Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.61457145770000.0
YER164W (CHD1)1468135649680.0
CAGL0L11770g1476135148020.0
Kwal_56.234421435146046600.0
KLLA0C17578g1525153046030.0
AGR123C1422133445630.0
Scas_665.17106057511641e-138
YOR304W (ISW2)112057511651e-138
Kwal_34.15925102558211461e-136
AFR537W102554211371e-135
CAGL0I09614g103958011341e-134
KLLA0F24838g106254211341e-134
AFL040W108658811161e-131
CAGL0C01683g111559411091e-130
Scas_652.17102559210901e-128
YBR245C (ISW1)112952010921e-127
KLLA0F06710g109660010741e-125
Scas_597.8106559710631e-124
Kwal_14.1600110252010591e-123
KLLA0F04521g134456910621e-122
AER375C128851810591e-121
Kwal_23.4777130156910561e-121
Scas_662.7134252910521e-120
YIL126W (STH1)135952910441e-119
Kwal_26.9164145456910361e-117
CAGL0G08756g135451810131e-115
KLLA0B08327g153456110191e-115
YOR290C (SNF2)170352810221e-114
Scas_594.7170352210171e-114
AFR562C144451710001e-112
CAGL0M04807g17305289981e-111
CAGL0J02662g8445618463e-96
KLLA0E04048g8265578435e-96
Kwal_47.180778095808337e-95
KLLA0F07513g10485466902e-74
ACR286C10195376874e-74
CAGL0H05533g19045436906e-73
AEL256C18665416871e-72
KLLA0E23804g18735406842e-72
Scas_664.918595436799e-72
Sklu_2125.310525286672e-71
Kwal_26.712310815466663e-71
YPL082C (MOT1)18675446744e-71
CAGL0H06193g11265386602e-70
KLLA0E22726g10335286563e-70
Scas_549.410795656565e-70
YAL019W (FUN30)11315366576e-70
YJR035W (RAD26)10855316556e-70
CAGL0I01694g10715306547e-70
AEL065C10255736403e-68
CAGL0M01188g14503655912e-61
Kwal_34.160827264825662e-60
ADR309W14863175771e-59
Scas_646.3*14563775752e-59
Kwal_55.2014314943265715e-59
KLLA0F21758g15723265708e-59
YDR334W15143275672e-58
KLLA0A03069g8954785572e-58
AGR379W14143345572e-57
Scas_669.2013973315554e-57
KLLA0E08965g14893275502e-56
CAGL0E05038g14843305483e-56
Scas_668.188754855384e-56
YGL150C (INO80)14893325474e-56
Kwal_14.15378424815303e-55
AEL297W8954865296e-55
Kwal_27.1138813343445359e-55
CAGL0I04224g9424775201e-53
Scas_520.58632845144e-53
YGL163C (RAD54)8984805137e-53
YFR038W8532865101e-52
AGL212W9034765065e-52
YBR073W (RDH54)9244815022e-51
KLLA0F11814g9315025013e-51
Scas_718.409264924985e-51
ADL098C8042894893e-50
CAGL0M01958g9205034852e-49
Kwal_27.105139004884682e-47
Sklu_1582.22831733841e-40
Scas_548.410543194122e-40
ADL345C7462052414e-20
KLLA0C05368g16051282327e-19
KLLA0B09240g8002092253e-18
YBR114W (RAD16)7902322244e-18
CAGL0K07766g8302242235e-18
CAGL0G09493g14083382183e-17
Scas_591.107721952163e-17
Kwal_23.36607681312146e-17
Kwal_14.186813573542075e-16
Scas_721.10011371362067e-16
AAR147W15801622068e-16
CAGL0A03432g11511382032e-15
YLR032W (RAD5)11691382003e-15
Scas_674.12d13231281952e-14
Kwal_47.177719721381942e-14
KLLA0F17479g11141341923e-14
AFR220W10851291871e-13
YOR191W (RIS1)16191621843e-13
Sklu_2412.711272911701e-11
YLR247C15561621592e-10
CAGL0B05049g14701301413e-08
Scas_573.915021191387e-08
KLLA0F12166g15281291333e-07
AAL030C15391291281e-06
Kwal_14.128715181341262e-06
Sklu_2234.210061631136e-05
Sklu_2432.914751021064e-04
CAGL0L03047g715113890.038
KLLA0F10505g812125880.042
AFR082C710100790.51
ADL273C623131761.0
CAGL0K03817g131748742.0
AFR251C86860742.0
Kwal_56.24760433124714.0
Scas_642.2*849115714.3
Scas_716.4220841678.4
Scas_700.2364096689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.6
         (1457 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.6                                                           2701   0.0  
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...  1918   0.0  
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...  1854   0.0  
Kwal_56.23442                                                        1799   0.0  
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...  1777   0.0  
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...  1762   0.0  
Scas_665.17                                                           452   e-138
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   453   e-138
Kwal_34.15925                                                         446   e-136
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   442   e-135
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   441   e-134
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   441   e-134
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   434   e-131
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   431   e-130
Scas_652.17                                                           424   e-128
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   425   e-127
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   418   e-125
Scas_597.8                                                            414   e-124
Kwal_14.1600                                                          412   e-123
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   413   e-122
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   412   e-121
Kwal_23.4777                                                          411   e-121
Scas_662.7                                                            409   e-120
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   406   e-119
Kwal_26.9164                                                          403   e-117
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   394   e-115
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   397   e-115
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   398   e-114
Scas_594.7                                                            396   e-114
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   389   e-112
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   389   e-111
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   330   3e-96
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   329   5e-96
Kwal_47.18077                                                         325   7e-95
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   270   2e-74
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   269   4e-74
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   270   6e-73
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   269   1e-72
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   268   2e-72
Scas_664.9                                                            266   9e-72
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           261   2e-71
Kwal_26.7123                                                          261   3e-71
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   264   4e-71
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   258   2e-70
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   257   3e-70
Scas_549.4                                                            257   5e-70
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   257   6e-70
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   256   6e-70
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   256   7e-70
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   251   3e-68
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   232   2e-61
Kwal_34.16082                                                         222   2e-60
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   226   1e-59
Scas_646.3*                                                           226   2e-59
Kwal_55.20143                                                         224   5e-59
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   224   8e-59
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   223   2e-58
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...   219   2e-58
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   219   2e-57
Scas_669.20                                                           218   4e-57
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   216   2e-56
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   215   3e-56
Scas_668.18                                                           211   4e-56
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   215   4e-56
Kwal_14.1537                                                          208   3e-55
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...   208   6e-55
Kwal_27.11388                                                         210   9e-55
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   204   1e-53
Scas_520.5                                                            202   4e-53
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   202   7e-53
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   201   1e-52
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   199   5e-52
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   197   2e-51
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   197   3e-51
Scas_718.40                                                           196   5e-51
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   192   3e-50
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   191   2e-49
Kwal_27.10513                                                         184   2e-47
Sklu_1582.2 , Contig c1582 197-1048                                   152   1e-40
Scas_548.4                                                            163   2e-40
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    97   4e-20
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    94   7e-19
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    91   3e-18
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    91   4e-18
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    91   5e-18
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    89   3e-17
Scas_591.10                                                            88   3e-17
Kwal_23.3660                                                           87   6e-17
Kwal_14.1868                                                           84   5e-16
Scas_721.100                                                           84   7e-16
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    84   8e-16
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    83   2e-15
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    82   3e-15
Scas_674.12d                                                           80   2e-14
Kwal_47.17771                                                          79   2e-14
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    79   3e-14
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    77   1e-13
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    75   3e-13
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          70   1e-11
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    66   2e-10
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    59   3e-08
Scas_573.9                                                             58   7e-08
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    56   3e-07
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    54   1e-06
Kwal_14.1287                                                           53   2e-06
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         48   6e-05
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              45   4e-04
CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces c...    39   0.038
KLLA0F10505g complement(966736..969174) some similarities with s...    39   0.042
AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH] (576175..57...    35   0.51 
ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C (...    34   1.0  
CAGL0K03817g 354005..357958 similar to sp|P39685 Saccharomyces c...    33   2.0  
AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH] (888186..8...    33   2.0  
Kwal_56.24760                                                          32   4.0  
Scas_642.2*                                                            32   4.3  
Scas_716.42                                                            30   8.4  
Scas_700.23                                                            31   9.4  

>Scas_576.6
          Length = 1457

 Score = 2701 bits (7000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1335/1457 (91%), Positives = 1335/1457 (91%)

Query: 1    MGSVKDLPNEILQNPELYGLRRSHRAPTHNYFEDEEDDEDAVKTSSRRGRKKSNVDPDVN 60
            MGSVKDLPNEILQNPELYGLRRSHRAPTHNYFEDEEDDEDAVKTSSRRGRKKSNVDPDVN
Sbjct: 1    MGSVKDLPNEILQNPELYGLRRSHRAPTHNYFEDEEDDEDAVKTSSRRGRKKSNVDPDVN 60

Query: 61   XXXXXXXXXXXXXXXXXXXXXXXYGSKGKKKHTRTIRKQKPKRTSRSKKGTXXXXXXXXF 120
                                   YGSKGKKKHTRTIRKQKPKRTSRSKKGT        F
Sbjct: 61   LDDDEDEEDLSELDDDEDDDDDDYGSKGKKKHTRTIRKQKPKRTSRSKKGTDDDDEEDEF 120

Query: 121  GVPVRFSERNNKTVNYNVDYSDDDLLVXXXXXXXXXXXXXXXXXXXXTGNRLEYSATPQL 180
            GVPVRFSERNNKTVNYNVDYSDDDLLV                    TGNRLEYSATPQL
Sbjct: 121  GVPVRFSERNNKTVNYNVDYSDDDLLVSEEDYDMNSDDEDEENDEEDTGNRLEYSATPQL 180

Query: 181  EDVHSIDMVITHKLKDGVDESVWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLGQ 240
            EDVHSIDMVITHKLKDGVDESVWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLGQ
Sbjct: 181  EDVHSIDMVITHKLKDGVDESVWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLGQ 240

Query: 241  IKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQR 300
            IKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQR
Sbjct: 241  IKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQR 300

Query: 301  VTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNYN 360
            VTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNYN
Sbjct: 301  VTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNYN 360

Query: 361  NSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAF 420
            NSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAF
Sbjct: 361  NSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAF 420

Query: 421  ISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTN 480
            ISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTN
Sbjct: 421  ISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTN 480

Query: 481  PYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKV 540
            PYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKV
Sbjct: 481  PYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKV 540

Query: 541  NNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPFI 600
            NNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPFI
Sbjct: 541  NNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPFI 600

Query: 601  LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSE 660
            LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSE
Sbjct: 601  LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSE 660

Query: 661  LKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRV 720
            LKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSG              DGHRV
Sbjct: 661  LKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGHRV 720

Query: 721  LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
            LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG
Sbjct: 721  LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780

Query: 781  GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
            GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR
Sbjct: 781  GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840

Query: 841  KKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDDV 900
            KKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDDV
Sbjct: 841  KKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDDV 900

Query: 901  LNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXXXXXX 960
            LNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIP                 
Sbjct: 901  LNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLKDEEQKRKDD 960

Query: 961  XYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRARNDLTSIGESEIRA 1020
             YIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRARNDLTSIGESEIRA
Sbjct: 961  EYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRARNDLTSIGESEIRA 1020

Query: 1021 IYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKEIMEK 1080
            IYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKEIMEK
Sbjct: 1021 IYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKEIMEK 1080

Query: 1081 LEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESFIGRA 1140
            LEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESFIGRA
Sbjct: 1081 LEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESFIGRA 1140

Query: 1141 EALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYGSWTQ 1200
            EALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYGSWTQ
Sbjct: 1141 EALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYGSWTQ 1200

Query: 1201 IRDDPFLGLTNKIFLNDSSSDPVMKKETAXXXXXXXXXXXXXXXXXXXPGAIHLGRRVDY 1260
            IRDDPFLGLTNKIFLNDSSSDPVMKKETA                   PGAIHLGRRVDY
Sbjct: 1201 IRDDPFLGLTNKIFLNDSSSDPVMKKETATNTTNTKKGKGVTGSSKKVPGAIHLGRRVDY 1260

Query: 1261 LISVMRDESQENTPSATATPTSGLKRKRQTKLSKPPTAKSSVNXXXXXXXXXXXXXXXXX 1320
            LISVMRDESQENTPSATATPTSGLKRKRQTKLSKPPTAKSSVN                 
Sbjct: 1261 LISVMRDESQENTPSATATPTSGLKRKRQTKLSKPPTAKSSVNSTPSSKRTKLTPKTLKK 1320

Query: 1321 XXXASKSVSNSPTPVNKKRTTSNMTPPGSENVIEKEYESMDEDECRHAMAPVRLSLKKLR 1380
               ASKSVSNSPTPVNKKRTTSNMTPPGSENVIEKEYESMDEDECRHAMAPVRLSLKKLR
Sbjct: 1321 VTKASKSVSNSPTPVNKKRTTSNMTPPGSENVIEKEYESMDEDECRHAMAPVRLSLKKLR 1380

Query: 1381 NGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKKHLWSYSSHFWPANVASA 1440
            NGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKKHLWSYSSHFWPANVASA
Sbjct: 1381 NGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKKHLWSYSSHFWPANVASA 1440

Query: 1441 KLMAMYDKIIATKESQA 1457
            KLMAMYDKIIATKESQA
Sbjct: 1441 KLMAMYDKIIATKESQA 1457

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
            ATP-dependent nucleosome remodeling activity, member of
            the Chromodomain-Helicase-DNA-binding (CHD) family [4407
            bp, 1468 aa]
          Length = 1468

 Score = 1918 bits (4968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 955/1356 (70%), Positives = 1081/1356 (79%), Gaps = 34/1356 (2%)

Query: 122  VPVRFSERNNKTVNYNVDYSDDDLLVXXXXXXXXXXXXXXXXXXXXTGNRLEYSATPQLE 181
            +P RFS R NKTVNYN+DYSDDDLL                       N  E SA PQ E
Sbjct: 123  IPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALSEE--------NVHEASANPQPE 174

Query: 182  DVHSIDMVITHKLKDGVDES--VWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLG 239
            D H ID+VI H+LK  ++E   + K V +L  CK+N +FLIKWTD+SHLHNTWETYES+G
Sbjct: 175  DFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIG 234

Query: 240  QIKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQ 299
            Q++GLKRLDNYCKQFII+DQQVRLDPY+T ED+E+MDME+ERRLDEF+EF +PERI+DSQ
Sbjct: 235  QVRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQ 294

Query: 300  RVTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNY 359
            R +L+DGTS+LQYLVKW+RLNYDEATWE A DIVK APEQVKHFQNR NSKILPQ S+NY
Sbjct: 295  RASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNY 354

Query: 360  NNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 419
              S RP+FEKL  QP ++K GELRDFQLTGINWMAFLWSK DNGILADEMGLGKTVQTVA
Sbjct: 355  T-SQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVA 413

Query: 420  FISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYT 479
            FISWLI+ARRQNGPHI+VVPLSTMPAW +TF+KWAPDLN ICYMGNQ+SRD IRE+EFYT
Sbjct: 414  FISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYT 473

Query: 480  NPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 539
            NP AKGKK +KFNVLLTTYEYILKDR+ELGSIKWQF+AVDEAHRLKNAESSLYESLNSFK
Sbjct: 474  NPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFK 533

Query: 540  VNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPF 599
            V NR+LITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQDEEQEEYI DLH+R+QPF
Sbjct: 534  VANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPF 593

Query: 600  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMS 659
            ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG+KGGHFSLLNIM+
Sbjct: 594  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMN 653

Query: 660  ELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHR 719
            ELKKASNHPYLFDNAEERVL+KFGDG+M+RENVLRGLIMSSG              DGHR
Sbjct: 654  ELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHR 713

Query: 720  VLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRA 779
            VLIFSQMVRMLDILGDYLSIKGI FQRLDGTVPSAQRRISIDHFN+PDS D VFLLSTRA
Sbjct: 714  VLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRA 773

Query: 780  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 839
            GGLGINLMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA
Sbjct: 774  GGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 833

Query: 840  RKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 899
            RKKMILEYAIISLGVTDG+KYTKKNEPN GELS ILKFGAGNMF A DNQKKLEDLNLDD
Sbjct: 834  RKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDD 893

Query: 900  VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXXXXX 959
            VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKAD+DWDDIIP                
Sbjct: 894  VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKD 953

Query: 960  XXYIKEQLDMMNRRDNALKKIKHSVNGDGT---TVDSDDESSSRTSKRRARNDLTSIGES 1016
              Y+KEQL+MMNRRDNALKKIK+SVNGDGT   +   DD +S  + +R   ND+ SIGES
Sbjct: 954  EEYVKEQLEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGES 1013

Query: 1017 EIRAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKE 1076
            E+RA+YKA+LK+G+L  + +ELI+DG LPVKS +KY E Y EMME A++ +H EE  RKE
Sbjct: 1014 EVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKE 1073

Query: 1077 IMEKLEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESF 1136
            I+EKLEK A  YR KLKSGEIK ++QPKDNP   L++K++EKKA+LF F  VKSLNAES 
Sbjct: 1074 ILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESL 1133

Query: 1137 IGRAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYG 1196
            + R E L +L+  I+ ++KDDPLKF + N +PK VQNWSSNW KE+DEKLL+GVFKYGYG
Sbjct: 1134 LSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYG 1193

Query: 1197 SWTQIRDDPFLGLTNKIFLNDSSSDPVMKKETAXXXXX---XXXXXXXXXXXXXXPGAIH 1253
            SWTQIRDDPFLG+T+KIFLN+   +PV KK  +                      PGAIH
Sbjct: 1194 SWTQIRDDPFLGITDKIFLNE-VHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIH 1252

Query: 1254 LGRRVDYLISVMRDESQENTPSA----TATPTSGLKRKRQTKLSK------PPTAKSSVN 1303
            LGRRVDYL+S +R      +PSA       PT G  +KRQ K +       P    S   
Sbjct: 1253 LGRRVDYLLSFLRGGLNTKSPSADIGSKKLPT-GPSKKRQRKPANHSKSMTPEITSSEPA 1311

Query: 1304 XXXXXXXXXXXXXXXXXXXXASKSVSNSPTP-----VNKKRTTSNMTPPGSENVIEKEYE 1358
                                 ++   NSPTP     V++   T   + P S +  EKEY+
Sbjct: 1312 NGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYD 1371

Query: 1359 SMDEDECRHAMAPVRLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDP 1418
            SMDE++CRH M+ +R SLK+LR G K LDRKE+A +LK+ELT IG+HIESQKG+S+K  P
Sbjct: 1372 SMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASP 1431

Query: 1419 VNFKKHLWSYSSHFWPANVASAKLMAMYDKIIATKE 1454
              ++KHLWSYS++FWPA+V S KLMAMYDKI  +++
Sbjct: 1432 EKYRKHLWSYSANFWPADVKSTKLMAMYDKITESQK 1467

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
            Saccharomyces cerevisiae YER164w CHD1 transcriptional
            regulator, start by similarity
          Length = 1476

 Score = 1854 bits (4802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 925/1351 (68%), Positives = 1056/1351 (78%), Gaps = 26/1351 (1%)

Query: 121  GVPVRFSERNNKTVNYNVDYSDDDLLVXXXXXXXXXXXXXXXXXXXXTGNRLEYSATPQL 180
             +P RFS R NK VNYN+DYSDDDLL                            S TP  
Sbjct: 135  AIPTRFSSRANKQVNYNIDYSDDDLLESEEEFDSDEDELLDEDQESRA-----RSNTPPQ 189

Query: 181  EDVHSIDMVITHKLKDGVD-ESVWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLG 239
            EDVH IDMVITH++K+G D E + K V  L  CK+N +F IKWTDQSHLHNTWETYESL 
Sbjct: 190  EDVHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLA 249

Query: 240  QIKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQ 299
             +KG+KRLDNYCKQ+IIQ+QQVRLDPYITPED+E+MDME ERRLDE QEFT PERI+DSQ
Sbjct: 250  GVKGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQ 309

Query: 300  RVTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNY 359
            RV L+DGTS+LQYLVKW+ LNYDEATWE AA+IVK APE VKHFQ+R NSKILPQ S+NY
Sbjct: 310  RVELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNY 369

Query: 360  NNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 419
              S RP+FEKL  QP ++K GELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA
Sbjct: 370  T-SERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 428

Query: 420  FISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYT 479
            FISWLI+ARRQNGPH+VVVPLSTMPAW ETF+KWAPD++VICYMGNQ+SRD  RE+EFY+
Sbjct: 429  FISWLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYS 488

Query: 480  NPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 539
            NP  KGKK IKFNVL+TTYEYILKDR+ELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK
Sbjct: 489  NPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 548

Query: 540  VNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPF 599
            V NRLLITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQDEEQE+YIRDLHKRLQPF
Sbjct: 549  VANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPF 608

Query: 600  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMS 659
            ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG+KGG FS+LNIM+
Sbjct: 609  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMN 668

Query: 660  ELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHR 719
             L KASNHPYLFD+AEE+VL+KFG G MSREN+LRGLIMSSG              DGHR
Sbjct: 669  TLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGKMVLLDKLLTRLKKDGHR 728

Query: 720  VLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRA 779
            VLIFSQMVR+LDILGDYLSIKGI FQRLDGTVPS QRRI+IDHFNAP S D VFLLSTRA
Sbjct: 729  VLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRA 788

Query: 780  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 839
            GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA
Sbjct: 789  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 848

Query: 840  RKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 899
            RKKMILEYAIISLGVTDG+KYTKK EP+ GELSEILKFGAGNMFAAKDNQKKLEDLNLDD
Sbjct: 849  RKKMILEYAIISLGVTDGNKYTKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 908

Query: 900  VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXXXXX 959
            VL+HAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIP                
Sbjct: 909  VLSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLQDEEQRHKD 968

Query: 960  XXYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRAR-NDLTSIGESEI 1018
              Y+KEQL+MMNRR+NALKKIK SVNG+G+TV SDDE   R+S+RRA+ NDL SIG+SE+
Sbjct: 969  EEYVKEQLEMMNRRNNALKKIKDSVNGEGSTVTSDDE-DGRSSRRRAKTNDLNSIGDSEV 1027

Query: 1019 RAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKEIM 1078
            RA+Y+AVL++GD+T+  +ELI+DG LPVKSI+KY+E+  E+++ A+     E+ KR + +
Sbjct: 1028 RALYRAVLRFGDVTDKLDELIADGTLPVKSIEKYKEILEELLDEAKSIYEEEDTKRTQTL 1087

Query: 1079 EKLEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESFIG 1138
             + E  AHEY++KLK+GEIK ++Q KDNP   L MKR+EKKAILFTF+ VKSLNAES + 
Sbjct: 1088 REFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLNAESIVN 1147

Query: 1139 RAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYGSW 1198
            R   L+F+  Y   HFK+DPL+F      PK V NW+ +WN+ DDEKL+VG+ KYGYG+W
Sbjct: 1148 RCRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAW 1207

Query: 1199 TQIRDDPFLGLTNKIFLNDSSS---DPVMKKETAXXXXXXXXXXXXXXXXXXXPGAIHLG 1255
             QIRDDPFLGLTNKIFL+D SS   D V ++                      PGA+HLG
Sbjct: 1208 AQIRDDPFLGLTNKIFLSDVSSAATDKVKEEVKQETPDATGGKRSKGRESKKVPGALHLG 1267

Query: 1256 RRVDYLISVMRDESQENTPSATATPTSGLKRKRQT---KLSKPPTAKSSVNXXXXXXXXX 1312
            RRVDYLI  ++++ +  T ++ ++  S   RK      K ++ P   SS +         
Sbjct: 1268 RRVDYLIDFLQNDGKPTTGASGSSSISESSRKTAANPRKRNRKPNNTSSFSETSASGTPE 1327

Query: 1313 XXXXXXXXXXXAS-KSVSNSPTPV---NKK-----RTTSNMTPPGSENVIEKEYESMDED 1363
                          K++   P  +   NKK     R  +     G+     KEY+SMDE+
Sbjct: 1328 LGKLDSPGQPTKRIKALPKGPASLVSRNKKTNSPQRDGNKENENGTSGAHAKEYDSMDEE 1387

Query: 1364 ECRHAMAPVRLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKK 1423
            ECRH M  +R SLK+LR G KGLDR+E+A +LKSELT IGD+IE+Q    K  +P   +K
Sbjct: 1388 ECRHTMTSMRSSLKRLRRGGKGLDRREWAKILKSELTAIGDYIEAQ--AKKNKNPDRHRK 1445

Query: 1424 HLWSYSSHFWPANVASAKLMAMYDKIIATKE 1454
            HLWSYSS+FWPA V SAKLM MY KI + ++
Sbjct: 1446 HLWSYSSNFWPAAVKSAKLMEMYKKITSAEK 1476

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%)

Query: 4  VKDLPNEILQNPELYGLRRSHRAPTHNYFEDEEDDEDAVKTSSRRGR 50
          +K++  E+LQNPELYGLRRSHRA  H  + D+E+DED V   +R+ R
Sbjct: 1  MKEIDEEVLQNPELYGLRRSHRAVAHRPYVDDEEDEDDVPVKTRKRR 47

>Kwal_56.23442
          Length = 1435

 Score = 1799 bits (4660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 923/1460 (63%), Positives = 1086/1460 (74%), Gaps = 39/1460 (2%)

Query: 3    SVKDLPNEILQNPELYGLRRSHRAPTH---NYFEDEEDDEDAVKTSSRRGRKKSNVDPDV 59
            + KD+  ++L NPELYGLRRS RA       YF D+++DED V T SRRGRK    D   
Sbjct: 2    ATKDVAMDMLDNPELYGLRRSGRAAASVQTRYFSDDDEDEDQVVT-SRRGRKAKQDD--- 57

Query: 60   NXXXXXXXXXXXXXXXXXXXXXXXYGSKGKKKHTRTIRKQKPKRTSRSKKGTXXXXXXXX 119
                                         +  H R+    KP+   +    T        
Sbjct: 58   ----GFSSDRLSEEDEVSDESDSMADDDSEVVHGRS----KPRPKKKVATKTKKRTPSEE 109

Query: 120  FGVPVRFSERNNKTVNYNVDYSDDDLLVXXXXXXXXXXXXXXXXXXXXTGNRLEYSATPQ 179
              +P RFS RNN++VNYNVDYSD+DLL                          +Y+ TP 
Sbjct: 110  IELPTRFSSRNNRSVNYNVDYSDEDLLESETEQADADM------------EEYDYTPTPS 157

Query: 180  LEDVHSIDMVITHKLKDGVDESVWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLG 239
             +D   ID+VITH+LK   +ES  K + ++  CK N +FLIKW D+SHLHN+WETY  +G
Sbjct: 158  SQDGQGIDLVITHRLKPDTEES--KDIPDVATCKTNYEFLIKWVDESHLHNSWETYADIG 215

Query: 240  QIKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQ 299
            Q++G+K++DNY KQFII D+Q+R DPY T ED+EVMD+E+ERRLDEF+E+ IPERI+DS 
Sbjct: 216  QVRGIKKIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSD 275

Query: 300  RVTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNY 359
            RVTL+DG+S+LQY VKW+RLNYDEATWE+A  IVK APEQVKHFQNRINSKILPQ S++Y
Sbjct: 276  RVTLEDGSSQLQYQVKWRRLNYDEATWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHY 335

Query: 360  NNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 419
              S RP+FEKLVEQPS++K GELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA
Sbjct: 336  -GSERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVA 394

Query: 420  FISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYT 479
            FISWLIYARRQNGPH+VVVPLSTMPAWQETF+KWAPDLN I ++GNQ+SRDAIRE EF+T
Sbjct: 395  FISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFT 454

Query: 480  NPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 539
            NP AK KK+ KFNVLLTTYEYILKDR+ELG+IKWQFLAVDEAHRLKNAESSLYESLNSFK
Sbjct: 455  NPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFK 514

Query: 540  VNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPF 599
            V NRLLITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQD EQE YIRDLH RLQPF
Sbjct: 515  VANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPF 574

Query: 600  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMS 659
            ILRRLKKDVEKSLPSKTERILRVELSDVQT+YYKNILTKNYSAL+AGSKG HFSLLNIM+
Sbjct: 575  ILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMN 634

Query: 660  ELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHR 719
            ELKKASNHPYLFD AE+RVL KFGDG+MSREN+LRGLIMSSG              DGHR
Sbjct: 635  ELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHR 694

Query: 720  VLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRA 779
            VLIFSQMVRMLDILGDYL+IKGIT+QRLDGTVPSAQRRISIDHFNAPDS D VFLLSTRA
Sbjct: 695  VLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRA 754

Query: 780  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 839
            GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERA
Sbjct: 755  GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERA 814

Query: 840  RKKMILEYAIISLGVTDGSKYT--KKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNL 897
            RKKMILEYAIISLGVTDGS  T  KK++P+ GELSEILKFGAGNMF A DNQ+KLEDLNL
Sbjct: 815  RKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNL 874

Query: 898  DDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXXX 957
            DDVLNHAEDHVTTPDLGESHLGGEEFL+QFEVTDYKADV+WDDIIP              
Sbjct: 875  DDVLNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWDDIIPEEELKKLKDEEQKR 934

Query: 958  XXXXYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRAR-NDLTSIGES 1016
                Y++EQL +MNRR+NAL +IK SVNG G     D+E  +  SKR++R ++L S GE 
Sbjct: 935  MDEEYVQEQLQLMNRRNNALNRIKASVNGSGINNGDDNEDENTGSKRKSRMSNLDSFGER 994

Query: 1017 EIRAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKE 1076
            E+RAIYK +L+YG+L + FEELI+DG+LPVK+ID Y  +Y EM+  A+  +  EE KR  
Sbjct: 995  EVRAIYKCILRYGNLDDKFEELIADGSLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSA 1054

Query: 1077 IMEKLEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESF 1136
                LEK A  YR KLK+   + D++ K NP A+LA K+KEKKA+LF FYDVKSLNAE+ 
Sbjct: 1055 AFASLEKSAQAYREKLKAHGQQLDEKDKSNPIAKLAAKKKEKKAVLFEFYDVKSLNAETI 1114

Query: 1137 IGRAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYG 1196
            + R + + FL  ++ +++ DDPLKF   N+ PK V NW+ +W+KEDDEKLLVGV KYGYG
Sbjct: 1115 LTRPDEMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYG 1174

Query: 1197 SWTQIRDDPFLGLTNKIFLNDSSSDPVMKKETAXXXXXXXXXXXXXXXXXXXPGAIHLGR 1256
            +W QIRDDPFLGL++KIFLN+  ++    K                      PG++HLGR
Sbjct: 1175 AWAQIRDDPFLGLSDKIFLNEPQTN--NGKADNISAADQKTKNSGAGGSKKVPGSVHLGR 1232

Query: 1257 RVDYLISVMRDESQEN----TPSATATPTSGLKRKRQTKLSKPPTAKSSVNXXXXXXXXX 1312
            R DYL +V++DE + +    T S  ++P  G     + ++ K PT++S+           
Sbjct: 1233 RTDYLFAVLKDEIKPHTSSGTNSGNSSPLPGASTGSKKRVRKAPTSRSATPDAKADEIRS 1292

Query: 1313 XXXXXXXXXXXASKSVSNSPTPVNKKRTTSNMTPPGSENVIEKEYESMDEDECRHAMAPV 1372
                          S         K ++    T P   +  +KEY+SM+E+EC+ AM P+
Sbjct: 1293 GPAKRVKKMGMGRSSPPPLVATARKAKSVKGGTAPRGNSAPDKEYDSMEEEECKAAMQPM 1352

Query: 1373 RLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKKHLWSYSSHF 1432
            + SLK+L  G KGLDRKE+A +LK EL  +GDHIE++K +SKK  P  F+KHLW++SSH+
Sbjct: 1353 KNSLKRLSRGGKGLDRKEWATILKEELRTVGDHIETKKVSSKKYPPEKFRKHLWAFSSHY 1412

Query: 1433 WPANVASAKLMAMYDKIIAT 1452
            WPA V S+KLMAMYDKI+A+
Sbjct: 1413 WPAEVKSSKLMAMYDKIVAS 1432

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
            cerevisiae YER164w CHD1 transcriptional regulator, start
            by similarity
          Length = 1525

 Score = 1777 bits (4603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 923/1530 (60%), Positives = 1095/1530 (71%), Gaps = 87/1530 (5%)

Query: 4    VKDLPNEILQNPELYGLRRSHRAP-THNYFEDEEDDEDAVKTSSRRGRKKSNVDPDVNXX 62
            V+DLP+E+L NPELYGLRRSHRA  THN +   + D D      RRG++K      V   
Sbjct: 2    VQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDEEVIRPRRGKQKRKA---VKQE 58

Query: 63   XXXXXXXXXXXXXXXXXXXXXYGSKGKKKHTRTI---RKQKPKRTSRSKKGTXXXXXXXX 119
                                 +GSK K     +    RK+     S+SK+          
Sbjct: 59   HNYDEEEEEEEEIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESDE 118

Query: 120  FGV--PVRFSERNN-KTVNYNV-DYSDDDLLVXXXXXXXXXXXXXXXXXXXXTGNRLEYS 175
              V  P RFS RNN K +NY + D S+D+ L+                     G    YS
Sbjct: 119  ENVVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDG----YS 174

Query: 176  ATPQ-LEDVHSIDMVITHKLKDGVDES--VWKKVMNLQECKDNIQFLIKWTDQSHLHNTW 232
            A+P   ++ HSID+V+ H+LK+GVD S     +  ++   + N +FLIKW DQSHLHN+W
Sbjct: 175  ASPSPQQETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSW 234

Query: 233  ETYESLGQ--IKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFT 290
            E+YE L +   KGLKR++NY KQFII DQ+VR DPY T ED+EVMD+E ERR+DEF+EF 
Sbjct: 235  ESYEDLKENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFK 294

Query: 291  IPERIVDSQRVTLDDGT--SELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRIN 348
            +PERI+DS+R   +DG+  S+L+YLVKW+RLNYDE TWE A++IVK APEQVK FQNR N
Sbjct: 295  VPERIIDSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTN 354

Query: 349  SKILPQNSTNYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADE 408
            SKI+PQNS+NY  + RPKFEKL  QPS++K GELRDFQLTGINWMAFLWSKNDNGILADE
Sbjct: 355  SKIMPQNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADE 414

Query: 409  MGLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRS 468
            MGLGKTVQTV+FISWLIYARRQNGPH+VVVPLSTMPAWQETFDKWAP LN + YMGNQ S
Sbjct: 415  MGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQAS 474

Query: 469  RDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAE 528
            RD I+++EFYTNP AKGKK++KFNVLLTTYEYILKDRS LGSIKWQFLAVDEAHRLKNAE
Sbjct: 475  RDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAE 534

Query: 529  SSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEY 588
            SSLYESLNSFKV NRLLITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQDE+QEEY
Sbjct: 535  SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEY 594

Query: 589  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSK 648
            IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT+G K
Sbjct: 595  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIK 654

Query: 649  GGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXX 708
            GGH SLLN+M+ELKKASNHPYLFDNAEERVL KFGDG  SREN+LRGLIMSSG       
Sbjct: 655  GGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDK 714

Query: 709  XXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDS 768
                   DGHRVLIFSQMVR+LDILGDYLSIKGI FQRLDGTVPSAQRRISIDHFNA DS
Sbjct: 715  LLTRLKKDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDS 774

Query: 769  TDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSK 828
             D VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSK
Sbjct: 775  NDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSK 834

Query: 829  DTVEEEVLERARKKMILEYAIISLGVTDGSKY--TKKNEPNPGELSEILKFGAGNMFAAK 886
            DTVEEEVLERARKKMILEYAIISLGVTDG+K   TKKNEP+ GELSEILKFGAGNMF   
Sbjct: 835  DTVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPN 894

Query: 887  DNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXX 946
            DNQ+KLEDLNLD+VLNHAEDH+TTP+LGES+LGGEEFL+QFEVTDYKADVDWDDIIP   
Sbjct: 895  DNQQKLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPEDE 954

Query: 947  XXXXXXXXXXXXXXXYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRA 1006
                           Y++EQLD+MNR+  A+ KIK SVNG+    DS+DE +S++ KR  
Sbjct: 955  LKKLKDEEQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSEDEGNSKSRKRSK 1014

Query: 1007 RNDLTSIGESEIRAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVAREN 1066
             N+L + GE EIRA+YK +L++GD+ N FEELI+DG+LPVKSID+Y+E+Y EM+  A   
Sbjct: 1015 ANNLDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETL 1074

Query: 1067 LHSEEAKRKEIMEKLEKKAHEYRLKLKSGEIKP-DDQPKDNPNAELAMKRKEKKAILFTF 1125
            +  EEAKR EI  KLEK A EYR K+K+ EIKP DD  K+ P   L+ KR+EK+AILF F
Sbjct: 1075 MRDEEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEF 1134

Query: 1126 YDVKSLNAESFIGRAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEK 1185
            +D K+LNA++ + R + L FL  ++  ++KDDPL+F   N++PK V  W+  W KEDDEK
Sbjct: 1135 HDTKALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEK 1194

Query: 1186 LLVGVFKYGYGSWTQIRDDPFLGLTNKIFLND------------------------SSSD 1221
            LL+G++KYGYG+W QIRDDPFLGLT K+FLN+                         SS 
Sbjct: 1195 LLIGIYKYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKAATPAAPSLTPSAPGASVAGSST 1254

Query: 1222 P---VMKKETAXXXX-----XXXXXXXXXXXXXXXPGAIHLGRRVDYLISVMRDESQ--E 1271
            P    +K ET                         PGA+HLGRRVDYL +V+RDE++  +
Sbjct: 1255 PGADAVKTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGPQ 1314

Query: 1272 NTPS--------ATATPTSGLKRKRQTKLSK-------------PPTAKSSVNXXXXXXX 1310
              PS         T TP    ++ +++  +               P+  +SVN       
Sbjct: 1315 TDPSHPAGSSSTGTTTPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDST 1374

Query: 1311 XXXXXXXXXXXXXASKSVSN-SPTPV------NKKRTTSNMTPPGSENVIEKEYESMDED 1363
                           +  S+ S TPV       +K     + P     + +KEY+SMDE+
Sbjct: 1375 PDNSSETKRGKAHHHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSMDEE 1434

Query: 1364 ECRHAMAPVRLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKK 1423
            EC+  M  VR SLK+LR+G  GL+RK++A++LK EL  +GD+IES K  S KT P  +K+
Sbjct: 1435 ECKKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPEKYKR 1494

Query: 1424 HLWSYSSHFWPANVASAKLMAMYDKIIATK 1453
            HLWS+++++WP +V S+KL+AMYDKI A++
Sbjct: 1495 HLWSFTAYYWPRDVPSSKLLAMYDKIKASE 1524

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..985231)
            [4269 bp, 1422 aa]
          Length = 1422

 Score = 1762 bits (4563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/1334 (66%), Positives = 1025/1334 (76%), Gaps = 27/1334 (2%)

Query: 122  VPVRFSERNNKTVNYNVDYSDDDLLVXXXXXXXXXXXXXXXXXXXXTGNRLEYSATPQLE 181
            +P RFS RNNK VNYN+DYSDDDLL                      G    Y+ TPQ+ 
Sbjct: 108  LPTRFSSRNNKAVNYNIDYSDDDLL--------ESAEEEYEGDEGDEGEEEAYAQTPQIP 159

Query: 182  DVHSIDMVITHKLKDGVDESV-WKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESLGQ 240
            D H ID V+TH+L +G  E V W    ++ ECK+  +FLIKW ++SH+HNTWET ESLG 
Sbjct: 160  DEHGIDFVVTHRLHEGHTEPVEW----DVPECKECYEFLIKWNNESHIHNTWETAESLGN 215

Query: 241  IKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDSQR 300
            ++G+K++DNY KQ+I+ D ++R D Y T ED+EVMD+E ERR DEF+EF   ERI+DS R
Sbjct: 216  VRGVKKVDNYIKQYILLDHELRTDKYTTREDIEVMDLEHERRCDEFEEFKKVERIIDSDR 275

Query: 301  VTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNYN 360
            VTLDDG+S+LQYLVKWKRLNYDEATWE A+ IVK APE+VK FQ+R +SKILPQ+S+NY 
Sbjct: 276  VTLDDGSSQLQYLVKWKRLNYDEATWENASVIVKMAPEEVKRFQSRSSSKILPQHSSNYG 335

Query: 361  NSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAF 420
             S RP FEKL  QPS++K GELRDFQLTGINWMAFLWSK+DNGILADEMGLGKTVQTV+F
Sbjct: 336  -SQRPGFEKLSVQPSFIKGGELRDFQLTGINWMAFLWSKSDNGILADEMGLGKTVQTVSF 394

Query: 421  ISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTN 480
            ISWLI+ARRQNGPH+VVVPLSTMPAWQETF+KWAP+LN + YMGNQ+SRD IRE+EFYTN
Sbjct: 395  ISWLIFARRQNGPHLVVVPLSTMPAWQETFEKWAPELNCVYYMGNQKSRDVIREYEFYTN 454

Query: 481  PYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKV 540
            P+ KGKKNIKFNVLLTTYEYILKDR ELG+IKWQFLAVDEAHRLKNAESSLYESL+SFKV
Sbjct: 455  PHTKGKKNIKFNVLLTTYEYILKDRLELGAIKWQFLAVDEAHRLKNAESSLYESLSSFKV 514

Query: 541  NNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPFI 600
             NR+LITGTPLQNNIKELAAL+NFLMPG+FTIDQEIDFENQDE+QE YIRDLHKRLQP+I
Sbjct: 515  ANRMLITGTPLQNNIKELAALVNFLMPGKFTIDQEIDFENQDEKQENYIRDLHKRLQPYI 574

Query: 601  LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSE 660
            LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNY+ALTAG+KG HFSLLNIM+E
Sbjct: 575  LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYNALTAGTKGTHFSLLNIMNE 634

Query: 661  LKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRV 720
            LKKASNHPYLF NAE RVL KFGDG  SREN+LRGLIMSSG              DGHRV
Sbjct: 635  LKKASNHPYLFGNAENRVLAKFGDGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRV 694

Query: 721  LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
            LIFSQMVRMLDILGDYLSIKGI FQRLDGTVPS+QRRISIDHFNAPDS D VFLLSTRAG
Sbjct: 695  LIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAG 754

Query: 781  GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
            GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERAR
Sbjct: 755  GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 814

Query: 841  KKMILEYAIISLGVTDGSKYTKKN--EPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLD 898
            KKMILEYAIISLGVTDG+KYT K+  EP+ GELSEILKFGAGNMF A DNQKKLEDLNLD
Sbjct: 815  KKMILEYAIISLGVTDGNKYTSKSKAEPSAGELSEILKFGAGNMFKAHDNQKKLEDLNLD 874

Query: 899  DVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPXXXXXXXXXXXXXXX 958
            DVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADV+WDDIIP               
Sbjct: 875  DVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVEWDDIIPEDELRKLKDEEQKRK 934

Query: 959  XXXYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRARNDLTSIGESEI 1018
               Y++EQL MMNRR+ AL KIK+SVNGDG    SD E  SR+ KR   N+L SIGE EI
Sbjct: 935  DEEYVQEQLQMMNRRNVALNKIKNSVNGDGAQSLSDKE-DSRSKKRAKSNNLNSIGEREI 993

Query: 1019 RAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRKEIM 1078
            RA+YKA+LKYGDLT    +LI+DG LPVKS++KY E+Y E+M +AR+ ++ EE+KR E +
Sbjct: 994  RALYKAILKYGDLTERLGDLIADGTLPVKSLEKYGELYDELMSIARKQINDEESKRNEAI 1053

Query: 1079 EKLEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAESFIG 1138
             +LE+   EY+ K+KSGEIKPDD  KD P A LA KR+EK+A+LF FY++K LNAE+ + 
Sbjct: 1054 SRLERDVEEYKTKVKSGEIKPDDNAKDLPIARLAAKRREKRAVLFEFYEIKGLNAETIVN 1113

Query: 1139 RAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGYGSW 1198
            R + L FL  ++  ++  DP+KF   NR PK + NW+  W +EDDEKLLVGV KYGYGSW
Sbjct: 1114 RTDDLRFLHNFLKNNYPSDPMKFRFLNRLPKPITNWNCTWTQEDDEKLLVGVDKYGYGSW 1173

Query: 1199 TQIRDDPFLGLTNKIFLNDSSSDPVMKKETAXXXXXXXXXXXXXXXXXXXPGAIHLGRRV 1258
            +Q+RDDPFLGL++KIFLN+  +        A                   PG++HLGRRV
Sbjct: 1174 SQVRDDPFLGLSDKIFLNEPGTQ--TNDSAAADADAADKKTRLANAAKKVPGSVHLGRRV 1231

Query: 1259 DYLISVMRDESQENTPSATATPTSGLKRKRQTKLSKPPTAKSSVNXXXXXXXXXXXXXXX 1318
            DYL++V+R+E++      T +  +        K ++  +  S                  
Sbjct: 1232 DYLLTVLREEAK-----GTDSAAAPQAALAAKKRARKSSGSSKSATPDARPEDSPSIKRT 1286

Query: 1319 XXXXXASKSVSNSPTPVNKKRTTSNMTPPGSENVIEKEYESMDEDECRHAMAPVRLSLKK 1378
                 AS+  S SP P  K+      +P      +E+EYESMDEDECR  M  VR SLK+
Sbjct: 1287 RALPAASRPSSGSPGPQLKRNGKKQASPKAP---MEREYESMDEDECRRTMHSVRASLKR 1343

Query: 1379 LRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKKHLWSYSSHFWPANVA 1438
            L+ G  GLDR E+A +LK EL  +G++IE  KG S   D   FK+HLWSYS+ FWPA V 
Sbjct: 1344 LKRGGAGLDRNEWAAILKRELLAVGNYIERHKGDSADRDRAQFKRHLWSYSAQFWPAQVK 1403

Query: 1439 SAKLMAMYDKIIAT 1452
            S+K+MAMYDK+ A+
Sbjct: 1404 SSKIMAMYDKLAAS 1417

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 4  VKDLPNEILQNPELYGLRRSHRAP----THNYFEDEEDDEDAVKTSSRRGRKKSNVDPD 58
           KDLP+E+L NPELYGLRRSHR P    T   + +  DDED+V  S R  ++K  +D D
Sbjct: 2  AKDLPDEVLANPELYGLRRSHRTPVGGSTQATYYESNDDEDSVVVSGRGRKRKKAIDID 60

>Scas_665.17
          Length = 1060

 Score =  452 bits (1164), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 241/575 (41%), Positives = 362/575 (62%), Gaps = 32/575 (5%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P+++K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L Y ++ +
Sbjct: 127 ESPAFIKGGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKKID 186

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP ++VVP ST+  W+  F+KW P++N I   G++  R  I  ++             KF
Sbjct: 187 GPFLIVVPKSTLDNWRREFNKWTPEVNAIVLHGDKEERHKIL-YDIVLEA--------KF 237

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           +VL+T+YE ++K+++ L    WQ++ +DEAHR+KN +S L + +  F   NRLLITGTPL
Sbjct: 238 DVLITSYEMVIKEKNVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPL 297

Query: 552 QNNIKELAALINFLMPGRF----TIDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F      D+  +  N +++QE  ++ LH  L PF+LRR+K D
Sbjct: 298 QNNLHELWALLNFLLPDVFGDSGIFDEWFEQNNSEQDQEIVVQQLHTVLNPFLLRRIKAD 357

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGSKGGHFSLLNIMSELKKAS 665
           VEKSL  K E  + V ++++Q ++YK++L K+  A+    G + G   LLNI+ +L+K  
Sbjct: 358 VEKSLLPKIETNVYVGMTEMQVKWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCC 417

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLF+ AE       G    + E+    L+ ++G               G RVLIFSQ
Sbjct: 418 NHPYLFEGAEP------GPPYTTDEH----LVFNAGKMIVLDKLLKRLKEKGSRVLIFSQ 467

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +G  + R+DG+     R  +ID +N P+S   VFLL+TRAGGLGIN
Sbjct: 468 MSRLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGIN 527

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L+TADTVI++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+ L
Sbjct: 528 LVTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRL 587

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLNHAE 905
           +  +I  G     K T     N  +L E++++GA NMF  K+ Q+  +D ++D++L   +
Sbjct: 588 DQLVIQQGT---GKKTASLGSNKDDLLEMIQYGAKNMFENKE-QQITKDADIDEILKKGQ 643

Query: 906 DHVTTPDLGESHLG-GEEFLKQFEVTDYKADVDWD 939
             + T +L   +   G + L++F   D ++  +W+
Sbjct: 644 --LKTKELNAKYQALGLDDLQKFNDVDNQSAYEWN 676

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  453 bits (1165), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 243/575 (42%), Positives = 361/575 (62%), Gaps = 32/575 (5%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E PS+VK G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L Y ++  
Sbjct: 174 ESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIE 233

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSR-DAIREFEFYTNPYAKGKKNIK 490
           GP +++VP ST+  W+  F KW P++NV+   G++ +R D +R                +
Sbjct: 234 GPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL----------EAR 283

Query: 491 FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTP 550
           F+VL+T+YE ++++++ L  + WQ++ +DEAHR+KN +S+L + +  F   NRLLITGTP
Sbjct: 284 FDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTP 343

Query: 551 LQNNIKELAALINFLMPGRF----TIDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLKK 606
           LQNN+ EL AL+NFL+P  F      D+  +  N +++QE  I+ LH  L PF+LRR+K 
Sbjct: 344 LQNNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKA 403

Query: 607 DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGSKGGHFSLLNIMSELKKA 664
           DVEKSL  K E  + V ++D+Q ++YK++L K+  A+    G + G   LLNI+ +L+K 
Sbjct: 404 DVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKC 463

Query: 665 SNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFS 724
            NHPYLF+ AE       G    + E+    LI +SG               G RVLIFS
Sbjct: 464 CNHPYLFEGAEP------GPPYTTDEH----LIFNSGKMIILDKLLKRLKEKGSRVLIFS 513

Query: 725 QMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGI 784
           QM R+LDIL DY   +   + R+DG+    +R  +ID +N P+S   VFLL+TRAGGLGI
Sbjct: 514 QMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGI 573

Query: 785 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 844
           NL+TADTVI+FDSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+ 
Sbjct: 574 NLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLR 633

Query: 845 LEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLNHA 904
           L+  +I  G     K T     +  +L ++++FGA NMF  K ++  + D ++DD+L   
Sbjct: 634 LDQLVIQQGT---GKKTASLGNSKDDLLDMIQFGAKNMFEKKASKVTV-DADIDDILKKG 689

Query: 905 EDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 939
           E      +     LG ++ L++F   + ++  +W+
Sbjct: 690 EQKTQELNAKYQSLGLDD-LQKFNGIENQSAYEWN 723

>Kwal_34.15925
          Length = 1025

 Score =  446 bits (1146), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 248/582 (42%), Positives = 355/582 (60%), Gaps = 42/582 (7%)

Query: 370 LVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 429
           L E PSY+K G LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT+AF+ +L Y + 
Sbjct: 117 LTESPSYIKSGVLRDYQVQGLNWLLSLHDNRLSGILADEMGLGKTLQTIAFLGYLRYLKD 176

Query: 430 QNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSR-----DAIREFEFYTNPYAK 484
            +GPHIV+VP ST+  W+  F KW P++  +   G++  R     D + E          
Sbjct: 177 IDGPHIVIVPKSTLNNWKREFSKWTPEVEAVVLSGDKEERQHLLKDIVLE---------- 226

Query: 485 GKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRL 544
                KF+VL+T+YE ++K++S L    WQ++ VDEAHR+KN +S+L + +  F   +RL
Sbjct: 227 ----CKFDVLITSYEMVIKEKSTLKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRL 282

Query: 545 LITGTPLQNNIKELAALINFLMPGRFTIDQEID--FENQDEE--QEEYIRDLHKRLQPFI 600
           LITGTPLQNN+ EL AL+NFL+P  F      D  FE  D E  Q+  ++ LH  L PF+
Sbjct: 283 LITGTPLQNNLHELWALLNFLLPDVFGDSDAFDRWFEQSDTEKDQDVVVQQLHTVLSPFL 342

Query: 601 LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GSKGGHFSLLNIM 658
           LRRLK +VE SL  K E  L V ++D+Q ++YK++L K+  A+    G + G+  LLNI+
Sbjct: 343 LRRLKSEVETSLLPKIETNLYVGMTDMQVQWYKSLLEKDLDAVNGAIGKREGNTRLLNIV 402

Query: 659 SELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGH 718
            +L+K  NHPYLF+ AE       G    + E+    LI ++G               G 
Sbjct: 403 MQLRKCCNHPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKKKKEAGS 452

Query: 719 RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTR 778
           RVLIFSQM R+LDIL DY   +   + R+DG+    +R  +ID FN P S   +FLL+TR
Sbjct: 453 RVLIFSQMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTR 512

Query: 779 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 838
           AGGLGINL+TADTV+I+DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ER
Sbjct: 513 AGGLGINLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIER 572

Query: 839 ARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLE-DLNL 897
           A +K+ L+  +I  GV    K T     + GEL  ++++GA ++F   D  +K+  D ++
Sbjct: 573 AAQKLRLDQLVIQQGV---GKKTSAIGNSKGELLGMIQYGAKDVFG--DGARKITVDDDI 627

Query: 898 DDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 939
           D++L   E      +     LG ++ L++F     ++  +W+
Sbjct: 628 DEILKKGEQKTQQLNAKYEKLGLDD-LQKFNGLGDQSAYEWN 668

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  442 bits (1137), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 235/542 (43%), Positives = 341/542 (62%), Gaps = 29/542 (5%)

Query: 370 LVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 429
           + E PS+VK G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L + + 
Sbjct: 116 VTESPSFVKAGKLRDYQIYGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKD 175

Query: 430 QNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNI 489
            +GP IVVVP ST+  W+  F KW P++N I   G++ +R  + E    T          
Sbjct: 176 IDGPFIVVVPKSTLDNWKREFAKWTPEVNTIVLHGDRETRTQLIEERILT---------C 226

Query: 490 KFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGT 549
            F+VL+T+YE ++K+++ L    WQ++ +DEAHR+KN +S+L + +  F   +RLLITGT
Sbjct: 227 DFDVLITSYEMVIKEKAILKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGT 286

Query: 550 PLQNNIKELAALINFLMPGRF----TIDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLK 605
           PLQNN+ EL AL+NFL+P  F      D+      + ++QE  ++ LH  LQPF+LRR+K
Sbjct: 287 PLQNNLHELWALLNFLLPDVFGESEVFDEWFQQNEKAQDQEIVVQQLHAVLQPFLLRRVK 346

Query: 606 KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGSKGGHFSLLNIMSELKK 663
            DVEKSL  K E  + V ++ +Q ++Y+++L K+  A+    G + G   LLNI+ +L+K
Sbjct: 347 ADVEKSLLPKIETNVYVGMTAMQLQWYRSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 406

Query: 664 ASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 723
             NHPYLF+ AE       G    + E+    LI +SG              +G RVLIF
Sbjct: 407 CCNHPYLFEGAEP------GPPYTTDEH----LIYNSGKMIVLDKLLKRKKKEGSRVLIF 456

Query: 724 SQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLG 783
           SQM R+LDIL DY   +   + R+DG     +R  +ID FNA DS   +FLL+TRAGGLG
Sbjct: 457 SQMSRLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLG 516

Query: 784 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 843
           INL+TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYRLV+++ +EE+V+ERA +K+
Sbjct: 517 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKL 576

Query: 844 ILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLNH 903
            L+  +I  G    S      +   GEL ++++FGA ++F  K  +  + D ++D +L  
Sbjct: 577 RLDQLVIQQGAGRKSANLGNTK---GELIDMIQFGARDVFDKKLTEATVAD-DIDAILMK 632

Query: 904 AE 905
            E
Sbjct: 633 GE 634

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  441 bits (1134), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 239/580 (41%), Positives = 354/580 (61%), Gaps = 38/580 (6%)

Query: 370 LVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 429
           + E PSY++ G+LRD+Q+ G+NWM  L     +GILADEMGLGKT+QT++F+ +L Y ++
Sbjct: 121 VTESPSYIQSGKLRDYQIQGLNWMISLHENKISGILADEMGLGKTLQTISFLGYLRYVKK 180

Query: 430 QNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNI 489
             GP +V+VP ST+  W+  F KW P+++     G +  R  I +             NI
Sbjct: 181 IEGPFLVIVPKSTLDNWRREFFKWTPNVSTTVLQGTKEQRQDILQ-------------NI 227

Query: 490 ----KFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLL 545
               +F+VL+T+YE +++++  L  + W+++ +DEAHR+KN +S+L + +  F   NRLL
Sbjct: 228 VLEARFDVLITSYEMVIREKGYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLL 287

Query: 546 ITGTPLQNNIKELAALINFLMPGRF----TIDQEIDFENQDEEQEEYIRDLHKRLQPFIL 601
           ITGTPLQNN+ EL AL+NFL+P  F      D      N D++QE  ++ LH  L PF+L
Sbjct: 288 ITGTPLQNNLHELWALLNFLLPDVFGDSEVFDDWFQQNNSDQDQEVVVQQLHAVLNPFLL 347

Query: 602 RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGSKGGHFSLLNIMS 659
           RR+K DVEKSL  K E  + V ++D+Q ++YK++L K+  A+    G + G   LLNI+ 
Sbjct: 348 RRIKADVEKSLLPKIETNVYVGMTDMQVQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVM 407

Query: 660 ELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHR 719
           +L+K  NHPYLF+ AE       G    + E+    LI ++G               G R
Sbjct: 408 QLRKCCNHPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKRLKEKGSR 457

Query: 720 VLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRA 779
           VLIFSQM R+LDIL DY   +   + R+DG+    +R  +ID +N P+S   VFLL+TRA
Sbjct: 458 VLIFSQMSRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRA 517

Query: 780 GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERA 839
           GGLGINL+TADTV++FDSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+VLERA
Sbjct: 518 GGLGINLVTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERA 577

Query: 840 RKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDD 899
            +K+ L+  +I  G     K T     +  +L E++++GA N+F  K+      D ++D+
Sbjct: 578 AQKLRLDQLVIQQG---SGKKTANLGNSKDDLIEMIQYGAKNVF-EKNGTTISVDADIDE 633

Query: 900 VLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 939
           +L   E      +     LG ++ L++F   + ++  +W+
Sbjct: 634 ILKKGEAKTHELNARYEALGLDD-LQRFNGMENQSAYEWN 672

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  441 bits (1134), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 233/542 (42%), Positives = 339/542 (62%), Gaps = 29/542 (5%)

Query: 370 LVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 429
           L + PS++K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+Q+++F+ +L Y + 
Sbjct: 124 LTQSPSFIKEGKLRDYQVYGLNWLISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKG 183

Query: 430 QNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNI 489
             GP+IV+VP ST+  WQ  F KW P++  +   G++  R  + E +  T          
Sbjct: 184 IEGPYIVIVPKSTLDNWQREFAKWTPEVKTVILQGDKDFRKELIETKILT---------C 234

Query: 490 KFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGT 549
            F+VL+T+YE +LK++  L    W+++ +DEAHR+KN +S+L + +  F   NRLLITGT
Sbjct: 235 NFDVLITSYEMVLKEKLTLKRFAWEYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGT 294

Query: 550 PLQNNIKELAALINFLMPGRF----TIDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLK 605
           PLQNN+ EL AL+NFL+P  F      D+      ++E+QE  ++ LH  LQPF+LRR+K
Sbjct: 295 PLQNNLHELWALLNFLLPDVFGDSEVFDEWFQQNGKEEDQEVVVQQLHSVLQPFLLRRVK 354

Query: 606 KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TAGSKGGHFSLLNIMSELKK 663
            +VEKSL  K E  L V ++D+Q E+YK++L K+  A+    G + G   LLNI+ +L+K
Sbjct: 355 SEVEKSLLPKKEINLYVGMTDMQIEWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 414

Query: 664 ASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 723
             NHPYLF+ AE       G    + E+    L+ +SG               G RVLIF
Sbjct: 415 CCNHPYLFEGAEP------GPPYTTDEH----LVFNSGKMIVLDKLLKKKKEQGSRVLIF 464

Query: 724 SQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLG 783
           SQM R+LDIL DY   +G  + R+DG+    +R  +ID +N P+S   +FLL+TRAGGLG
Sbjct: 465 SQMSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLG 524

Query: 784 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 843
           INL+TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+
Sbjct: 525 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKL 584

Query: 844 ILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLNH 903
            L+  +I  G     K T     N  +L ++++FGA +M         + D ++D++L  
Sbjct: 585 RLDQLVIQQGT---GKKTSALTNNKDDLIDMIQFGARDMLQHGSGNITV-DEDIDEILKK 640

Query: 904 AE 905
            E
Sbjct: 641 GE 642

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  434 bits (1116), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/588 (40%), Positives = 345/588 (58%), Gaps = 45/588 (7%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P +V  G LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT+ F+ +L Y  ++ 
Sbjct: 135 ESPGFVD-GRLRPYQVQGVNWLVSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIEKKR 193

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP +V+ P ST+  WQ   ++W PD++     G++  R  + +                F
Sbjct: 194 GPFLVIAPKSTLNNWQREINRWTPDVDAFILQGDKEERARLCQERLLA---------CNF 244

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           +V + +YE I+++++    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 245 DVAIASYEIIIREKASFKKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPL 304

Query: 552 QNNIKELAALINFLMPGRFT----IDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F+     D+    E  D+++++ ++ LH  LQPF+LRR+K D
Sbjct: 305 QNNLHELWALLNFLLPDIFSDSAAFDEWFSSEASDDDKDKIVKQLHTILQPFLLRRIKSD 364

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GSKGGHFSLLNIMSELKKAS 665
           VE SL  K E  L V +S +Q ++YK IL K+  A+    GSK     LLNIM +L+K  
Sbjct: 365 VETSLLPKKELNLYVGMSSMQRKWYKQILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCC 424

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLFD AE       G    + E+    L+ +S               DG RVLIFSQ
Sbjct: 425 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKLKEDGSRVLIFSQ 474

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +G  + R+DG+     R  +ID +NAPDS   +FLL+TRAGGLGIN
Sbjct: 475 MSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGIN 534

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L
Sbjct: 535 LTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRL 594

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQK--------------K 891
           +  +I  G T  SK     +     LS +++ GA +MF + D                 K
Sbjct: 595 DQLVIQQGRTSISKKENAKDAKDALLS-MIQHGAVDMFRSTDTSNASSAKGTPQPETGDK 653

Query: 892 LEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWD 939
            ++++L+ +LN +E+   + +   + LG    L Q +  +  +  +WD
Sbjct: 654 DDEVDLESLLNKSENKTKSLNEKYAALG----LDQLQKFNQDSAYEWD 697

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  431 bits (1109), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 242/594 (40%), Positives = 352/594 (59%), Gaps = 43/594 (7%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P+Y+  G+LRD+Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y ++  
Sbjct: 166 ESPAYIN-GQLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLRYIKKIP 224

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP +V+ P ST+  W    +KW P++N     G++  R  + + +F             F
Sbjct: 225 GPFLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERARLIQDKFMA---------CDF 275

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           +V++ +YE I+++++    + W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 276 DVVIASYEIIIREKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPL 335

Query: 552 QNNIKELAALINFLMPGRFTIDQEID----FENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F+  Q+ D     E  +E+QE+ ++ LH  LQPF+LRR+K D
Sbjct: 336 QNNLHELWALLNFLLPDIFSDSQDFDEWFSKETDEEDQEKIVKQLHTVLQPFLLRRIKSD 395

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GSKGGHFSLLNIMSELKKAS 665
           VE SL  K E  + V +S +Q ++Y+ IL K+  A+ A  GSK     LLNI+ +L+K  
Sbjct: 396 VETSLLPKKELNVYVGMSPMQKKWYRQILEKDIDAVNADSGSKESKTRLLNIVMQLRKCC 455

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLFD AE       G    + E+    L+ +S                G RVLIFSQ
Sbjct: 456 NHPYLFDGAEP------GPPYTTDEH----LVYNSEKLKVLDKLLRKLKEAGSRVLIFSQ 505

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +   + R+DG+     R  +ID +NAPDS   +FLL+TRAGGLGIN
Sbjct: 506 MSRVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGIN 565

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L TAD V++FDSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L
Sbjct: 566 LTTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRL 625

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAA---------KDNQKKLEDLN 896
           +  +I        K   KN+     LS +++ GA ++F +         + +  K ED++
Sbjct: 626 DQLVIQQNRPTNKKKENKNDSKDALLS-MIQHGAADVFKSNTTSERGTPQPDDDKGEDVD 684

Query: 897 LDDVLNHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADVDWDDIIP 943
           LD++L  +E    + +     LG ++  K       ++  TD+K  V  D I P
Sbjct: 685 LDELLAQSESKTQSLNAKYESLGLDDLQKFNQDSAYEWNGTDFKKKVQKDIISP 738

>Scas_652.17
          Length = 1025

 Score =  424 bits (1090), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 235/592 (39%), Positives = 353/592 (59%), Gaps = 47/592 (7%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P Y+  G LR +Q+ G+NW+  L      GILADEMGLGKT+QT+AF+ +L Y    N
Sbjct: 104 ESPKYIH-GTLRPYQIQGLNWLVSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGIN 162

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP +V+ P ST+  W    +KW PD+      G+++ R ++ + +  T           F
Sbjct: 163 GPFLVIAPKSTLNNWLREINKWTPDVKAFVLQGDKQERASLIKEKLMT---------CDF 213

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           ++++ +YE I+++++      W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 214 DIVVASYEIIIREKAAFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPL 273

Query: 552 QNNIKELAALINFLMPGRFTIDQEID----FENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F+  Q+ D     E  +E+Q++ ++ LH  LQPF+LRR+K D
Sbjct: 274 QNNLHELWALLNFLLPDIFSSSQDFDDWFSSETTEEDQDKVVKQLHTVLQPFLLRRIKND 333

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GSKGGHFSLLNIMSELKKAS 665
           VE SL  K E  L V +S++Q ++YK IL K+  A+     SK     LLNI+ +L+K  
Sbjct: 334 VETSLLPKKELNLYVGMSNMQKKWYKKILEKDLDAVNGENSSKESKTRLLNIVMQLRKCC 393

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLFD AE       G    + E+    L+ +S               DG RVLIFSQ
Sbjct: 394 NHPYLFDGAEP------GPPYTTDEH----LVYNSKKLQVLDKLLKKMKEDGSRVLIFSQ 443

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +G  + R+DG+     R  SID +NAPDS   +FLL+TRAGGLGIN
Sbjct: 444 MSRVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLGIN 503

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L
Sbjct: 504 LTSADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKLRL 563

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGE-LSEILKFGAGNMFAAKDN-------------QKK 891
           +  +I       +K  K+++ +  + L  +++ GA ++F + ++              ++
Sbjct: 564 DQLVIQQNKASMNKNKKESKKDAKDALLSMIQHGAADIFQSGNSTTTESTPQPGEAKSEE 623

Query: 892 LEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADV 936
           +ED++L+ +L  +E+  ++ +     LG ++  K       +++  D+K DV
Sbjct: 624 VEDVDLESILATSENKTSSLNAKYETLGLDDLQKFNQDSAYEWDGHDFKKDV 675

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  425 bits (1092), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/520 (43%), Positives = 321/520 (61%), Gaps = 27/520 (5%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P+YV  G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y  +  
Sbjct: 187 ESPAYVN-GQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIP 245

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP +V+ P ST+  W    ++W PD+N     G++  R  + +         K      F
Sbjct: 246 GPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQ---------KKLLGCDF 296

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           +V++ +YE I++++S L  I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 297 DVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPL 356

Query: 552 QNNIKELAALINFLMPGRFTIDQEID----FENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F+  Q+ D     E+ +E+Q++ ++ LH  LQPF+LRR+K D
Sbjct: 357 QNNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSD 416

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GSKGGHFSLLNIMSELKKAS 665
           VE SL  K E  L V +S +Q ++YK IL K+  A+    GSK     LLNIM +L+K  
Sbjct: 417 VETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCC 476

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLFD AE       G    + E+    L+ ++               +G RVLIFSQ
Sbjct: 477 NHPYLFDGAEP------GPPYTTDEH----LVYNAAKLQVLDKLLKKLKEEGSRVLIFSQ 526

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +   + R+DG+     R  +ID +NAPDS   VFLL+TRAGGLGIN
Sbjct: 527 MSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGIN 586

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L
Sbjct: 587 LTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRL 646

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAA 885
           +  +I    T   K   K +     LS +++ GA ++F +
Sbjct: 647 DQLVIQQNRTSLKKKENKADSKDALLS-MIQHGAADVFKS 685

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  418 bits (1074), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 239/600 (39%), Positives = 351/600 (58%), Gaps = 49/600 (8%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P+YV  G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT+AF+ +L Y  ++N
Sbjct: 132 ESPAYVN-GQLRPYQIQGLNWLVALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIEKKN 190

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP +V+ P ST+  W    ++W P+++     G++  R  +   +              F
Sbjct: 191 GPFLVIAPKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLA---------CDF 241

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           ++ + +YE I+++++    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 242 DICVASYEIIIREKASFKKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPL 301

Query: 552 QNNIKELAALINFLMPGRF----TIDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F    T D+    E+ +E++E+ ++ LH  L PF+LRR+K D
Sbjct: 302 QNNLHELWALLNFLLPDIFADSATFDEWFSSESSEEDKEKVVKQLHTVLSPFLLRRIKND 361

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GSKGGHFSLLNIMSELKKAS 665
           VE SL  K E  + V +S +Q ++YK IL K+  A+    G K     LLNI+ +L+K  
Sbjct: 362 VEGSLLPKKELNVYVGMSSMQKKWYKQILEKDIDAVNGSNGQKESKTRLLNIVMQLRKCC 421

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLFD AE       G    + E+    L+ +S                G RVLIFSQ
Sbjct: 422 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKFKEQGSRVLIFSQ 471

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +   + R+DG+     R  +ID +NAPDS   +FLL+TRAGGLGIN
Sbjct: 472 MSRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGIN 531

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L
Sbjct: 532 LTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKL 591

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDN---------------QK 890
           +  +I  G     K   KN+   G LS +++ GA ++F + D+               + 
Sbjct: 592 DQLVIQQGRVTNKKKENKNDSKEGLLS-MIQHGAVDVFKSNDSSAMTSQTGTPHPDDGKD 650

Query: 891 KLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADVDWDDIIP 943
           K ED++LD +L  +ED   + +   + LG +E  +       +++  ++K  V+ D I P
Sbjct: 651 KDEDVDLDALLAQSEDKTRSLNAKYATLGLDELQRFNQDSAYEWDGQNFKKKVEKDIINP 710

>Scas_597.8
          Length = 1065

 Score =  414 bits (1063), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 235/597 (39%), Positives = 348/597 (58%), Gaps = 45/597 (7%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P ++  G LR++Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y  +  
Sbjct: 123 ESPGFIN-GTLRNYQIQGLNWLVSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVEKIP 181

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP +V+ P ST+  W    +KW P++N     G++  R  + + +              F
Sbjct: 182 GPFLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERAQLVKDKLLA---------CDF 232

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           ++++ +YE I++++S    I WQ++ +DEAHR+KN ES L + L  F  +NRLLITGTPL
Sbjct: 233 DIVVASYEIIIREKSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPL 292

Query: 552 QNNIKELAALINFLMPGRFTIDQEID----FENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F+  Q+ D     E  +E+QE+ ++ LH  LQPF+LRRLK D
Sbjct: 293 QNNLHELWALLNFLLPDIFSDSQDFDDWFSSETTEEDQEKVVKQLHTVLQPFLLRRLKND 352

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGS--KGGHFSLLNIMSELKKAS 665
           VE SL  K E  L V +S++Q ++YK IL K+  A+   +  K     LLNI+ +L+K  
Sbjct: 353 VETSLLPKQELNLYVGMSNMQKKWYKQILEKDIDAVNGSNVNKESKTRLLNIVMQLRKCC 412

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLFD AE       G    + E+    L+ +S               +G RVLIFSQ
Sbjct: 413 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKMKEEGSRVLIFSQ 462

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +G  + R+DG+     R  +ID +N P S   +FLL+TRAGGLGIN
Sbjct: 463 MSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAGGLGIN 522

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L +A+ V++FDSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L
Sbjct: 523 LTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERATQKLRL 582

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKK------------LE 893
           +  +I    +   K  +  + N   L  +++ GA ++F + D+  +             +
Sbjct: 583 DQLVIQQNRSTLKKKKENKKDNKEALLSMIQHGAADVFQSIDSSAENSNRNTPQPGDATD 642

Query: 894 DLNLDDVLNHAEDHVTTPDLGESHLGGEEFLK-------QFEVTDYKADVDWDDIIP 943
           D++LD +L  +ED   + +     LG ++  +       ++   D+K  V  D I P
Sbjct: 643 DIDLDSILALSEDKTKSLNAKYESLGLDDLQRFNQDSAYEWNGQDFKKKVQKDIISP 699

>Kwal_14.1600
          Length = 1102

 Score =  412 bits (1059), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/520 (41%), Positives = 314/520 (60%), Gaps = 26/520 (5%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           E P ++  G LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT++F+ +L Y  ++ 
Sbjct: 127 ESPPFIN-GCLRPYQVQGVNWLVSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKP 185

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
           GP +V+ P ST+  W    ++W PD+      G++  R  +          A       F
Sbjct: 186 GPFVVIAPKSTLNNWLREINRWTPDVRAFILQGDKEERAKL---------VANKLMACDF 236

Query: 492 NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPL 551
           ++++ +YE I+K+++    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 237 DIVVASYEIIIKEKASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPL 296

Query: 552 QNNIKELAALINFLMPGRFTIDQEID----FENQDEEQEEYIRDLHKRLQPFILRRLKKD 607
           QNN+ EL AL+NFL+P  F+  Q  D     E+ ++++ + ++ LH  LQPF+LRRLK +
Sbjct: 297 QNNLHELWALLNFLLPDVFSDSQAFDDWFSSESSEDDKGKIVKQLHTVLQPFLLRRLKNE 356

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA--GSKGGHFSLLNIMSELKKAS 665
           VE SL  K E  L + +S +Q  +YK IL K+  A+    G+K     LLN+M +L+K  
Sbjct: 357 VETSLLPKKELNLYIGMSSMQKRWYKQILEKDIDAVNGANGNKESKTRLLNVMMQLRKCC 416

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           NHPYLFD AE       G    + E+    L+ +S               +G RVLIFSQ
Sbjct: 417 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLRKFKEEGSRVLIFSQ 466

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
           M R+LDIL DY   +   + R+DG+     R  +ID +NAPDS   VFLL+TRAGGLGIN
Sbjct: 467 MSRVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGLGIN 526

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+RLV+ ++VEE++LERA +K+ L
Sbjct: 527 LTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQKLRL 586

Query: 846 EYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAA 885
           +  +I       ++   K   +   L  +++ GA ++F+ 
Sbjct: 587 DQLVIQQSRNGVNQKEVKKGDSKDALLSMIQHGAADVFST 626

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  413 bits (1062), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 237/569 (41%), Positives = 332/569 (58%), Gaps = 47/569 (8%)

Query: 359  YNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 418
            Y  S R K E + +QPS +  G L+++QL G+ WM  L++ + NGILADEMGLGKT+Q++
Sbjct: 491  YEVSHRIK-ETVDKQPSILVGGTLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSI 549

Query: 419  AFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFY 478
            + IS+L   + +  P +V+VPLST+  W   F+KWAP L  I Y GN   R A++     
Sbjct: 550  SLISYLYEIKNERQPFLVIVPLSTITNWTIEFEKWAPSLRTIVYKGNPNQRKALQHTIKM 609

Query: 479  TNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSL-YESLNS 537
             N          F+V+LTTYEYI+KDR  L    W  + +DE HR+KNA+S L Y   + 
Sbjct: 610  GN----------FDVVLTTYEYIIKDRPLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHY 659

Query: 538  FKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEID---------------FENQD 582
            +K  NRL++TGTPLQNN+ EL AL+NF++P  F   +  D                E  +
Sbjct: 660  YKTKNRLILTGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFANTGTQEKLEMTE 719

Query: 583  EEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSA 642
            EE    IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   
Sbjct: 720  EETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSSLQQQLYEQMLKHNAFF 779

Query: 643  LTAGSKG----GHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIM 698
            + AG++G    G   L N + +L+K  NHP++FD  E  +         +REN    L  
Sbjct: 780  IGAGTEGATKAGIKGLNNKVMQLRKICNHPFVFDEVENVI-------NPTRENS-SILYR 831

Query: 699  SSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRI 758
             SG               GHRVL+F QM +++DI+ D+L ++ + + RLDG   +  R  
Sbjct: 832  VSGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTG 891

Query: 759  SIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN 818
             +  FNAPDS    FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN
Sbjct: 892  MLKLFNAPDSEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKN 951

Query: 819  HVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEIL-KF 877
             V + RL++ D+VEE +LERA +K+ ++  +I  G  D       N+    E  E L + 
Sbjct: 952  EVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFD-------NKSTAEEQEEFLRRL 1004

Query: 878  GAGNMFAAKDNQKKLEDLNLDDVLNHAED 906
              G+     +   +L+D  L+++L   ED
Sbjct: 1005 LEGDTNKDDEYSGELDDEELNEILARTED 1033

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  412 bits (1059), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 221/518 (42%), Positives = 317/518 (61%), Gaps = 38/518 (7%)

Query: 368 EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
           EK+ +QPS +  G L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 443 EKVEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 502

Query: 428 RRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKK 487
           ++ +GP +V+VPLST+  W   F+KWAP L  + Y G    R +++      +       
Sbjct: 503 KKDSGPFLVIVPLSTITNWTLEFEKWAPSLTTVIYKGTPNQRRSLQHQVRIGD------- 555

Query: 488 NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSL-YESLNSFKVNNRLLI 546
              F+VLLTTYEYI+KDRS L   +W  + +DE HR+KNA+S L Y   + +K  +RL++
Sbjct: 556 ---FDVLLTTYEYIIKDRSLLAKHEWSHMIIDEGHRMKNAQSKLSYTLTHYYKTRHRLIL 612

Query: 547 TGTPLQNNIKELAALINFLMPGRFTIDQEID------FENQDEEQEE---------YIRD 591
           TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++           IR 
Sbjct: 613 TGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFSNTGGQEKLELTEEEALLVIRR 672

Query: 592 LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGS---- 647
           LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG+    
Sbjct: 673 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFVGAGTEGAT 732

Query: 648 KGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXX 707
           KGG   L N + +L+K  NHP++FD  E       G    +R N    L   SG      
Sbjct: 733 KGGIKGLNNKIMQLRKICNHPFVFDEVE-------GVVNPTRTNS-SLLYRVSGKFELLD 784

Query: 708 XXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPD 767
                    GHRVL+F QM +++DI+ D+L +K + + RLDG   + +R   ++ FNAPD
Sbjct: 785 RVLPKFKATGHRVLMFFQMTQVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPD 844

Query: 768 STDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 827
           S    FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 845 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 904

Query: 828 KDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
            D+VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 905 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 942

>Kwal_23.4777
          Length = 1301

 Score =  411 bits (1056), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 234/569 (41%), Positives = 331/569 (58%), Gaps = 44/569 (7%)

Query: 358 NYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQT 417
           +Y   A    EK+ +QPS +  G L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+
Sbjct: 432 DYYEVAHSVKEKIEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQS 491

Query: 418 VAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEF 477
           ++ I++L   + + GP +V+VPLST+  W   F+KWAP L  I Y G    R +++    
Sbjct: 492 ISLITYLRETKNEPGPFLVIVPLSTITNWTLEFEKWAPSLATIVYKGTPNQRKSMQHQIR 551

Query: 478 YTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNS 537
             N          F VLLTTYEYI+KDRS L    W  + +DE HR+KNA+S L  +L  
Sbjct: 552 IGN----------FEVLLTTYEYIIKDRSLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTR 601

Query: 538 F-KVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEID------FENQDEEQEE--- 587
           + +  NRL++TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++    
Sbjct: 602 YYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFDEWFNTPFANTGGQEKLELT 661

Query: 588 ------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYS 641
                  IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N  
Sbjct: 662 EEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNAL 721

Query: 642 ALTAGS----KGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLI 697
              AG+    KGG   L N + +L+K  NHP++FD  E       G    SR N    L 
Sbjct: 722 FFGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVE-------GIINPSRANSPL-LY 773

Query: 698 MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRR 757
             +G               GHRVL+F QM +++DI+ D+L ++G+ + RLDG   +  R 
Sbjct: 774 RVAGKFELLDRILLKFKVTGHRVLMFFQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRT 833

Query: 758 ISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQK 817
             +  FNAP+S    FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQK
Sbjct: 834 GMLKLFNAPNSEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQK 893

Query: 818 NHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKF 877
           N V + RL++ D+VEE +LERA +K+ ++  +I  G  D     ++ E     L E    
Sbjct: 894 NEVRILRLITTDSVEEVILERALQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLLE---- 949

Query: 878 GAGNMFAAKDNQKKLEDLNLDDVLNHAED 906
                   +D++ +L D  L+D+L   ED
Sbjct: 950 --NENAKDEDDEAELNDEELNDILARGED 976

>Scas_662.7
          Length = 1342

 Score =  409 bits (1052), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/529 (41%), Positives = 318/529 (60%), Gaps = 38/529 (7%)

Query: 357 TNYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQ 416
           T+Y   A    EK+ +QPS +  G L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q
Sbjct: 436 TDYYEVAHQIKEKIDKQPSMLVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQ 495

Query: 417 TVAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFE 476
           +++ I++L   ++  GP++V+VPLST+  W   F+KWAP LN + Y G    R  ++   
Sbjct: 496 SISLITYLFEEKKDPGPYLVIVPLSTITNWTLEFEKWAPSLNTVIYKGTPNQRRNLQHQV 555

Query: 477 FYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSL-YESL 535
              N          F+VLLTTYEYI+KDR+ L   +W  + +DE HR+KNA+S L Y   
Sbjct: 556 RIGN----------FDVLLTTYEYIIKDRALLAKHEWTHMIIDEGHRMKNAQSKLSYTIT 605

Query: 536 NSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEID------FENQDEEQEE-- 587
           + +K  +RL++TGTPLQNN+ EL AL+NF++P  F   +  +      F N    ++   
Sbjct: 606 HYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTGEKLEL 665

Query: 588 -------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNY 640
                   IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N 
Sbjct: 666 TEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYEQMLKHNA 725

Query: 641 SALTAGSKG----GHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGL 696
             L  G++G    G   L N + +L+K  NHP++FD  E  +     +  +        L
Sbjct: 726 LFLGEGTEGATKSGIKGLNNKIMQLRKICNHPFVFDEVEGVINPTRANSNL--------L 777

Query: 697 IMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQR 756
              SG               GHRVL+F QM +++DI+ D+L +K + + RLDG+  +  R
Sbjct: 778 YRVSGKFELLNRVLPKFKAAGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDR 837

Query: 757 RISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQ 816
              ++ FNAPDS    FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQ
Sbjct: 838 TGMLNDFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 897

Query: 817 KNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
           KN V + RL++ D+VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 898 KNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 946

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  406 bits (1044), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 223/529 (42%), Positives = 322/529 (60%), Gaps = 38/529 (7%)

Query: 357 TNYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQ 416
           T+Y   A    EK+ +QPS +  G L+++QL G+ WM  L++ + NGILADEMGLGKT+Q
Sbjct: 445 TDYYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQ 504

Query: 417 TVAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFE 476
           +++ I++L   ++  GP +V+VPLST+  W   F+KWAP LN I Y G    R +++   
Sbjct: 505 SISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQI 564

Query: 477 FYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLN 536
              N          F+VLLTTYEYI+KD+S L    W  + +DE HR+KNA+S L  +++
Sbjct: 565 RVGN----------FDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTIS 614

Query: 537 SF-KVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEID------FENQDEEQEE-- 587
            + +  NRL++TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++   
Sbjct: 615 HYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLEL 674

Query: 588 -------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNY 640
                   IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N 
Sbjct: 675 TEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNA 734

Query: 641 SALTAGS----KGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGL 696
             + AG+    KGG   L N + +L+K  NHP++FD  E  V    G+  +        L
Sbjct: 735 LFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDL--------L 786

Query: 697 IMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQR 756
              +G               GHRVL+F QM +++DI+ D+L +K + + RLDG+  + +R
Sbjct: 787 FRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEER 846

Query: 757 RISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQ 816
              ++ FNAPDS    FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQ
Sbjct: 847 TEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 906

Query: 817 KNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
           KN V + RL++ D+VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 907 KNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 955

>Kwal_26.9164
          Length = 1454

 Score =  403 bits (1036), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 226/569 (39%), Positives = 340/569 (59%), Gaps = 57/569 (10%)

Query: 354  QNSTNYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGK 413
            QN   YN + R K E++ +QPS +  G L+++QL G+ WM  L++ + NGILADEMGLGK
Sbjct: 575  QNIDYYNVAHRIK-EEIKQQPSILVGGTLKEYQLKGLQWMVSLYNNHLNGILADEMGLGK 633

Query: 414  TVQTVAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIR 473
            T+QT++ +++L   +   GP +V+VPLST+  W   FDKWAP +  + Y G+   R    
Sbjct: 634  TIQTISLLTYLYEVKNVRGPSLVIVPLSTLTNWDSEFDKWAPVIRKVAYKGSPNER---- 689

Query: 474  EFEFYTNPYAKGKKNI----KFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAES 529
                      K K+ I    +F+V+LTT+EYI+K+R+ L  IKW  + +DE HR+KNA+S
Sbjct: 690  ----------KSKQGIIRSGQFDVVLTTFEYIIKERALLSKIKWVHMIIDEGHRMKNAQS 739

Query: 530  SLYESLNSF-KVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEID------FEN-- 580
             L  +LN++   + RL++TGTPLQNN+ EL AL+NF++P  F   +  D      F N  
Sbjct: 740  KLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTG 799

Query: 581  -------QDEEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 633
                    +EE    IR LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+
Sbjct: 800  GQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSALQQKLYE 859

Query: 634  NILTKN---YSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRE 690
             +L         L +    G     N + +LKK  NHP++F+  E+++       + +  
Sbjct: 860  QMLKHRRLFIGDLNSNKNVGMRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNA 915

Query: 691  NVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGT 750
            N+ R     +G               GHR+LIF QM +++DI+ D+L +  + + RLDG 
Sbjct: 916  NIWR----VAGKFELLERILPKFKATGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGH 971

Query: 751  VPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMAR 810
              S  R + ++ FNAP+S    FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  R
Sbjct: 972  TKSDDRTLLLNLFNAPNSEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDR 1031

Query: 811  AHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNEPNPGE 870
            AHRIGQKN V + RL+++++VEE +L+RA KK+ ++  +I  G  D    +++ E     
Sbjct: 1032 AHRIGQKNEVRILRLITENSVEEVILDRAHKKLDIDGKVIQAGKFDNKSTSEEQE----- 1086

Query: 871  LSEILKFGAGNMFAAKDNQKKLEDLNLDD 899
               +L+    ++  A++ QK+  +L L++
Sbjct: 1087 --ALLR----SLLEAEEEQKRKRELGLEE 1109

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  394 bits (1013), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/518 (41%), Positives = 315/518 (60%), Gaps = 38/518 (7%)

Query: 368 EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
           EK+ +QPS +  G L+++QL G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 439 EKIEKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 498

Query: 428 RRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKK 487
           +++ GP++V+VPLST+  W   F+KWAP L  I Y G    R A++             +
Sbjct: 499 KQEPGPYLVIVPLSTITNWTLEFEKWAPSLTTIIYKGTPNQRHALQH----------KIR 548

Query: 488 NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSF-KVNNRLLI 546
           +  F+VLLTTYEYI+KD++ L   +W  + +DE HR+KNA S L  ++  + +  NRL++
Sbjct: 549 SGNFDVLLTTYEYIIKDKALLSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLIL 608

Query: 547 TGTPLQNNIKELAALINFLMPGRFTIDQEID------FENQDEEQEE---------YIRD 591
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++           IR 
Sbjct: 609 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRR 668

Query: 592 LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGS---- 647
           LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + AG+    
Sbjct: 669 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYQQMLKHNALFVGAGTEGAT 728

Query: 648 KGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXX 707
           KGG   L N + +L+K  NHP++FD  E  V    G+  +        L   +G      
Sbjct: 729 KGGIKGLNNKIMQLRKICNHPFVFDEVEAVVNPSRGNSDL--------LYRVAGKFELLD 780

Query: 708 XXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPD 767
                    GHRVLIF QM +++DI+ D+L ++ + + RLDG+  +  R   +  FN  +
Sbjct: 781 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVEN 840

Query: 768 STDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 827
           S    FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 841 SEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 900

Query: 828 KDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
            D+VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 901 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 938

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  397 bits (1019), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 223/561 (39%), Positives = 331/561 (59%), Gaps = 38/561 (6%)

Query: 368  EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
            E++ +QPS +  G L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L  A
Sbjct: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729

Query: 428  RRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKK 487
            +  +GP +V+VPLST+  W   FDKWAP L  I + G    R           P     K
Sbjct: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779

Query: 488  NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNN-RLLI 546
            N +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ RL++
Sbjct: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839

Query: 547  TGTPLQNNIKELAALINFLMPGRFTIDQEID------FEN---------QDEEQEEYIRD 591
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +EE    IR 
Sbjct: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899

Query: 592  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGH 651
            LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +   S    
Sbjct: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959

Query: 652  FS----LLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXX 707
            FS      N + +L+K  NHP++F+  E+++       + + + + R    S+G      
Sbjct: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011

Query: 708  XXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPD 767
                     GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ FNAP+
Sbjct: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071

Query: 768  STDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 827
            S    FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131

Query: 828  KDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKD 887
             ++VEE +L++A  K+ ++  +I  G  D     ++ E     L E  +          +
Sbjct: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEAEEEEKKRRELGIE 1191

Query: 888  NQKKLEDLNLDDVLNHAEDHV 908
             +++L+D  L+++L   E+ +
Sbjct: 1192 EEEQLDDNELNEILARNENEI 1212

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  398 bits (1022), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 220/528 (41%), Positives = 320/528 (60%), Gaps = 42/528 (7%)

Query: 359  YNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 418
            YN + R K E + +QPS +  G L+D+Q+ G+ WM  L++ + NGILADEMGLGKT+QT+
Sbjct: 745  YNVAHRIK-EDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTI 803

Query: 419  AFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFY 478
            + +++L   +   GP++V+VPLST+  W   F KWAP L  I + G+   R A +     
Sbjct: 804  SLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQ----- 858

Query: 479  TNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNS- 537
                AK +   +F+V+LTT+EYI+K+R+ L  +KW  + +DE HR+KNA+S L  +LN+ 
Sbjct: 859  ----AKIRAG-EFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTH 913

Query: 538  FKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEID---------------FENQD 582
            +  + RL++TGTPLQNN+ EL AL+NF++P  F   +  D                E  +
Sbjct: 914  YHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSE 973

Query: 583  EEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSA 642
            EE    IR LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   Y  
Sbjct: 974  EETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQML--KYRR 1031

Query: 643  LTAGSKG-----GHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLI 697
            L  G +      G     N + +LKK  NHP++F+  E+++       + + +++ R   
Sbjct: 1032 LFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNDDIWR--- 1084

Query: 698  MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRR 757
              +G               GHRVLIF QM +++DI+ D+L    I + RLDG   S +R 
Sbjct: 1085 -VAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERS 1143

Query: 758  ISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQK 817
              +  FNAPDS    F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQK
Sbjct: 1144 ELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQK 1203

Query: 818  NHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
            N V + RL++ ++VEE +LERA KK+ ++  +I  G  D    +++ E
Sbjct: 1204 NEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQE 1251

>Scas_594.7
          Length = 1703

 Score =  396 bits (1017), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 216/522 (41%), Positives = 316/522 (60%), Gaps = 47/522 (9%)

Query: 368  EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
            E++ +QP+ +  G L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 799  EEIRQQPAMLVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYET 858

Query: 428  RRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGN---QRSRDAIREFEFYTNPYAK 484
            +  +GP++V+VPLST+  W   F KWAP +  I Y G+   ++S+ AI            
Sbjct: 859  KHIHGPYLVIVPLSTLSNWSNEFAKWAPTMRCISYKGSPNERKSKHAI------------ 906

Query: 485  GKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNN-R 543
              K+ +F+V+LTT+EYI+K+R+ L  +KW  + +DE HR+KNA+S L  +LN++  ++ R
Sbjct: 907  -IKSGEFDVVLTTFEYIIKERALLSKVKWIHMIIDEGHRMKNAQSKLSLTLNTYYHSDYR 965

Query: 544  LLITGTPLQNNIKELAALINFLMPGRFTIDQEID---------------FENQDEEQEEY 588
            L++TGTPLQNN+ EL AL+NF +P  F   +  D                E  +EE    
Sbjct: 966  LILTGTPLQNNLPELWALLNFALPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLV 1025

Query: 589  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSK 648
            IR LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   Y  L  G  
Sbjct: 1026 IRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQQIMYQQML--KYRRLFIGDH 1083

Query: 649  G-----GHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXX 703
                  G     N + +LKK  NHP++F+  E+++       + +  N+ R     +G  
Sbjct: 1084 TNKKMVGLRGFNNQLMQLKKICNHPFVFEEVEDQI----NPTRETNANIWR----VAGKF 1135

Query: 704  XXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHF 763
                         GHRVLIF QM +++DI+ D+L    I + RLDG   S  R   +  F
Sbjct: 1136 ELLEKVLPKLKATGHRVLIFFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLF 1195

Query: 764  NAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVY 823
            NAPDS    F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + 
Sbjct: 1196 NAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIL 1255

Query: 824  RLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
            RL+++ +VEE +LERA KK+ ++  +I  G  D    +++ E
Sbjct: 1256 RLITEHSVEEAILERAHKKLDIDGKVIQAGKFDNKSTSEEQE 1297

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  389 bits (1000), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 213/517 (41%), Positives = 305/517 (58%), Gaps = 46/517 (8%)

Query: 373  QPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNG 432
            QPS +  G L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   +  +G
Sbjct: 552  QPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEFKGIHG 611

Query: 433  PHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFN 492
            P +V+VPLST+  W   FDKWAP L  + + G    R A+              K+  F+
Sbjct: 612  PFLVIVPLSTLTNWNAEFDKWAPTLRKLAFKGPPSERKALSGI----------IKSGNFD 661

Query: 493  VLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSF-KVNNRLLITGTPL 551
            V+LTT+EYI+K+R  L  +KW  + +DE HR+KNA+S L  +LN +   + RL++TGTPL
Sbjct: 662  VVLTTFEYIIKERPLLSKVKWVHMIIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPL 721

Query: 552  QNNIKELAALINFLMPGRFTIDQEID---------------FENQDEEQEEYIRDLHKRL 596
            QNN+ EL AL+NF++P  F   +  D                E  +EE    IR LHK L
Sbjct: 722  QNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVL 781

Query: 597  QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN--------YSALTAGSK 648
            +PF+LRRLKKDVEK LP K E++L+  +S +Q + Y+ +L            S    G +
Sbjct: 782  RPFLLRRLKKDVEKELPDKVEKVLKCRMSALQQKLYEQMLKHRRLFVVDDPSSKKMVGLR 841

Query: 649  GGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXX 708
            G +    N + +LKK  NHP++F+  E+++       + +  N+ R     +G       
Sbjct: 842  GFN----NQIMQLKKICNHPFVFEEVEDQI----NPNRETNANIWR----VAGKFELLEK 889

Query: 709  XXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDS 768
                    GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ FNAP S
Sbjct: 890  ILPKFKASGHRVLIFFQMTQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGS 949

Query: 769  TDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSK 828
                FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++ 
Sbjct: 950  DYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITD 1009

Query: 829  DTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
            ++VEE +LERA +K+ ++  +I  G  D     ++ E
Sbjct: 1010 NSVEEVILERAHRKLDIDGKVIQAGKFDNKSTAEEQE 1046

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  389 bits (998), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/528 (40%), Positives = 317/528 (60%), Gaps = 42/528 (7%)

Query: 359  YNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 418
            YN + R K E++ +QPS +  G L+++Q+ G+ WM  L++ + NGILADEMGLGKT+QT+
Sbjct: 780  YNVAHRIK-EEVRQQPSILVGGTLKEYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTI 838

Query: 419  AFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFY 478
            + +++L   +   GP +++VPLST+P W   F KWAP L  I Y G+   R  +++ +  
Sbjct: 839  SLLTYLYEMKNIKGPFLIIVPLSTLPNWSSEFAKWAPKLRTISYKGSPNER-KMKQAQI- 896

Query: 479  TNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSF 538
                    K+ +F+ ++TT+EYI+K+R+ L  +KW  + +DE HR+KNA+S L  +LN+F
Sbjct: 897  --------KSGEFDAVITTFEYIIKERAILSKVKWVHMIIDEGHRMKNAQSKLSLTLNTF 948

Query: 539  KVNN-RLLITGTPLQNNIKELAALINFLMPGRFTIDQEID---------------FENQD 582
              ++ RL++TGTPLQNN+ EL AL+NF++P  F   +  D                E  +
Sbjct: 949  YHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAKSFDEWFNTPFANTGGQDKIELSE 1008

Query: 583  EEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSA 642
            EE    IR LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   +  
Sbjct: 1009 EETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQHAMYQQML--KHKQ 1066

Query: 643  LTAGSKG-----GHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLI 697
            L  G +      G     N + +LKK  NHP++F+  E+ +     D  M   N+ R   
Sbjct: 1067 LFIGDQKKNKLVGLRGFNNQLMQLKKICNHPFVFEEVEDHI-NPTRDTNM---NIWR--- 1119

Query: 698  MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRR 757
              +G                HRVLIF QM +++DI+ D+L    I + RLDG   S +R 
Sbjct: 1120 -VAGKFELLERILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYLRLDGHTRSDERG 1178

Query: 758  ISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQK 817
              +  FN P+S    F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQK
Sbjct: 1179 ELLKLFNDPNSEYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQK 1238

Query: 818  NHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
            N V + RL++ ++VEE +LERA KK+ ++  +I  G  D     ++ E
Sbjct: 1239 NEVRIIRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEEQE 1286

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  330 bits (846), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 210/561 (37%), Positives = 291/561 (51%), Gaps = 77/561 (13%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           EQPSY+K   L+ +Q+ G+NW+  L+    NGILADEMGLGKT+Q++A +S+ IY     
Sbjct: 209 EQPSYLKNCVLKPYQMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSF-IYEMDTK 267

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREF--EFYTNPYAKGKKNI 489
           GP ++  PLST+  W   F K+AP++ ++ Y   Q  +DA ++   +F+ N   +G    
Sbjct: 268 GPFLIAAPLSTVDNWMNEFAKFAPEIPILKYYS-QNGQDARQKLLKKFFKNNNREG---- 322

Query: 490 KFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGT 549
              V++T+YE I++D + +   +W+FL VDE HRLKN    L + L     +NRLL+TGT
Sbjct: 323 ---VIVTSYEMIIRDANIIMGEQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGT 379

Query: 550 PLQNNIKELAALINFLMPGRFTIDQEI-----DFEN--------------QDEEQEEYIR 590
           PLQNN+ EL +L+NF++P  F  D EI     DF++               DE ++  I 
Sbjct: 380 PLQNNLSELWSLLNFILPDIFA-DFEIFNKWFDFKDLDLQSNSAKLNKLINDELEKNLIS 438

Query: 591 DLHKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKG 649
           +LH  L+PF+LRRLK  V K  LP K E I+   LS +QT++Y+  L+            
Sbjct: 439 NLHTILKPFLLRRLKSVVLKDVLPPKREYIVNCPLSPIQTKFYRMALSGKLKVTVFKELV 498

Query: 650 GHFSLLN--IMSELKKASNHPYL-FDNAEE-------RVLKKFGDGQMSREN-------- 691
             F  LN   +  +   S   ++ +  +EE        V+K+  D  M   N        
Sbjct: 499 KAFFTLNQEYIGTVSNKSIRDFIDYKLSEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRL 558

Query: 692 ---------------------------VLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFS 724
                                       L  L+ SSG               GH++LIFS
Sbjct: 559 QNMMMQLRQVVDSTLLFFFPYMEPEDITLDYLLASSGKLQMLQKLAIPLIKKGHKILIFS 618

Query: 725 QMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGI 784
           Q V MLD+L D+  +      R+DG V +  R+  ID FN       +FLLSTRA GLGI
Sbjct: 619 QFVGMLDLLEDWSELNSFNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGI 678

Query: 785 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 844
           NL+ ADTVIIFDSDWNPQ DLQAM R HRIGQ   V+VYR    +T+E  +L RA  K  
Sbjct: 679 NLVAADTVIIFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRK 738

Query: 845 LEYAIISLGVTDGSKYTKKNE 865
           LE  +I +G     K    NE
Sbjct: 739 LERMVIQMGKFSNLKKLALNE 759

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  329 bits (843), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 206/557 (36%), Positives = 294/557 (52%), Gaps = 96/557 (17%)

Query: 373 QPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNG 432
           QPS++K  +L+ +Q  G+NW+  L+    NGILADEMGLGKT+Q++A +++ IY     G
Sbjct: 188 QPSFLKNCQLKPYQKEGLNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDTKG 246

Query: 433 PHIVVVPLSTMPAWQETFDKWAPDLNVICYMGN--QRSRDAIREFEFYTNPYAKGKKNIK 490
           P ++  PLST+  W   F ++APD+ V+ Y  +  Q +R A+   +F+ N   +G     
Sbjct: 247 PFLIAAPLSTVENWMNEFARFAPDIPVLKYYNSEGQAARHAMMG-KFFKNNKGEG----- 300

Query: 491 FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTP 550
             V++T+YE I++D   + S +W+FL VDE HRLKN    L   L     +NRLL+TGTP
Sbjct: 301 --VIITSYEIIIRDIELILSYQWKFLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGTP 358

Query: 551 LQNNIKELAALINFLMPGRFTIDQEI-----DFEN--------------QDEEQEEYIRD 591
           LQNN+ EL +L+NF++P  F+ D EI     DF +               DE ++  I +
Sbjct: 359 LQNNLGELWSLLNFILPNIFS-DFEIFNKWFDFSDLNLESSSEKLTKIINDELEKNLISN 417

Query: 592 LHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL------------TK 638
           LH  L+PF+LRRLKK+V   SLP K E I+   ++ +Q +YYK  L             K
Sbjct: 418 LHTILKPFLLRRLKKNVLAGSLPPKREYIITCPVTPLQKKYYKQALKGNLKQTIQKQAIK 477

Query: 639 NYSALTAGSKGG-------------------------------------HFSLL-----N 656
           ++  L A   G                                      H  LL     N
Sbjct: 478 DFFTLNAEYIGTVSNKSIRDFIEWKLSADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQN 537

Query: 657 IMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXD 716
           +M +L++  N  YLF               ++ EN+L+    +SG               
Sbjct: 538 MMIQLRQIVNSTYLF------YFPLLEPTDLTLENLLK----TSGKLQVLQKLVPELIKK 587

Query: 717 GHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLS 776
            H+VLIFSQ V MLD++ D+  +      R+DG++ +  R+  I+ F+   S  ++FLLS
Sbjct: 588 KHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQNNSRKEQIEEFSKKGSKANLFLLS 647

Query: 777 TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 836
           TRA GLGINL  AD+VIIFDSDWNPQ DLQAM RAHRIGQ   V+VYRL   +T+E  ++
Sbjct: 648 TRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRAHRIGQTKPVIVYRLYCDNTIENVIM 707

Query: 837 ERARKKMILEYAIISLG 853
            RA  K  LE  +I +G
Sbjct: 708 TRAVNKRKLEKLVIQMG 724

>Kwal_47.18077
          Length = 809

 Score =  325 bits (833), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 209/580 (36%), Positives = 299/580 (51%), Gaps = 84/580 (14%)

Query: 370 LVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 429
           L +QPS +K  +L+ +QL G+NW+  L+    NGILADEMGLGKT+Q++A +++ I    
Sbjct: 168 LHQQPSLLKNCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKTLQSIALLAF-ITEMD 226

Query: 430 QNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRS--RDAIREFEFYTNPYAKGKK 487
             GP ++  PLST+  W   F ++APD+ V+ Y   Q    R ++ + +F+ +   +G  
Sbjct: 227 TGGPFLIAAPLSTLDTWVNEFSRFAPDIQVLKYYSTQGQSYRQSLLK-KFFKSTKGQG-- 283

Query: 488 NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLIT 547
                V++T+YE I++D   + S +W+FL VDE HR+KN    L   L      NRLLIT
Sbjct: 284 -----VVITSYEIIIRDIELILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNRLLIT 338

Query: 548 GTPLQNNIKELAALINFLMPGRFTIDQEI-----DFEN--------------QDEEQEEY 588
           GT LQNN+ EL +L+NF+MP  F  D EI     DF +               DE ++  
Sbjct: 339 GTALQNNLSELWSLLNFIMPDIFA-DFEIFHKWFDFSDLELKSSSQGLNRLINDELEKNL 397

Query: 589 IRDLHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL----------- 636
           I +LH  L+PF+LRRLKK V   SLP K E I+   L+ VQ + YK+ L           
Sbjct: 398 ISNLHAILKPFLLRRLKKVVLAGSLPPKREYIVNCPLTSVQKKLYKSALNGKLKQAIFKQ 457

Query: 637 -TKNYSALTAGSKGG---------------------HFSLLNIMSELKKASNHPYLFDNA 674
             K++  L +   G                         +L  M +L K   H  L +  
Sbjct: 458 AIKDFFVLNSDQIGQVSNKSIRDFMEWKLNANDEDPDTEILQQMDKLYKQHIHRALLNKR 517

Query: 675 EER---VLKKFGDGQM--------SRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 723
            +     L++  D  +          +  L  L+ SSG               GH+VLIF
Sbjct: 518 LQNPMVQLRQVVDSTLLFFFPFINPEKLTLDFLLQSSGKLQILQQLVPPLIKKGHKVLIF 577

Query: 724 SQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLG 783
           +Q V MLD++ D+  +  +   R+DG++ +  R+  I+ FN PD + D FL+STRAGGLG
Sbjct: 578 TQFVGMLDLIEDWCELNDVRVCRIDGSMGNETRQEHIERFNDPDDSFDAFLISTRAGGLG 637

Query: 784 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 843
           INL  AD+VI+FDSDWNPQ DLQA  R HRIGQ   V+VYRL   +T+E  +L RA  K 
Sbjct: 638 INLTAADSVILFDSDWNPQVDLQATDRTHRIGQTKPVIVYRLCCDNTIEHVILTRAASKR 697

Query: 844 ILEYAIISLG--------VTDGSKYTKKNEPNPGELSEIL 875
            LE  +I LG          + S +  +   NP    E++
Sbjct: 698 KLEKMVIQLGKFGTLQRLAGNDSSFISQGHSNPNSNKELM 737

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  270 bits (690), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 188/546 (34%), Positives = 275/546 (50%), Gaps = 79/546 (14%)

Query: 381  ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPL 440
            EL+D+Q TGINW+  L+  + + ILADEMGLGKT Q ++F+++L      NGPH+VVVP 
Sbjct: 501  ELKDYQQTGINWLHLLYQNDLSCILADEMGLGKTCQVISFLAYL-KQTHHNGPHLVVVPS 559

Query: 441  STMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEY 500
            ST+  W   F+K+ P L V  Y G+Q+ R  +R+           +   +++V++TTY  
Sbjct: 560  STLENWLREFNKFCPHLKVEPYYGSQQERAELRDI--------LEENEGQYDVIVTTYNL 611

Query: 501  ILKDRSELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKE 557
                + ++  ++   +  +  DE H LKN+ S  +  L     + RLL+TGTPLQNN+KE
Sbjct: 612  AAGTKYDVSFLRNRNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKE 671

Query: 558  LAALINFLMPGRF---------TIDQEIDFENQDEE-----QEEYIRDLHKRLQPFILRR 603
            L +L+ F+MP  F            Q+    + D+       E  I      ++PFILRR
Sbjct: 672  LMSLLEFIMPNLFVSKKDDLATVFKQKTRTSDADKGYNPLLAEHAIERAKTMMKPFILRR 731

Query: 604  LKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGSKGGHFSL---LNI 657
             K  V K LP K   IL  E++++Q   Y+  + +   +   +  G K    S     N+
Sbjct: 732  KKDQVLKHLPRKHNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNL 791

Query: 658  MSELKKASNHPYLFDNA-EERVLKKF-------------GDGQMSRENV-------LRGL 696
            +  L+KAS HP LF +   ++++ K              G+ +  +E++       L  L
Sbjct: 792  IMALRKASIHPLLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKL 851

Query: 697  I----------------MSSGXXXXXXXXXXXXXXDGH-RVLIFSQMVRMLDILGDYLSI 739
                             M+SG                H +VL+FS   ++LDIL   LS 
Sbjct: 852  CCKFPSLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLST 911

Query: 740  KGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDW 799
              I F RLDG      R+  ID F   D T  VFLLST+AGG GINL+ A+ VIIFD  +
Sbjct: 912  LNIKFLRLDGQTQVNDRQSLIDRF-YEDDTIPVFLLSTKAGGFGINLVCANNVIIFDQSF 970

Query: 800  NPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSK 859
            NP  D QA  RAHR+GQ   V V  L+S+DT+EE++L  A+ K+ L+  I        S+
Sbjct: 971  NPHDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHI--------SQ 1022

Query: 860  YTKKNE 865
              KKNE
Sbjct: 1023 EDKKNE 1028

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  269 bits (687), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 183/537 (34%), Positives = 276/537 (51%), Gaps = 80/537 (14%)

Query: 381 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN--GPHIVVV 438
           EL+D+Q TG+NW+  L+  N + ILADEMGLGKT Q ++F+++L   + QN  GPH+VVV
Sbjct: 470 ELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVISFLAYL---KEQNHTGPHLVVV 526

Query: 439 PLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTY 498
           P ST+  W   F K+ P L +  Y G+Q+ R  +R+           + + +++ ++TTY
Sbjct: 527 PSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRDI--------LEENDGQYDAIVTTY 578

Query: 499 EYILKDRSELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNI 555
                +++++  +K   +  +  DE H LKN+ S  +  L     N RLL+TGTPLQNN+
Sbjct: 579 NLASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNL 638

Query: 556 KELAALINFLMPGRFTIDQE-----------IDFENQDEE---QEEYIRDLHKRLQPFIL 601
           +EL +L+ F+MP  F   ++               N+D      +E I      ++PFIL
Sbjct: 639 RELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSNKDYNPLLAQEAIDRAKTIMKPFIL 698

Query: 602 RRLKKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTAG---SKGGHFSLL 655
           RR K  V K LP+K   I   +++  Q   Y     ++ ++   +  G   +  G  +L+
Sbjct: 699 RRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERALV 758

Query: 656 ------NIMSELKKASNHPYLFDN---------AEERVLKK-----FGDGQMSRENV--- 692
                 N++  L+KA+ HP LF +           ER+L +      G+    RE++   
Sbjct: 759 AQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADSGNRDYIREDMSYM 818

Query: 693 ----LRGLI----------------MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDI 732
               L  L                 M+SG                 + L+FS   ++LDI
Sbjct: 819 CDLELHRLCCRFPSLASFQLSEPTWMASGKVHRLQPLLRAAIARREKTLVFSLFTQVLDI 878

Query: 733 LGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTV 792
           L   LS  GI F RLDG+ P   R+  ID F+  D+   VFLLST+AGG GINL+ A+ V
Sbjct: 879 LELVLSSLGIAFLRLDGSTPVNDRQALIDRFHT-DTDVPVFLLSTKAGGFGINLVCANHV 937

Query: 793 IIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 849
           IIFD  +NP  D QA  RAHR+GQ   V V  LVS+ TVEE++L+ AR K+ L+ ++
Sbjct: 938 IIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALDSSV 994

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  270 bits (690), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 180/543 (33%), Positives = 275/543 (50%), Gaps = 73/543 (13%)

Query: 365  PKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 424
            P   K  + P  +K   LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+  
Sbjct: 1297 PSKAKPFKLPVAIK-ATLRKYQQDGINWLAFLNKYHLHGILCDDMGLGKTLQTICIIASD 1355

Query: 425  IYARRQNG-----------PHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIR 473
             Y R++             P ++V P S    W+  F++++P L ++ Y G    R  +R
Sbjct: 1356 QYLRQEEYKLSGNIECRPLPSLIVCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVRQPLR 1415

Query: 474  EFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYE 533
                        K+    ++++T+Y+    D   + S  + +  +DE H +KNA+S L +
Sbjct: 1416 ------------KQLSSADIIITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKLAK 1463

Query: 534  SLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG----------RFT--IDQEIDFENQ 581
            ++   K N+RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +  
Sbjct: 1464 AVKLIKANHRLILTGTPIQNNVVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNSKTS 1523

Query: 582  DEEQEE---YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY------ 632
             +EQE     +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y      
Sbjct: 1524 SKEQEAGALALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYEDFAKK 1583

Query: 633  -KNILTKNY-SALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGD------ 684
             KN++ K+  +     SK   F  L  M   +K  NHP L  + +   LK+  +      
Sbjct: 1584 QKNVVEKDIQNTADVDSKQHIFQALQYM---RKLCNHPALVLSNDHPQLKQIQNYLKQTG 1640

Query: 685  ------GQMSRENVLRGLIMSSG-------XXXXXXXXXXXXXXDGHRVLIFSQMVRMLD 731
                      +   LR L+   G                       HR LIF Q+  MLD
Sbjct: 1641 CDLHDIRNAPKLTALRTLLFECGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLD 1700

Query: 732  ILGDYL---SIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMT 788
            ++ + L    +  +++ RLDG+V    R+  +  FN  D + D  LL+T+ GGLG+NL  
Sbjct: 1701 MIENDLFKRYMPSVSYMRLDGSVDPRDRQKVVRKFNE-DPSIDCLLLTTKVGGLGLNLTG 1759

Query: 789  ADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYA 848
            ADTVI  + DWNP  DLQAM RAHR+GQK  V VYR+V+K T+EE+++   + KM +   
Sbjct: 1760 ADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIAST 1819

Query: 849  IIS 851
            +++
Sbjct: 1820 VVN 1822

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  269 bits (687), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 180/541 (33%), Positives = 277/541 (51%), Gaps = 72/541 (13%)

Query: 365  PKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 424
            P   K    P  +K   LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+  
Sbjct: 1263 PSKAKPFSLPVAIK-ATLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASD 1321

Query: 425  IYARRQNG-----------PHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIR 473
             Y R+++            P ++V P S    W++ F+++AP L V+ Y G   +R  +R
Sbjct: 1322 QYLRQEDYKTTKSVETRPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTRYPLR 1381

Query: 474  EFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYE 533
                       GK     ++++T+Y+    D   +    + +  +DE H +KN++S L +
Sbjct: 1382 -----------GKLG-DADIVVTSYDVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAK 1429

Query: 534  SLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG----------RFT--IDQEIDFENQ 581
            ++ S + N+RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +  
Sbjct: 1430 AVKSIRANHRLILTGTPIQNNVVELWSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTS 1489

Query: 582  DEEQEE---YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK----- 633
             +EQE     +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + YK     
Sbjct: 1490 SKEQEAGALALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKK 1549

Query: 634  --NILTKNY-SALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGD------ 684
              NI+ ++  + +   SK   F  L  M   +K  NHP L  + +     +  D      
Sbjct: 1550 QKNIVERDIENTMELESKNHIFQALQYM---RKLCNHPSLVLSKDHPQYNQVQDYLSQTG 1606

Query: 685  ------GQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDG------HRVLIFSQMVRMLDI 732
                      +   LR L++  G                      HR LIF Q+  MLD+
Sbjct: 1607 MDIHDIAHAPKLGALRNLLLECGIGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDM 1666

Query: 733  LGDYL---SIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTA 789
            + + L    +  +T+ RLDG+V S  R+  +  FN  D + D  LL+T+ GGLG+NL  A
Sbjct: 1667 IENDLFKKYLPSVTYMRLDGSVESRDRQKVVRKFNE-DPSIDCLLLTTKVGGLGLNLTGA 1725

Query: 790  DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 849
            DTVI  + DWNP  DLQAM RAHR+GQK  V VYR+++K ++EE+++   + KM +   +
Sbjct: 1726 DTVIFIEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTV 1785

Query: 850  I 850
            +
Sbjct: 1786 V 1786

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  268 bits (684), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 177/540 (32%), Positives = 273/540 (50%), Gaps = 70/540 (12%)

Query: 365  PKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 424
            P   K  + P  +K   LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+  
Sbjct: 1271 PSKAKPFKLPVAIK-ATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASD 1329

Query: 425  IYARRQNG-----------PHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIR 473
             Y R ++            P +++ P S    W++ F +++P LNV+ Y G    R    
Sbjct: 1330 QYLRSEDYKKTQSEKTRPLPSLIICPPSLTGHWEQEFQQYSPTLNVLVYAGGPSVR---- 1385

Query: 474  EFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYE 533
                    Y    +    ++++T+Y+    D   L    + +  +DE H +KN++S L +
Sbjct: 1386 --------YPLQGQVPTADIVVTSYDVARNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAK 1437

Query: 534  SLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG----------RFT--IDQEIDFENQ 581
            ++     N+RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +  
Sbjct: 1438 AVKLINSNHRLVLTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQERFAKPIASSRNSKTS 1497

Query: 582  DEEQEE---YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY------ 632
             +EQE     +  LHK++ PF+LRRLK++V   LP K  +    ELSD+Q + Y      
Sbjct: 1498 SKEQEAGALALEALHKQVLPFMLRRLKEEVLSDLPPKIIQDYYCELSDLQKQLYNDFVKK 1557

Query: 633  -KNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAE-------ERVLKKFG- 683
             KN++ K+           H  +   +  ++K  NHP L  N+        +  L + G 
Sbjct: 1558 QKNVVEKDIENTAEVENKQH--IFQALQYMRKLCNHPSLVLNSSHPQFQQVQSYLSQTGM 1615

Query: 684  ----DGQMSRENVLRGLIMSSGXXXXXXXXXXXX------XXDGHRVLIFSQMVRMLDIL 733
                 G   +   L+ L++  G                      HRVLIF Q+  MLD++
Sbjct: 1616 DLHDIGHAPKLEALKTLLLECGIGIQDVEKKSNKNPSIDNVISQHRVLIFCQLKDMLDMV 1675

Query: 734  GDYL---SIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTAD 790
             + L    +  +TF RLDG+V S  R+  +  FN  D + D  LL+T+ GGLG+NL  AD
Sbjct: 1676 ENDLLKKHLPSVTFMRLDGSVDSRDRQKVVRKFNE-DPSIDCLLLTTKVGGLGLNLTGAD 1734

Query: 791  TVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 850
            TVI  + DWNP  DLQAM RAHR+GQK  V VYR+++K T+EE+++   + KM +   I+
Sbjct: 1735 TVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIV 1794

>Scas_664.9
          Length = 1859

 Score =  266 bits (679), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 178/543 (32%), Positives = 271/543 (49%), Gaps = 72/543 (13%)

Query: 365  PKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 424
            P   K  + P  +K   LR +Q  G+NW+AFL     +GIL D+MGLGKT+QT+  I+  
Sbjct: 1251 PSKAKPFKLPVAIK-ATLRKYQQDGVNWLAFLNKYRLHGILCDDMGLGKTLQTICIIASD 1309

Query: 425  IYARRQNG-----------PHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIR 473
             Y R ++            P ++V P S    W+  F+++AP L +I Y G    R  +R
Sbjct: 1310 QYLRAEDYKKTNSVETRKLPSLIVCPPSLTGHWENEFEQYAPFLKIIVYAGGPSMRIPLR 1369

Query: 474  EFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYE 533
            +          G  +I    ++T+Y+    D S +    + +  +DE H +KNA+S L +
Sbjct: 1370 D--------ELGSADI----VITSYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAK 1417

Query: 534  SLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG----------RFT--IDQEIDFENQ 581
            ++     N+RL++TGTP+QNN+ EL +L +FLMPG          +F   I    + +  
Sbjct: 1418 AVKQISANHRLILTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTS 1477

Query: 582  DEEQEE---YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY------ 632
             +EQE     +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y      
Sbjct: 1478 SKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKK 1537

Query: 633  -KNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDG------ 685
             KN++ K+    T      H  +   +  ++K  NHP L  +     L +  D       
Sbjct: 1538 QKNVVEKDIENTTDTDNSQH--IFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGI 1595

Query: 686  ------QMSRENVLRGLIMSSGX--------XXXXXXXXXXXXXDGHRVLIFSQMVRMLD 731
                     + N LR L+   G                        HR LIF Q+  MLD
Sbjct: 1596 DLHDVINAPKLNALRTLLFECGIGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLD 1655

Query: 732  ILGDYL---SIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMT 788
            ++ + L    +  +T+ RLDG+V    R+  +  FN  D + D  LL+T+ GGLG+NL  
Sbjct: 1656 MVENDLFKRYMPSVTYMRLDGSVDPRDRQKVVRKFNE-DPSIDCLLLTTKVGGLGLNLTG 1714

Query: 789  ADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYA 848
            ADTVI  + DWNP  DLQAM RAHR+GQK  V VYR+++K T+EE+++   + KM +   
Sbjct: 1715 ADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIAST 1774

Query: 849  IIS 851
            +++
Sbjct: 1775 VVN 1777

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  261 bits (667), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 171/528 (32%), Positives = 256/528 (48%), Gaps = 76/528 (14%)

Query: 379 FGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV 438
           F  L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q ++F++ L ++   +GP ++V 
Sbjct: 282 FPLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIISFLASLHHSGMLDGPILIVC 341

Query: 439 PLSTMPAWQETFDKWAPDLNVICY------MGNQR--SRDAIREFEFYTNP-------YA 483
           P + M  W   F  W P    +        M N+   S D + E    +NP       Y 
Sbjct: 342 PATVMKQWCNEFHTWWPPFRAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYT 401

Query: 484 KGKKN-----IKFN-------------VLLTTYEYILKDRSELGSIKWQFLAVDEAHRLK 525
             KK       K N             VL+TTY  +     EL  +KW +  +DE H+++
Sbjct: 402 DSKKTKSTMESKLNLTKLVDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIR 461

Query: 526 NAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRF----TIDQEI----- 576
           N +S +  +    K +NR++++GTP+QNN+ EL +L +F+ PGR        Q+      
Sbjct: 462 NPDSDISLTCKQLKTSNRVILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPIN 521

Query: 577 --DFENQDEEQEE-------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDV 627
              + N    Q +        +RDL   + P++LRR+K DV K LP K E +L  +L+  
Sbjct: 522 MGGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQY 578

Query: 628 QTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQM 687
           Q   Y   L    S      K G   +L  +  L+K  NHP +         + +GD + 
Sbjct: 579 QRNKYLQFLN---SGDLVKIKNGKRQVLYGIDILRKICNHPDILVRDMRHSEESYGDPK- 634

Query: 688 SRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLS-----IKGI 742
                       SG               GH+ L+F+Q  +MLDIL  ++S     +  +
Sbjct: 635 -----------RSGKMQVVKQLLKLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSL 683

Query: 743 TFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ 802
           T+ R+DGT   A R+  +D FN  +   DVFLL+TR GGLG+NL  A+ +IIFD DWNP 
Sbjct: 684 TYLRMDGTTNIAARQHLVDKFN--NELYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS 741

Query: 803 ADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 850
            DLQA  RA RIGQK  V +YRL+   ++EE++  R   K  L   I+
Sbjct: 742 TDLQARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLTNKIL 789

>Kwal_26.7123
          Length = 1081

 Score =  261 bits (666), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 185/546 (33%), Positives = 273/546 (50%), Gaps = 94/546 (17%)

Query: 382  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN---GPHIVVV 438
            L+D+Q TGINW+  L+  N + ILADEMGLGKT Q +AF+S+L    +QN   GPH+VVV
Sbjct: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579

Query: 439  PLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTY 498
            P ST+  W   F+K+ PDL +  Y G+Q+ R  +R+             + +++V++TTY
Sbjct: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDI--------LEDNDGQYDVIVTTY 631

Query: 499  EYILKDRSELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNI 555
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   + N RLL+TGTPLQNN+
Sbjct: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691

Query: 556  KELAALINFLMPGRFTIDQEIDFE------------NQDEE---QEEYIRDLHKRLQPFI 600
            KEL +L+ F+MP  F I ++ D              N+D      +E I      ++PFI
Sbjct: 692  KELMSLLEFIMPNLF-ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFI 750

Query: 601  LRRLKKDVEKSLPSKTERILRVELSDV----------QTEYYKNILTKNYSAL------- 643
            LRR K  V K LP K  +I   E+SDV          Q   +K +L +            
Sbjct: 751  LRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEGSAEEPRP 810

Query: 644  TAGSKGGHFSLLNIMSELKKASNHP----------------------------------- 668
            T  + G   S   IMS L+KA+ HP                                   
Sbjct: 811  TKKNGGAQISKNLIMS-LRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQ 869

Query: 669  ----YLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXX-XXDGHRVLIF 723
                Y+ D    R+  +F D  +++  +     M+SG                  +VL+F
Sbjct: 870  EDMSYMNDFELHRLCTRFPDS-LAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVF 928

Query: 724  SQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLG 783
            S   +MLDIL   L+   I F RLDG+     R+  ID F+  D T  VF+LST+AGG G
Sbjct: 929  SLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFH-DDDTIPVFILSTKAGGFG 987

Query: 784  INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 843
            INL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +  L++++++EE++L+ A+ K+
Sbjct: 988  INLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKL 1047

Query: 844  ILEYAI 849
             L+  I
Sbjct: 1048 ALDTYI 1053

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  264 bits (674), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 179/544 (32%), Positives = 275/544 (50%), Gaps = 74/544 (13%)

Query: 365  PKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 424
            P   K  + P  +K   LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+  
Sbjct: 1256 PSKAKPFKLPIAIK-ATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASD 1314

Query: 425  IYARRQNG-----------PHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIR 473
             Y R+++            P +++ P S    W+  FD++AP L V+ Y G    R  +R
Sbjct: 1315 QYLRKEDYEKTRSVESRALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVRLTLR 1374

Query: 474  EFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYE 533
                   P          ++++T+Y+    D + L   ++ +  +DE H +KN++S L +
Sbjct: 1375 -------PQLSDA-----DIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAK 1422

Query: 534  SLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG----------RFT--IDQEIDFENQ 581
            ++     N+RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +  
Sbjct: 1423 AVKEITANHRLILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTS 1482

Query: 582  DEEQEE---YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY------ 632
             +EQE     +  LHK++ PF+LRRLK+DV   LP K  +    EL D+Q + Y      
Sbjct: 1483 SKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKK 1542

Query: 633  -KNILTKNY-SALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDG----- 685
             KN++ K+  ++  A  K   F  L  M   +K  NHP L  +     L +  D      
Sbjct: 1543 QKNVVEKDIENSEIADGKQHIFQALQYM---RKLCNHPALVLSPNHPQLAQVQDYLKQTG 1599

Query: 686  -------QMSRENVLRGLIMSSGXXXXXXXXXXXXXXD--------GHRVLIFSQMVRML 730
                      + + LR L+   G              +         HR LIF Q+  ML
Sbjct: 1600 LDLHDIINAPKLSALRTLLFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDML 1659

Query: 731  DILGDYLSIK---GITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLM 787
            D++ + L  K    +T+ RLDG++    R+  +  FN  D + D  LL+T+ GGLG+NL 
Sbjct: 1660 DMVENDLFKKYMPSVTYMRLDGSIDPRDRQKVVRKFNE-DPSIDCLLLTTKVGGLGLNLT 1718

Query: 788  TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEY 847
             ADTVI  + DWNP  DLQAM RAHRIGQK  V VYR+++K T+EE+++   + KM +  
Sbjct: 1719 GADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIAS 1778

Query: 848  AIIS 851
             +++
Sbjct: 1779 TVVN 1782

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  258 bits (660), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 178/538 (33%), Positives = 271/538 (50%), Gaps = 78/538 (14%)

Query: 382  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLS 441
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F+++L     Q  PH++VVP S
Sbjct: 572  LKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYLKQIG-QPSPHLIVVPSS 630

Query: 442  TMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYI 501
            T+  W   F K+ P L +  Y G Q+ R  +RE           + + K++V++TTY   
Sbjct: 631  TLENWLREFQKFCPSLKIEPYYGTQQERADLREI--------LERNDGKYDVIVTTYNLA 682

Query: 502  LKDRSELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKEL 558
              ++ ++  +K   +  +  DE H LKN+ S  +  L     N RLL+TGTPLQNN+KEL
Sbjct: 683  AGNKYDVSFLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKEL 742

Query: 559  AALINFLMPGRFTIDQEI-------DFENQDEEQ-------EEYIRDLHKRLQPFILRRL 604
             +L+ F+MP  F   +E          +  D+ +       ++ I      ++PFILRR 
Sbjct: 743  MSLLEFIMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITRAKTMMKPFILRRR 802

Query: 605  KKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTAG---------SKGGHF 652
            K  V K LP+K  R     ++D Q E Y     ++ ++   +  G         SK  + 
Sbjct: 803  KDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKIENN 862

Query: 653  SLLNIMSELKKASNHP----YLFDNA----------EERVLKKFGDGQMSRENV------ 692
            S  N++  L+KAS HP    +++D+A          +E    + G+ +  RE++      
Sbjct: 863  SSKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDMSFMTDF 922

Query: 693  -LRGLI-----------------MSSGXXXXXXXXXXXXXXDG-HRVLIFSQMVRMLDIL 733
             L  L                  M+SG                  +VLIF+   ++LDIL
Sbjct: 923  ELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVLDIL 982

Query: 734  GDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVI 793
               LS     F RLDG+     R+  ID F   D+T  +F+LSTRAGG GINL+ A+ VI
Sbjct: 983  EKVLSTLNYKFLRLDGSTQVNDRQTMIDKF-YDDNTIPIFMLSTRAGGFGINLVCANHVI 1041

Query: 794  IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 851
            IFD  +NP  D QA  RAHR+GQ   V V  L++KD++EE++ + A+ K+ L+  + S
Sbjct: 1042 IFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDSQVSS 1099

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  257 bits (656), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 170/528 (32%), Positives = 258/528 (48%), Gaps = 72/528 (13%)

Query: 379 FGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV 438
           F  L  +Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF++ L ++R+ NGP +VV 
Sbjct: 262 FPLLFPYQKTCVQWLCELYQQGCGGIIGDEMGLGKTIQIIAFLATLHHSRKLNGPVLVVC 321

Query: 439 PLSTMPAWQETFDKWAPDLNVICYMG-----NQRSRDAIREFE----------FYTNPYA 483
           P + M  W   F  W P    +         N+ ++    E E          F  N Y 
Sbjct: 322 PATVMKQWCNEFHTWWPPFRAVILHSIGAGMNKGTQIPEEELEKMLMTSNYGTFTYNDYE 381

Query: 484 K---------GKKNIK---------FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLK 525
           K          +K++K          ++++TTY  +      L +++W +  +DE H+++
Sbjct: 382 KKEKTRTSLESRKSVKKLLEKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIR 441

Query: 526 NAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRF----TIDQEI----- 576
           N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+        Q+      
Sbjct: 442 NPDSDISLTCKQLKTQNRIILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPIN 501

Query: 577 --DFENQDEEQEE-------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDV 627
              + N    Q +        +RDL   + P++LRR+K DV K LP K E +L  +L+  
Sbjct: 502 MGGYANASNIQVKTGYKCAVALRDL---ISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQY 558

Query: 628 QTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQM 687
           Q   Y   L   +S      + G   +L  +  L+K  NHP L D       KK  D   
Sbjct: 559 QKSKYLEFL---HSDELMKIRKGKRQVLYGIDILRKICNHPDLLDLKR----KKMND--- 608

Query: 688 SRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKG-----I 742
             E+   G    SG               GH+ L+F+Q  +MLDIL +++S K      +
Sbjct: 609 -YEDADYGNPARSGKMQVVKQLLLLWHSQGHKTLLFTQSRQMLDILQEFISYKDPELSDL 667

Query: 743 TFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ 802
            F R+DGT     R+  +D FN  +   DVFLL+TR GGLGINL  A+ +IIFD DWNP 
Sbjct: 668 KFLRMDGTTNIGSRQSLVDKFN--NEPYDVFLLTTRVGGLGINLTGANRIIIFDPDWNPS 725

Query: 803 ADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 850
            D+QA  RA RIGQK  V +YRL+   ++EE++  R   K  L   I+
Sbjct: 726 TDMQARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLSNKIL 773

>Scas_549.4
          Length = 1079

 Score =  257 bits (656), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 170/565 (30%), Positives = 271/565 (47%), Gaps = 83/565 (14%)

Query: 379 FGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV 438
           F  L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q +AF++ L ++   NGP ++V 
Sbjct: 301 FSLLFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIIAFLASLHHSGLLNGPVLIVC 360

Query: 439 PLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREF--------------------EFY 478
           P + M  W      W P L  I            + F                    +F 
Sbjct: 361 PATVMKQWCNELHHWWPPLRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQ 420

Query: 479 TNPYAKGKKNIKFNV-------------LLTTYEYILKDRSELGSIKWQFLAVDEAHRLK 525
                K      FN+             ++TTY  +     +L  + W +  +DE H+++
Sbjct: 421 NRSKTKASLESTFNIQSLIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIR 480

Query: 526 NAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRF----TIDQEI----- 576
           N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+        Q+      
Sbjct: 481 NPDSDISLTCKKIKTPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPIN 540

Query: 577 --DFEN----QDEEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTE 630
              + N    Q +   +    L   + P++LRR+K DV K LP K E +L  +L+  Q  
Sbjct: 541 AGGYANATNIQVQTGVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKN 600

Query: 631 YYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMS-R 689
            Y   L  N   LT   +GG   +L  +  L+K  NHP L +  E +    +G+ + S +
Sbjct: 601 RYLEFLNSN--ELTQ-IRGGRRHVLYGIDILRKICNHPDLLEREERQYETDYGNPKRSGK 657

Query: 690 ENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKG-----ITF 744
             V++ L++                 +GH+ L+F+Q  +MLDIL  ++  K      + +
Sbjct: 658 MQVVKQLLL-------------LWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKY 704

Query: 745 QRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 804
            R+DGT   ++R+  +D FN  D   DVFLL+TR GGLG+NL  A+ +II+D DWNP  D
Sbjct: 705 LRMDGTSNISKRQGLVDQFNNEDY--DVFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTD 762

Query: 805 LQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTD--GSKYTK 862
           +QA  RA RIGQK  V +YRL+   ++EE++  R   K  L   I+    TD    ++ K
Sbjct: 763 MQARERAWRIGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKIL----TDPKQKRFFK 818

Query: 863 KNEPNPGELSEILKFGAGNMFAAKD 887
            N     EL ++   G  N  A+++
Sbjct: 819 MN-----ELRDLFTLGGDNGLASEE 838

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  257 bits (657), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 180/536 (33%), Positives = 266/536 (49%), Gaps = 78/536 (14%)

Query: 382  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLS 441
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F ++L     + GPH+VVVP S
Sbjct: 572  LKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLKQIN-EPGPHLVVVPSS 630

Query: 442  TMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYI 501
            T+  W   F K+AP L +  Y G+ + R+ +R+           +   K++V++TTY   
Sbjct: 631  TLENWLREFQKFAPALKIEPYYGSLQEREELRDI--------LERNAGKYDVIVTTYNLA 682

Query: 502  LKDRSELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKEL 558
              ++ ++  +K   +  +  DE H LKN+ S  +  L   + N RLL+TGTPLQNN+KEL
Sbjct: 683  AGNKYDVSFLKNRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKEL 742

Query: 559  AALINFLMPGRFTIDQEI-------------DFENQDE-EQEEYIRDLHKRLQPFILRRL 604
             +L+ F+MP  F   +E              D +N +    +E I      ++PFILRR 
Sbjct: 743  MSLLEFIMPNLFISKKESFDAIFKQRAKTTDDNKNHNPLLAQEAITRAKTMMKPFILRRR 802

Query: 605  KKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTAG---------SKGGHF 652
            K  V K LP K   I   EL+ +Q + Y     I+ ++   +  G         SK    
Sbjct: 803  KDQVLKHLPPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQSS 862

Query: 653  SLLNIMSELKKASNHPYLFDNA-EERVLKKFGDGQMSR----ENVLRGLI---------- 697
            S  N++  L+KAS HP LF N   ++++ K  D  +      EN  +  I          
Sbjct: 863  SSKNLIMALRKASLHPLLFRNIYNDKIITKMSDAILDEPAYAENGNKEYIKEDMSYMTDF 922

Query: 698  -----------------------MSSGXXXXXXXXXXXXXXDGH-RVLIFSQMVRMLDIL 733
                                   M SG              D   +VLIFS   ++LDIL
Sbjct: 923  ELHKLCCNFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDIL 982

Query: 734  GDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVI 793
               LS     F RLDG+     R++ ID F   D    +F+LST+AGG GINL+ A+ VI
Sbjct: 983  EMVLSTLDYKFLRLDGSTQVNDRQLLIDKF-YEDKDIPIFILSTKAGGFGINLVCANNVI 1041

Query: 794  IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 849
            IFD  +NP  D QA  RAHR+GQ   V +  L++KD++EE++ + A+ K+ L+  I
Sbjct: 1042 IFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKLALDSYI 1097

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  256 bits (655), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 168/531 (31%), Positives = 270/531 (50%), Gaps = 84/531 (15%)

Query: 382 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLS 441
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q +AFI+ L ++    GP ++V P +
Sbjct: 297 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPAT 356

Query: 442 TMPAWQETFDKWAPDLNVICY--MGNQRSRDAIREFEFYTNPY----------------- 482
            M  W   F  W P L  +    MG+  + D  ++F+   N                   
Sbjct: 357 VMKQWCNEFQHWWPPLRTVILHSMGSGMASD--QKFKMDENDLENLIMNSKPSDFSYEDW 414

Query: 483 ---AKGKKNIKF---------------NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRL 524
               + KK ++                ++L+TTY  +     +L  +KWQ+  +DE H++
Sbjct: 415 KNSTRTKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKI 474

Query: 525 KNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGR----------FTIDQ 574
           +N +S +  +    K +NR++++GTP+QNN+ EL +L +F+ PG+          F I  
Sbjct: 475 RNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPI 534

Query: 575 EID-FENQDEEQEEY-------IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSD 626
            I  + N    Q +        +RDL   + P++LRR+K DV K LP K E +L  +L+ 
Sbjct: 535 NIGGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKADVAKDLPQKKEMVLFCKLTK 591

Query: 627 VQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQ 686
            Q   Y   L   +S+     + G  ++L  +  L+K  NHP L D   +R    +GD +
Sbjct: 592 YQRSKYLEFL---HSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDTKRHNPDYGDPK 648

Query: 687 MS-RENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKG---- 741
            S +  V++ L++                  G++ L+F+Q  +MLDIL +++S K     
Sbjct: 649 RSGKMQVVKQLLL-------------LWHKQGYKALLFTQSRQMLDILEEFISTKDPDLS 695

Query: 742 -ITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWN 800
            + + R+DGT     R+  +D FN  + + DVFLL+TR GGLG+NL  A+ +IIFD DWN
Sbjct: 696 HLNYLRMDGTTNIKGRQSLVDRFN--NESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWN 753

Query: 801 PQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 851
           P  D+QA  RA RIGQK  V +YRL+   ++EE++  R   K  L   I++
Sbjct: 754 PSTDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILT 804

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  256 bits (654), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 166/530 (31%), Positives = 260/530 (49%), Gaps = 78/530 (14%)

Query: 379 FGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV 438
           F  L ++Q TG+ W+  L+ +   GI+ DEMGLGKT+Q  AF++ L ++   +GP ++V 
Sbjct: 294 FSLLFNYQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTAFLAALHHSNLLSGPVLIVC 353

Query: 439 PLSTMPAWQETFDKWAPDLNVICYMG-----NQRS---RDAIR-----------EFEFYT 479
           P + M  W     +W P    +         N +S    D I            +F  Y 
Sbjct: 354 PATVMKQWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYE 413

Query: 480 NPYAKGKKNIKF---------------NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRL 524
           N  +K K  ++                ++++TTY  +     +L ++ W +  +DE H++
Sbjct: 414 NA-SKLKSKVETGMHMQNLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKI 472

Query: 525 KNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRF----TIDQEI---- 576
           +N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR        Q+     
Sbjct: 473 RNPDSEISLTCKKLKCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPI 532

Query: 577 ---DFENQDEEQEEY-------IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSD 626
               + N    Q +        +RDL   + P++LRR+K DV K LP K E +L  +L++
Sbjct: 533 NMGGYANATNTQVQTGYRCAVALRDL---ISPYLLRRVKADVAKDLPKKKEMVLFCKLTE 589

Query: 627 VQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQ 686
            Q   Y   L+   S   +  KGG   +L  +  L+K  NHP L D    +    +GD +
Sbjct: 590 FQRRKYLEFLS---SDELSQIKGGKRHVLYGIDILRKICNHPDLLDRDYIKNTSGYGDPK 646

Query: 687 MSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIK-----G 741
                        SG              +GH+ L+F+Q  +MLDIL +++  K      
Sbjct: 647 ------------RSGKMQVVKQLLKLWKSEGHKTLLFTQSRQMLDILEEFIKFKEPELSD 694

Query: 742 ITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNP 801
           I + R+DGT     R+  +D FN  + + DVFLL+TR GGLG+NL  A+ +II+D DWNP
Sbjct: 695 IRYLRMDGTTSIQVRQTLVDRFN--NESYDVFLLTTRVGGLGVNLTGANRIIIYDPDWNP 752

Query: 802 QADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIIS 851
             DLQA  RA RIGQK  V +YRL+   T+EE++  R   K  L   ++S
Sbjct: 753 STDLQARERAWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLS 802

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  251 bits (640), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 174/573 (30%), Positives = 279/573 (48%), Gaps = 90/573 (15%)

Query: 379 FGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV 438
           F +L  +Q T + W+  L  +N  GI+ DEMGLGKT+Q V+F++ L ++ +  GP +VV 
Sbjct: 260 FDKLFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVC 319

Query: 439 PLSTMPAWQETFDKWAPDLNVICY------------MGNQR-----SRDAIREFEF--YT 479
           P + M  W   F  W P    +              M  ++      RD   EF +  Y 
Sbjct: 320 PATVMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYA 379

Query: 480 NPYAKGKKNIKF---------------NVLLTTYEYILKDRSELGSIKWQFLAVDEAHRL 524
           N   + KK ++                ++L+TTY  +      L  + W +  +DE H++
Sbjct: 380 N-LGRTKKQLEARRGIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKI 438

Query: 525 KNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRF----TIDQEI---- 576
           +N ++ +  +    +  +R++++GTP+QNN+ EL +L +F+ PG+        Q+     
Sbjct: 439 RNPDAGISLTCKRLRTPHRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPI 498

Query: 577 ---DFENQDEEQEE-------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSD 626
               + N    Q +        +RDL   + P++LRR+K DV K LP K E +L  +++ 
Sbjct: 499 NAGGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQ 555

Query: 627 VQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQ 686
            Q E Y   L    S      K G   +L  +  L+K  NHP L +    +    FGD +
Sbjct: 556 FQKEKYLQFLN---SEDMIKIKNGRRQVLYGIDILRKICNHPDLLERDFRKHEPSFGDPR 612

Query: 687 MS-RENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLS-----IK 740
            S +  V++ L+++                 GH+ L+F+Q  +MLDIL  Y+S     + 
Sbjct: 613 RSGKMTVIKQLLLT-------------WKKQGHKALLFTQSRQMLDILEAYISHKDPELA 659

Query: 741 GITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWN 800
           G+ + R+DGT   A R+  +D FN  +    +FLL+TR GGLG+NL  A+ +IIFD DWN
Sbjct: 660 GLQYLRMDGTTNIAHRQALVDRFN--NGPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWN 717

Query: 801 PQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKY 860
           P  DLQA  RA RIGQK  V +Y L+   ++EE++  R   K  L   ++S       ++
Sbjct: 718 PSTDLQARERAWRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLS--DPKQKRF 775

Query: 861 TKKNEPNPGELSEILKFGAG---NMFAAKDNQK 890
            K N     EL ++  FG G   + FA++  Q+
Sbjct: 776 FKMN-----ELHDLFSFGPGAASDSFASEIEQQ 803

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  232 bits (591), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/365 (35%), Positives = 204/365 (55%), Gaps = 40/365 (10%)

Query: 349 SKILPQNSTNYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADE 408
           S + P ++TN      P   + V  PS ++ G LR +Q  G+NW+A L++ N NGILADE
Sbjct: 601 SDLFPADTTN-----DPLAVQDVPTPSLLR-GTLRTYQKQGLNWLASLYNNNTNGILADE 654

Query: 409 MGLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRS 468
           MGLGKT+QT++ +S+L   +   GPH++VVP S +  W+  F ++AP   V+ Y GN + 
Sbjct: 655 MGLGKTIQTISLLSYLACEKHNWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGNPQQ 714

Query: 469 RDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAE 528
           R   R  + +  P A       F+V + +Y+ I++D+      KWQ++ +DEAH +KN  
Sbjct: 715 RKEKR--KGWNKPDA-------FHVCIVSYQLIVQDQHSFKRKKWQYMVLDEAHNIKNFR 765

Query: 529 SSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEID-------FEN- 580
           S+ +++L +F    R+L+TGTPLQNNI EL +L+ FLMP      Q++        F+  
Sbjct: 766 STRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTVIDGQKVSGFADLDAFQQW 825

Query: 581 ----------------QDEEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVEL 624
                           QD E +  +  LH+ L+P++LRRLK DVEK +P K E I+  +L
Sbjct: 826 FGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKADVEKQIPGKYEHIVYCKL 885

Query: 625 SDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGD 684
           S  Q   Y + +++  +  T  S G   S++N + +L+K  NHP LF+    +    FG+
Sbjct: 886 SKRQRFLYDDFMSRAQTKATLAS-GNFMSIVNCLMQLRKVCNHPDLFEVRPIKTSFLFGE 944

Query: 685 GQMSR 689
             ++R
Sbjct: 945 SVIAR 949

 Score =  140 bits (352), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 89/137 (64%), Gaps = 1/137 (0%)

Query: 717  GHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLS 776
            GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN+ D    VF+LS
Sbjct: 1194 GHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNS-DPKITVFILS 1252

Query: 777  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 836
            +R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  +L
Sbjct: 1253 SRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNIL 1312

Query: 837  ERARKKMILEYAIISLG 853
            ++A +K  L+  II  G
Sbjct: 1313 KKANQKRQLDDVIIQKG 1329

>Kwal_34.16082
          Length = 726

 Score =  222 bits (566), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 144/482 (29%), Positives = 232/482 (48%), Gaps = 70/482 (14%)

Query: 379 FGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV 438
           F  L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF++ L ++ + +GP ++V 
Sbjct: 260 FRLLFNYQKTCVQWLYELFQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLDGPVLIVC 319

Query: 439 PLSTMPAWQETFDKWAPDLNVICYMG--------NQRSRDAIREFEFYTNP-------YA 483
           P + +  W + F  W P    +            +  S + + E    +NP       Y 
Sbjct: 320 PATVLRQWCKEFHTWWPPFRTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYM 379

Query: 484 KGKKN------------------IKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLK 525
             K+                    + ++L+TTY  +      L +++W +  +DE H+++
Sbjct: 380 DSKRTKSTLESGMARSKLINKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIR 439

Query: 526 NAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGR----------FTIDQE 575
           N ++ +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR          F+I   
Sbjct: 440 NPDADISLTCKKLKTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPIN 499

Query: 576 I-DFEN----QDEEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTE 630
           +  + N    Q +   +    L   + P++LRR+K DV K LP K E +L  +L+  Q  
Sbjct: 500 VGGYANATNIQVQTGYKCAIALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRR 559

Query: 631 YYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRE 690
            Y   L  N   LT   K G   +L  +  L+K  NHP L +  +      +GD +    
Sbjct: 560 KYLQFL--NSEDLTK-IKNGKRQVLFGIDILRKICNHPDLLEKDKRENESSYGDPK---- 612

Query: 691 NVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIK-----GITFQ 745
                    SG               GH+ L+F+Q  +MLDIL  ++S K      +T+ 
Sbjct: 613 --------RSGKMQVVKQLLRLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYL 664

Query: 746 RLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL 805
           R+DGT     R+  +D FN  +   DVFLL+TR GGLG+NL  A+ +IIFD DWNP  D+
Sbjct: 665 RMDGTTNIGSRQALVDSFN--NGLYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDM 722

Query: 806 QA 807
           QA
Sbjct: 723 QA 724

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  226 bits (577), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 184/317 (58%), Gaps = 35/317 (11%)

Query: 380 GELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVP 439
           G LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT+A +++L   +   GPH+++VP
Sbjct: 669 GTLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIALLAYLACEKENWGPHLIIVP 728

Query: 440 LSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNI-KFNVLLTTY 498
            S +  W+  F ++AP   V+ Y G+ + R   R          +G   +  F+V +T+Y
Sbjct: 729 TSVLLNWEMEFKRFAPGFKVLSYYGSPQQRKEKR----------RGWNKLDAFHVCITSY 778

Query: 499 EYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKEL 558
           + ++ D+      KWQ++ +DEAH +KN +S+ +++L +F    RLL+TGTPLQNNI EL
Sbjct: 779 QLVVHDQHSFKRKKWQYMILDEAHNIKNFKSTRWQALLNFNTRRRLLLTGTPLQNNIAEL 838

Query: 559 AALINFLMP------GRFTIDQEIDFENQ-----------------DEEQEEYIRDLHKR 595
            +L+ FLMP      G+ +   ++D   Q                 D+E    +  LH+ 
Sbjct: 839 WSLLYFLMPQTALENGKISGFADLDAFQQWFGKPVDKIIAANDSEHDDETRRTVSKLHQV 898

Query: 596 LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLL 655
           L+P++LRRLK DVEK +P+K E IL   LS  Q   Y + +++  +  T  S G   S++
Sbjct: 899 LRPYLLRRLKADVEKQMPAKYEHILYCRLSKRQRFLYDDFMSRAQTKATLAS-GNFMSII 957

Query: 656 NIMSELKKASNHPYLFD 672
           N + +L+K  NHP LF+
Sbjct: 958 NCLMQLRKVCNHPDLFE 974

 Score =  137 bits (344), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 88/138 (63%), Gaps = 1/138 (0%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLL 775
            +GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN  D    VF+L
Sbjct: 1232 EGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNT-DPRITVFIL 1290

Query: 776  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 835
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR  S+ T+E  +
Sbjct: 1291 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFASEHTIESNI 1350

Query: 836  LERARKKMILEYAIISLG 853
            L++A +K  L+  +I  G
Sbjct: 1351 LKKANQKRQLDNIVIQKG 1368

>Scas_646.3*
          Length = 1456

 Score =  226 bits (575), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 210/377 (55%), Gaps = 43/377 (11%)

Query: 327 EAAADIVKDAPEQVKHFQNRINSKILPQNSTNYNNSAR--PKFEKL----VEQPSYVKFG 380
           E + D V   PE +       +   L  N     NS +  P  ++L    V  PS ++ G
Sbjct: 584 EDSDDFVMSEPESITPASETPDKGELLPNEAGAENSEQVVPNEQQLSVVDVPVPSLLR-G 642

Query: 381 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPL 440
            LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +++L   ++  GPH++VVP 
Sbjct: 643 TLRTYQKQGLNWLASLFNNNTNGILADEMGLGKTIQTISLLAYLACEKQNWGPHLIVVPT 702

Query: 441 STMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEY 500
           S +  W+  F ++ P L V+ Y G+ + R   R  + +  P A       F+V + +Y+ 
Sbjct: 703 SVLLNWEMEFKRFCPGLKVLTYYGSPQQRKEKR--KGWNKPDA-------FHVCIVSYQL 753

Query: 501 ILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAA 560
           +++D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTPLQNN+ EL +
Sbjct: 754 VVQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWS 813

Query: 561 LINFLMP----------------------GRFTIDQEIDFE---NQDEEQEEYIRDLHKR 595
           L+ FLMP                      GR  +D+ I+      QD E ++ +  LH+ 
Sbjct: 814 LLYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKLIETGAGYQQDAETKKTVSKLHQV 872

Query: 596 LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLL 655
           L+P++LRRLK DVEK +P+K E I+   LS  Q   Y + ++++ +  T  S G   S++
Sbjct: 873 LRPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATLAS-GNFMSIV 931

Query: 656 NIMSELKKASNHPYLFD 672
           N + +L+K  NHP LF+
Sbjct: 932 NCLMQLRKVCNHPDLFE 948

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 92/147 (62%), Gaps = 1/147 (0%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLL 775
            +GHR LIF+QM ++LD+L  +L+  G  + RLDG      R+I  + FN  D    VF+L
Sbjct: 1204 NGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQILTERFNN-DPRVTVFIL 1262

Query: 776  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 835
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  +
Sbjct: 1263 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNI 1322

Query: 836  LERARKKMILEYAIISLGVTDGSKYTK 862
            L++A +K  L+  +I  G      +TK
Sbjct: 1323 LKKANQKRQLDNVVIQRGGFHYDYFTK 1349

>Kwal_55.20143
          Length = 1494

 Score =  224 bits (571), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 189/326 (57%), Gaps = 35/326 (10%)

Query: 371 VEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 430
           V  PS ++ G LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +++L   +  
Sbjct: 661 VPTPSLLR-GTLRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKHN 719

Query: 431 NGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIK 490
            GPH+++VP S +  W+  F ++AP   V+ Y G+ + R   R  + +  P A       
Sbjct: 720 WGPHLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKR--KGWNRPDA------- 770

Query: 491 FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTP 550
           F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTP
Sbjct: 771 FHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTP 830

Query: 551 LQNNIKELAALINFLMP----------------------GRFT--IDQEIDFENQDEEQE 586
           LQNN+ EL +L+ FLMP                      GR    I Q  +   QDEE  
Sbjct: 831 LQNNLAELWSLLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETR 890

Query: 587 EYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG 646
           + +  LH+ L+P++LRRLK DVEK +P+K E ++   LS  Q   Y + +++  +  T  
Sbjct: 891 KTVTKLHQVLRPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETLS 950

Query: 647 SKGGHFSLLNIMSELKKASNHPYLFD 672
           S G   S++N + +L+K  NHP LF+
Sbjct: 951 S-GNFMSIINCLMQLRKVCNHPDLFE 975

 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (64%), Gaps = 1/137 (0%)

Query: 717  GHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLS 776
            GHR LIF+QM ++LD+L  +L+  G  + RLDG     +R+I  + FN  D+    F+LS
Sbjct: 1233 GHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQILTERFNT-DNRITAFILS 1291

Query: 777  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 836
            +R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  +L
Sbjct: 1292 SRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNIL 1351

Query: 837  ERARKKMILEYAIISLG 853
            ++A +K  L+  +I  G
Sbjct: 1352 KKANQKRQLDNVVIQRG 1368

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  224 bits (570), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 191/326 (58%), Gaps = 35/326 (10%)

Query: 371  VEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 430
            V  PS ++ G LR +Q  G+NW+A L++   NGILADEMGLGKT+QT++ +++L   +  
Sbjct: 755  VPVPSLLR-GTLRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKEN 813

Query: 431  NGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIK 490
             GPH++VVP S +  W+  F ++AP   V+ Y G+ + R   R  + +  P A       
Sbjct: 814  WGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRREKR--KGWNKPDA------- 864

Query: 491  FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTP 550
            F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTP
Sbjct: 865  FHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTP 924

Query: 551  LQNNIKELAALINFLMP------GRFTIDQEIDF----------------EN--QDEEQE 586
            LQNN+ EL +L+ FLMP      G+ +   ++D                 EN  QDEE +
Sbjct: 925  LQNNLAELWSLLYFLMPQTALENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETK 984

Query: 587  EYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG 646
            + +  LH+ L+P++LRRLK DVEK +P K E I+   LS  Q   Y + +++  +  T  
Sbjct: 985  KTVSKLHQVLRPYLLRRLKADVEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLA 1044

Query: 647  SKGGHFSLLNIMSELKKASNHPYLFD 672
            S G   S++N + +L+K  NHP LF+
Sbjct: 1045 S-GNFMSIINCLMQLRKVCNHPDLFE 1069

 Score =  142 bits (358), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 82/192 (42%), Positives = 110/192 (57%), Gaps = 10/192 (5%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLL 775
            +GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN+ D    VF+L
Sbjct: 1325 NGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQILTERFNS-DPRITVFIL 1383

Query: 776  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 835
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS  T+E  +
Sbjct: 1384 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSDHTIESNI 1443

Query: 836  LERARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDL 895
            L++A +K  L+  +I  G      +TK        LS     GA       D++  L+D 
Sbjct: 1444 LKKANQKRHLDNVVIQTGDFTTDYFTK--------LSVKDLLGAEAPEDIPDDKPLLQDQ 1495

Query: 896  -NLDDVLNHAED 906
             NL+ +L  AED
Sbjct: 1496 KNLNKLLAQAED 1507

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  223 bits (567), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 193/327 (59%), Gaps = 37/327 (11%)

Query: 371  VEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 430
            V  PS ++ G LR +Q  G+NW+A L++ + NGILADEMGLGKT+QT++ +++L   +  
Sbjct: 686  VPVPSLLR-GNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKEN 744

Query: 431  NGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIK 490
             GPH++VVP S +  W+  F ++AP   V+ Y G+ + R   R  + +  P A       
Sbjct: 745  WGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKR--KGWNKPDA------- 795

Query: 491  FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTP 550
            F+V + +Y+ +++D+      +WQ++ +DEAH +KN  S+ +++L +F    RLL+TGTP
Sbjct: 796  FHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTP 855

Query: 551  LQNNIKELAALINFLMP----------------------GRFTIDQEIDFEN---QDEEQ 585
            LQNN+ EL +L+ FLMP                      GR  +D+ I+      QD+E 
Sbjct: 856  LQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKIIETGQNFGQDKET 914

Query: 586  EEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTA 645
            ++ +  LH+ L+P++LRRLK DVEK +P+K E I+  +LS  Q   Y + +++  +  T 
Sbjct: 915  KKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATL 974

Query: 646  GSKGGHFSLLNIMSELKKASNHPYLFD 672
             S G   S++N + +L+K  NHP LF+
Sbjct: 975  AS-GNFMSIVNCLMQLRKVCNHPNLFE 1000

 Score =  140 bits (353), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 90/138 (65%), Gaps = 1/138 (0%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLL 775
            +GHR LIF+QM ++LD+L  +L+  G  + RLDG      R+I  + FN  DS   VF+L
Sbjct: 1261 NGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNT-DSRITVFIL 1319

Query: 776  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 835
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YR VS+ T+E  +
Sbjct: 1320 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNI 1379

Query: 836  LERARKKMILEYAIISLG 853
            L++A +K  L+  +I  G
Sbjct: 1380 LKKANQKRQLDNVVIQEG 1397

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score =  219 bits (557), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 147/478 (30%), Positives = 236/478 (49%), Gaps = 34/478 (7%)

Query: 404 ILADEMGLGKTVQTVAFISWLIY-----ARRQNGPHIVVVPLSTMPAWQETFDKW-AP-D 456
           I+ADEMGLGKT+Q +A + W +       RR     I+V P S +  W    DKW  P  
Sbjct: 329 IMADEMGLGKTLQCLALM-WTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGS 387

Query: 457 LNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFL 516
           L+ +   G + S +     +  ++  +   +NI   VL+ +Y+ + ++  +L + +   +
Sbjct: 388 LSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLM 447

Query: 517 AVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG-------- 568
             DE HRLKNA+S  + +L+S +   R++++GTP+QN++ E  AL+NF  PG        
Sbjct: 448 LADEGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDF 507

Query: 569 ----RFTIDQEIDFENQDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILR 621
                  I Q  D    DEE    ++ +R L   +  FI+RR    + K LP K E ++ 
Sbjct: 508 RKNFELPILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIF 567

Query: 622 VELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFD------NAE 675
           + L+  Q   Y++ +     A+    KG     L  +  LKK  NHP L +       +E
Sbjct: 568 INLTPFQQSLYQHFIESR--AVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGSE 625

Query: 676 ERVLKKFGDGQMSRENVLRGLI---MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDI 732
           E +   +     SR +  R +I    SS                  ++++ S   + LD+
Sbjct: 626 ELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDL 685

Query: 733 LGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTV 792
           +            RLDGT+   +R+  +D FN P+  + +FLLS++AGG GINL+ A+ +
Sbjct: 686 IEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRL 745

Query: 793 IIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 850
           I+ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 746 ILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 803

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  219 bits (557), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 201/334 (60%), Gaps = 31/334 (9%)

Query: 368 EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
           E  +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L  A
Sbjct: 642 EITIEQPKILA-CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--A 698

Query: 428 RRQN--GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKG 485
            R N  GP IVV P ST+  W     K+ PD  ++ Y GN   R  +R F  +   + + 
Sbjct: 699 ERYNIWGPFIVVTPASTLHNWVNEIQKFVPDFKILPYWGNGNDRKILRRF--WDRKHLRY 756

Query: 486 KKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLL 545
            K+  F+V++T+Y+ I+ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL
Sbjct: 757 SKDAPFHVMITSYQMIVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLL 816

Query: 546 ITGTPLQNNIKELAALINFLMPGRFT--------IDQEIDFENQDEEQ--EEYIRDLHKR 595
           +TGTP+QN+++EL AL++F+MP  F           ++I+   Q   Q  ++ +R LH  
Sbjct: 817 LTGTPIQNSMQELWALLHFIMPSLFDSHDEFNDWFSKDIESHAQSNTQLNQQQLRRLHMI 876

Query: 596 LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL------TAG 646
           L+PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++ +Y A+      ++G
Sbjct: 877 LKPFMLRRIKKNVQSELGDKIEIDVMCDLTHRQAKLYQVLKSQVSASYDAIENAASNSSG 936

Query: 647 SKGGHFSL-----LNIMSELKKASNHPYLFDNAE 675
              G+ SL     +N + E +K  NHP LF+ A+
Sbjct: 937 DDSGNMSLSDSKIMNTVMEFRKVCNHPDLFERAD 970

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (67%), Gaps = 1/133 (0%)

Query: 718  HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            HRVLI+ QM RM+D++ +YL+ +     RLDG+     RR  + H     S   +FLLST
Sbjct: 1257 HRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRR-DLVHDWQTKSDIFIFLLST 1315

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
            RAGGLGINL +ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ K T+EE + +
Sbjct: 1316 RAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLLIKGTIEERMRD 1375

Query: 838  RARKKMILEYAII 850
            RA++K  ++  ++
Sbjct: 1376 RAKQKEHVQQVVM 1388

>Scas_669.20
          Length = 1397

 Score =  218 bits (555), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 194/331 (58%), Gaps = 21/331 (6%)

Query: 371 VEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 430
           +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L      
Sbjct: 635 IEQPKMLA-CTLKEYQLKGLNWLASLYDQGINGILADEMGLGKTVQSISVLAHLAEKHNI 693

Query: 431 NGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIK 490
            GP++VV P ST+  W     K+ P   ++ Y GN   R  +R+F  +     +  K+  
Sbjct: 694 WGPYLVVTPASTLHNWVNEITKFVPQFKILPYWGNAADRKVLRKF--WDRKNLRYTKDSP 751

Query: 491 FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTP 550
           F+V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP
Sbjct: 752 FHVMITSYQMVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTP 811

Query: 551 LQNNIKELAALINFLMPGRFTIDQEI------DFENQDEE----QEEYIRDLHKRLQPFI 600
           +QNN++EL AL++F+MP  F    E       D E+  E       + +R LH  L+PF+
Sbjct: 812 IQNNMQELWALLHFIMPSLFDSHDEFSEWFAKDIESHAEANTQLNHQQLRRLHMILKPFM 871

Query: 601 LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI-LTKNYSALTAGSKGGHFS----LL 655
           LRR+KK+V+  L  K E  +  +L+  Q + Y+ +  T NY A+   +    FS    L+
Sbjct: 872 LRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSDEFSSDQNLV 931

Query: 656 NIMSELKKASNHPYLFDNAEER---VLKKFG 683
           N + + +K  NHP LF+ A+        KFG
Sbjct: 932 NTVMQFRKVCNHPDLFERADINSPFAFTKFG 962

 Score =  132 bits (333), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 92/136 (67%), Gaps = 3/136 (2%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRR-ISIDHFNAPDSTDDVFL 774
            +GHRVLI+ QM +M+D++ +YL+ +     RLDG+     RR +  D    P+    VFL
Sbjct: 1235 EGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLVHDWQTKPEIF--VFL 1292

Query: 775  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 834
            LSTRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE 
Sbjct: 1293 LSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEER 1352

Query: 835  VLERARKKMILEYAII 850
            + +RA++K  ++  ++
Sbjct: 1353 MRDRAKQKEQVQQVVM 1368

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  216 bits (550), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 120/327 (36%), Positives = 197/327 (60%), Gaps = 24/327 (7%)

Query: 368  EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
            E  ++QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L  A
Sbjct: 733  EITIDQPKMLACT-LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--A 789

Query: 428  RRQN--GPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKG 485
             R N  GP IVV P ST+  W     ++ P   ++ Y GN   R  +R+F  +   + + 
Sbjct: 790  DRYNIWGPFIVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLRKF--WDRKHLRY 847

Query: 486  KKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLL 545
             ++  F+V++T+Y+ ++ D S L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL
Sbjct: 848  GRDAPFHVMVTSYQMVVSDASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLL 907

Query: 546  ITGTPLQNNIKELAALINFLMPGR----------FTIDQEIDFENQDEEQEEYIRDLHKR 595
            +TGTP+QNN++EL AL++F+MP            F+ D E   E+  E  +E +R LH  
Sbjct: 908  LTGTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAESNTELNQEQLRRLHMV 967

Query: 596  LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTAGSKGGHF 652
            L+PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+   +     
Sbjct: 968  LKPFMLRRIKKNVQSELGDKIEIDVLCDLTFRQAKLYQVLKSQVSGGYDAIENAAGNDDV 1027

Query: 653  S----LLNIMSELKKASNHPYLFDNAE 675
            +    L+N++ E +K  NHP LF+ A+
Sbjct: 1028 TSDQKLVNLVMEFRKVCNHPDLFERAD 1054

 Score =  132 bits (333), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 91/134 (67%), Gaps = 3/134 (2%)

Query: 718  HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISI-DHFNAPDSTDDVFLLS 776
            HRVLI+ QM +M+D++ +YL+ +  T  RLDG+     RR  + D    PD    +FLLS
Sbjct: 1336 HRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRDLVHDWQTKPDIF--IFLLS 1393

Query: 777  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 836
            TRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE + 
Sbjct: 1394 TRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMR 1453

Query: 837  ERARKKMILEYAII 850
            +RA++K  ++  ++
Sbjct: 1454 DRAKQKEHVQQVVM 1467

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  215 bits (548), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 193/330 (58%), Gaps = 25/330 (7%)

Query: 368  EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
            E  +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L   
Sbjct: 709  EITIEQPKMLACT-LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEH 767

Query: 428  RRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKK 487
                GP +VV P ST+  W     K+ P   ++ Y G+   R  +R+F  +     +  +
Sbjct: 768  HNIWGPFLVVTPASTLHNWVNEISKFVPQFKILPYWGSANDRKVLRKF--WDRKNLRYSE 825

Query: 488  NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLIT 547
               F+V++T+Y+ ++ D S L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+T
Sbjct: 826  KSPFHVMITSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLT 885

Query: 548  GTPLQNNIKELAALINFLMPGRFTIDQEI------DFENQDEE----QEEYIRDLHKRLQ 597
            GTP+QNN++EL AL++F+MP  F    E       D E+  E      ++ +R LH  L+
Sbjct: 886  GTPIQNNMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEGNSSLNQQQLRRLHMILK 945

Query: 598  PFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL---------TA 645
            PF+LRR+KK+V+  L  K E  +  +L+  QT+ Y   K+ ++ NY A+          A
Sbjct: 946  PFMLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLYQVLKSQMSSNYDAIENAAAEGSDIA 1005

Query: 646  GSKGGHFSLLNIMSELKKASNHPYLFDNAE 675
            G      S++N + + +K  NHP LF+ A+
Sbjct: 1006 GGGNSDQSIINAVMQFRKVCNHPDLFERAD 1035

 Score =  132 bits (332), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 96/155 (61%), Gaps = 1/155 (0%)

Query: 718  HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            HRVLI+ QM +M+D++ +YL+ +     RLDG+     RR  + H    +    +FLLST
Sbjct: 1312 HRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRR-DLVHDWQTNPEIFIFLLST 1370

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
            RAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE + +
Sbjct: 1371 RAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLLVRGTIEERMRD 1430

Query: 838  RARKKMILEYAIISLGVTDGSKYTKKNEPNPGELS 872
            RA++K  ++  ++     D +  T    P   +L+
Sbjct: 1431 RAKQKEQVQQVVMEGKTKDTNIQTTHTRPEHEQLT 1465

>Scas_668.18
          Length = 875

 Score =  211 bits (538), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 147/485 (30%), Positives = 235/485 (48%), Gaps = 49/485 (10%)

Query: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGPH-----IVVVPLSTMPAWQETFDKW-APD- 456
           I+ADEMGLGKT+Q +A + W +  +   G       I+V P S +  W     KW  P  
Sbjct: 309 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367

Query: 457 LNVICY--------MGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSEL 508
           L+ +           GN    +A+  +   T       +NI   VL+ +YE + ++  +L
Sbjct: 368 LSPLAVDGKKSSLASGNSTVAEAVHSWAQATG------RNIVKPVLIISYETLRRNVDQL 421

Query: 509 GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG 568
            +     +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG
Sbjct: 422 RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481

Query: 569 RFTIDQEI------------DFENQDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLP 613
                 E             D ++ DEE    EE ++ L   +  FI+RR    + K LP
Sbjct: 482 LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLP 541

Query: 614 SKTERILRVELSDVQTEYYKNIL-TKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFD 672
            K E ++ V L   Q + Y  +L +++ + +  G  G     L  +  LKK  NHP L +
Sbjct: 542 CKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQ--PLKAIGVLKKLCNHPNLIN 599

Query: 673 NAEERVLKKFGDGQMSRENVLRGL-------IMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
             EE  +  F D ++  E  ++G          S                   ++++ S 
Sbjct: 600 LDEE--IDDFDDLEIPDEYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISN 657

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
             + LD++      K  +  RLDGT+   +R+  +D FN P+  + +FLLS++AGG GIN
Sbjct: 658 YTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGIN 717

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L+ A+ +I+ D DWNP AD QA+AR  R GQK    +YR +S  ++EE++ +R   KM L
Sbjct: 718 LIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSL 777

Query: 846 EYAII 850
              ++
Sbjct: 778 SSCVV 782

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  215 bits (547), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 195/332 (58%), Gaps = 27/332 (8%)

Query: 368  EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
            E  +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L   
Sbjct: 693  EITIEQPKILA-CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEN 751

Query: 428  RRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKK 487
                GP +VV P ST+  W     K+ P   ++ Y GN   R  +R+F  +     +  K
Sbjct: 752  HNIWGPFLVVTPASTLHNWVNEISKFLPQFKILPYWGNANDRKVLRKF--WDRKNLRYNK 809

Query: 488  NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLIT 547
            N  F+V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+T
Sbjct: 810  NAPFHVMVTSYQMVVTDANYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLT 869

Query: 548  GTPLQNNIKELAALINFLMPGRFTIDQEI------DFENQDEE----QEEYIRDLHKRLQ 597
            GTP+QN+++EL AL++F+MP  F    E       D E+  E      ++ +R LH  L+
Sbjct: 870  GTPIQNSMQELWALLHFIMPSLFDSHDEFNEWFSKDIESHAEANTKLNQQQLRRLHMILK 929

Query: 598  PFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL----------- 643
            PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++ NY A+           
Sbjct: 930  PFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTSN 989

Query: 644  TAGSKGGHFSLLNIMSELKKASNHPYLFDNAE 675
            +A + G   +L+N + + +K  NHP LF+ A+
Sbjct: 990  SASNSGSDQNLINAVMQFRKVCNHPDLFERAD 1021

 Score =  134 bits (336), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/135 (48%), Positives = 91/135 (67%), Gaps = 1/135 (0%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLL 775
            +GHRVLI+ QM +M+D++ +YL+ +     RLDG+     RR  + H    +    VFLL
Sbjct: 1314 EGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRR-DLVHDWQTNPEIFVFLL 1372

Query: 776  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 835
            STRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE +
Sbjct: 1373 STRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVRGTIEERM 1432

Query: 836  LERARKKMILEYAII 850
             +RA++K  ++  ++
Sbjct: 1433 RDRAKQKEQVQQVVM 1447

>Kwal_14.1537
          Length = 842

 Score =  208 bits (530), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 146/481 (30%), Positives = 225/481 (46%), Gaps = 40/481 (8%)

Query: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HIVVVPLSTMPAWQETFDKWA----- 454
           I+ADEMGLGKT+Q +A +  L+    Q  P     I+V P S +  W     KW      
Sbjct: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419

Query: 455 ---PDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSI 511
              P       + N     A+R +       A+G+  +K  VL+ +YE + ++   L + 
Sbjct: 420 ASLPIDGKKSSLNNGTVAQAVRGWAL-----ARGRSVVK-PVLIISYETLRRNVEHLNNC 473

Query: 512 KWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFT 571
           +   L  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 474 EIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 533

Query: 572 IDQEI--DFEN----------QDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKT 616
              E   +FEN           D E     E ++ L   +  FI+RR    + K LP K 
Sbjct: 534 TRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKY 593

Query: 617 ERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLF----- 671
           E +L V L   Q   Y+ +L      L           L  +  LKK  NHP L      
Sbjct: 594 EHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPED 653

Query: 672 -DNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGH-RVLIFSQMVRM 729
            + +E+ + + + +  +S+          SG              +   +++I S   + 
Sbjct: 654 VEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQT 713

Query: 730 LDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTA 789
           LD++            RLDGT+   +R+  +D FN  +  + +FLLS++AGG GINL+ A
Sbjct: 714 LDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGA 773

Query: 790 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 849
           + +I+ D DWNP AD QA+AR  R GQK    +YR +   T+EE++ +R   KM L   +
Sbjct: 774 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLSSCV 833

Query: 850 I 850
           +
Sbjct: 834 V 834

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score =  208 bits (529), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 149/486 (30%), Positives = 237/486 (48%), Gaps = 48/486 (9%)

Query: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HIVVVPLSTMPAWQETFDKW-APD-L 457
           I+ADEMGLGKT+Q +A +  L+    Q  P     I+V P S +  W     KW  PD L
Sbjct: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386

Query: 458 NVICYMGNQRS------RDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSI 511
           + +   G + S        ++R++       A+G+  +K  VL+ +YE + ++   L   
Sbjct: 387 SPLAIDGRKSSLSNGSVAQSVRQWAI-----AQGRNVVK-PVLIISYETLRRNVENLKGC 440

Query: 512 KWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG--- 568
           K   +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 441 KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500

Query: 569 ---RFTIDQEI------DFENQDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKT 616
              +F  + EI      D +  D+E    E  + +L + +  FI+RR    + K LP K 
Sbjct: 501 TRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKY 560

Query: 617 ERILRVELSDVQTEYYKNIL-TKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAE 675
           E IL V LS +Q   Y++ + ++  + L  G+       + +   LKK  NHP L D  +
Sbjct: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---LKKLCNHPDLLDLPD 617

Query: 676 ERVLKK-----------FGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFS 724
           E                  + +  R +V      SS                  ++++ S
Sbjct: 618 EIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLIS 677

Query: 725 QMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGI 784
              + LD++            RLDGT+   +R+  +D FN P   + +FLLS++AGG GI
Sbjct: 678 NYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGI 737

Query: 785 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 844
           NL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YR ++  ++EE++ +R   KM 
Sbjct: 738 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMS 797

Query: 845 LEYAII 850
           L   ++
Sbjct: 798 LSSCVV 803

>Kwal_27.11388
          Length = 1334

 Score =  210 bits (535), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 203/344 (59%), Gaps = 24/344 (6%)

Query: 368 EKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 427
           E  ++QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L   
Sbjct: 581 EITIDQPKLLT-CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEN 639

Query: 428 RRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKK 487
               GP IVV P ST+  W     K+ PD  ++ Y GN   R  +R F  +     +  K
Sbjct: 640 YNIWGPFIVVTPASTLHNWVNEISKFLPDFKILPYWGNGNDRKILRRF--WDRKQFRYGK 697

Query: 488 NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLIT 547
           +  F+V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+T
Sbjct: 698 DAPFHVMVTSYQMVVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLT 757

Query: 548 GTPLQNNIKELAALINFLMPGRF-TIDQEIDFENQDEEQ---------EEYIRDLHKRLQ 597
           GTP+QNN++EL AL++F+MP  F + D+  D+ ++D E          ++ +R LH  L+
Sbjct: 758 GTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAQSNTKLNQQQLRRLHMILK 817

Query: 598 PFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL--TAGS--KGG 650
           PF+LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+   AGS     
Sbjct: 818 PFMLRRIKKNVQSELGEKIEIDVMCDLTRRQHKLYQVLKSQMSAAYDAIENAAGSDEASS 877

Query: 651 HFSLLNIMSELKKASNHPYLFDNAEERVLKKFGD----GQMSRE 690
             +++N + + +K  NHP LF+  + R    F D    G + RE
Sbjct: 878 DQNIVNTVMQFRKVCNHPDLFEREDVRSPFAFTDFGRSGSILRE 921

 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 90/134 (67%), Gaps = 3/134 (2%)

Query: 718  HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRR-ISIDHFNAPDSTDDVFLLS 776
            HRVLI+ QM +M+D++ +YLS +     RLDG+     RR +  D    P+    +FLLS
Sbjct: 1187 HRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRDLVHDWQTKPEIF--IFLLS 1244

Query: 777  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 836
            TRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYRL+ + T+EE + 
Sbjct: 1245 TRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMR 1304

Query: 837  ERARKKMILEYAII 850
            +RA++K  ++  ++
Sbjct: 1305 DRAKQKEQVQQVVM 1318

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score =  204 bits (520), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 146/477 (30%), Positives = 230/477 (48%), Gaps = 33/477 (6%)

Query: 404 ILADEMGLGKTVQTVAFISWLI----YARRQNGPHIVVVPLSTMPAWQETFDKW-APD-L 457
           I+ADEMGLGKT+Q +A +  L+      +R     I+V P S +  W     KW  P+ L
Sbjct: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435

Query: 458 NVICYMGNQRS--RDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQF 515
           + +   G + S    A    E   N      +NI   VL+ +Y+ + ++  +L + +   
Sbjct: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495

Query: 516 LAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQE 575
           L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG      E
Sbjct: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555

Query: 576 I--DFE-------------NQDEEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERIL 620
              +FE             N  +  E+ ++ L   +  FI+RR    + K LP K E ++
Sbjct: 556 FRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVI 615

Query: 621 RVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLK 680
            V L+  Q + Y N+L K+          G    L  +  LKK  NHP L    EE  L 
Sbjct: 616 FVNLTPFQKQVY-NMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKLDEE--LD 672

Query: 681 KFGDGQMSRE-NVLRG------LIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDIL 733
            + D  +  + ++  G         S                   ++++ S   + LD++
Sbjct: 673 NYNDLDIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLI 732

Query: 734 GDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVI 793
                 +     RLDGT+   +R+  +D FN P+  + +FLLS++AGG GINL+ A+ +I
Sbjct: 733 ERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLI 792

Query: 794 IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 850
           + D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 793 LMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849

>Scas_520.5
          Length = 863

 Score =  202 bits (514), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 168/284 (59%), Gaps = 32/284 (11%)

Query: 372 EQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 431
           EQPS +K   L+ +QL G+NW+  L+    NGILAD+MGLGKT+Q++A +++ IY     
Sbjct: 261 EQPSMLKNCVLKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAF-IYEMDTK 319

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVICYM--GNQRSRDAIREFEFYTNPYAKGKKNI 489
           GP ++  PLST+  W   F+K+APDL V+ Y   G +  R+ +    F+      G    
Sbjct: 320 GPFLIAAPLSTVDNWMNEFEKFAPDLPVLKYYHPGGKNERNKLMR-NFFKKTNGTG---- 374

Query: 490 KFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGT 549
              +++T+YE I++D   + S +W+FL VDE HRLKN    L + L     +NRLL+TGT
Sbjct: 375 ---IVVTSYEIIIRDADYIMSKQWKFLIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGT 431

Query: 550 PLQNNIKELAALINFLMPGRFTIDQEI-----DFEN--------------QDEEQEEYIR 590
           PLQNN+ EL +L+NF+MP  FT D EI     DF++               +E Q+  I 
Sbjct: 432 PLQNNLAELWSLLNFIMPDIFT-DFEIFNKWFDFKDLEMESNSSKLNKVINEELQKNLIS 490

Query: 591 DLHKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYK 633
           +LH  L+PF+LRRLKK V  + LP K E ++   L+ +Q ++YK
Sbjct: 491 NLHTILKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQKKFYK 534

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (59%)

Query: 693 LRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVP 752
           L+ L+ SSG               GH++LIFSQ V MLD+L D+  +  +   R+DGT+ 
Sbjct: 643 LQELLESSGKLKTLQRLVIPLIAKGHKILIFSQFVNMLDLLEDWCDLNSLAAFRIDGTID 702

Query: 753 SAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 812
           +  R+  +  FN   +   VFLLSTRA GLG+NL+ ADTV++FDSDWNPQ DLQAM R H
Sbjct: 703 NESRKEQLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDLQAMDRCH 762

Query: 813 RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
           RIGQ   V+VYR    +T+E  +L RA  K  LE  +I +G  +  K    NE
Sbjct: 763 RIGQTKPVIVYRFCCDNTLEHVILTRAANKRKLERLVIQMGKFNTLKKLALNE 815

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score =  202 bits (513), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 146/480 (30%), Positives = 232/480 (48%), Gaps = 39/480 (8%)

Query: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGPH-----IVVVPLSTMPAWQETFDKW-APD- 456
           I+ADEMGLGKT+Q +A + W +  +   G       I+V P S +  W     KW  P+ 
Sbjct: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390

Query: 457 LNVICYMGNQRSR---DAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKW 513
           L  +   G + S    +       +    A+G+ NI   VL+ +YE + ++  +L +   
Sbjct: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGR-NIVKPVLIISYETLRRNVDQLKNCNV 449

Query: 514 QFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTID 573
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509

Query: 574 QEI--DFEN----------QDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTER 618
            E   +FEN           D+E    E  ++ L   +  FI+RR    + K LP K E 
Sbjct: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569

Query: 619 ILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERV 678
           ++ V L  +Q E Y N L K+          G    L  +  LKK  NHP L +  +E  
Sbjct: 570 VIFVNLKPLQNELY-NKLIKSREVKKVVKGVGGSQPLRAIGILKKLCNHPNLLNFEDEFD 628

Query: 679 LKKFGD--------GQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRML 730
            +   +        G  +R+   +    S+                  ++++ S   + L
Sbjct: 629 DEDDLELPDDYNMPGSKARDVQTK---YSAKFSILERFLHKIKTESDDKIVLISNYTQTL 685

Query: 731 DILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTAD 790
           D++      K  +  RLDGT+   +R+  +D FN P+  + +FLLS++AGG GINL+ A+
Sbjct: 686 DLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGAN 745

Query: 791 TVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 850
            +I+ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 746 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  201 bits (510), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 164/286 (57%), Gaps = 32/286 (11%)

Query: 371 VEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 430
           ++QP  +K   L+ +QL G+NW+  L+    NGILADEMGLGKTVQ++A +++ IY    
Sbjct: 211 IKQPRLLKNCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAF-IYEMDT 269

Query: 431 NGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFE-FYTNPYAKGKKNI 489
            GP +V  PLST+  W   F K+APDL V+ Y G    ++   + + F+      G    
Sbjct: 270 KGPFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSAKLKNFFKQHGGTG---- 325

Query: 490 KFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGT 549
              +++T+YE IL+D   + S  W+FL VDE HRLKN    L + L     +NRLL+TGT
Sbjct: 326 ---IVITSYEIILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGT 382

Query: 550 PLQNNIKELAALINFLMPGRFTIDQEI-----DFEN----------------QDEEQEEY 588
           PLQNN+ EL +L+NF+MP  F  D EI     DF++                 DE Q+  
Sbjct: 383 PLQNNLAELWSLLNFIMPDIFA-DFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNL 441

Query: 589 IRDLHKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYK 633
           I +LH  L+PF+LRRLKK V  + LP K E I+   ++  Q ++YK
Sbjct: 442 ISNLHTILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYK 487

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 107/173 (61%)

Query: 693 LRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVP 752
           L  L+ +SG              +GH+VLI+SQ V MLD++ D+  +      R+DG+V 
Sbjct: 595 LETLLKTSGKLQILQKLIPPLISEGHKVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVN 654

Query: 753 SAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 812
           +  R+  ++ FN+     ++FLLSTRA GLGINL+ ADTV++FDSDWNPQ DLQAM R H
Sbjct: 655 NETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCH 714

Query: 813 RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
           RIGQ++ V+VYRL   +T+E  +L RA  K  LE  +I +G  +  K    NE
Sbjct: 715 RIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVIQMGKFNNLKKLALNE 767

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  199 bits (506), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 136/476 (28%), Positives = 227/476 (47%), Gaps = 57/476 (11%)

Query: 404 ILADEMGLGKTVQTVAFISWLI--YARRQNGPH--------------IVVVPLSTMPAWQ 447
           +LADEMGLGKT  T+A I  L+  + R  + P               +VV P++ +  W+
Sbjct: 295 LLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNWK 354

Query: 448 ETFDKWAPDLNVICYMG------NQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYI 501
           + F KW P +N I  +        ++ ++ +R F      Y          VL+  YE +
Sbjct: 355 KEFIKWLP-MNRIGILTLSSKNTPEKDKNDVRNFLRVQRTY---------QVLILGYEKL 404

Query: 502 LKDRSEL--GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELA 559
           L   SEL     K   L  DE HRLKN+ S + + L   ++  ++++TGTP+QN++ E  
Sbjct: 405 LNVFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFY 464

Query: 560 ALINFLMPGRFT------------IDQEIDFENQDEEQ-----EEYIRDLHKRLQPFILR 602
            +INF+ PG               I +  D  N+  +Q     E   +DL +  + FILR
Sbjct: 465 TIINFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILR 524

Query: 603 RLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELK 662
           R    +   LP +T+ ++  + +  Q + +  +L          S     S L +++  K
Sbjct: 525 RTSSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQNMS---FNSSLGLITLFK 581

Query: 663 KASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 722
           K  N P L   + +   +   +G      + +                     D  +V++
Sbjct: 582 KICNSPSLV--SSDSYFQSKVNGGTPALRIAQSTTSGKLKVLMSLLHQIAHRSDNEKVVV 639

Query: 723 FSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGL 782
            S   + LDI+G+ +S   +++ RLDG+ P+ +R   ++ FN   +    FLLS ++GG+
Sbjct: 640 ISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQTIFG-FLLSAKSGGV 698

Query: 783 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 838
           G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YRLV+   ++E++ +R
Sbjct: 699 GLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQR 754

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  197 bits (502), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 150/481 (31%), Positives = 235/481 (48%), Gaps = 68/481 (14%)

Query: 404 ILADEMGLGKTVQTVAFISWLI----YARRQNGPH------------IVVVPLSTMPAWQ 447
           +LAD+MGLGKT+ ++  I  LI    +A + +               +VV P++ +  W+
Sbjct: 309 LLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWK 368

Query: 448 ETFDKWAPDLNV----ICYMGNQRSRD----AIREFEFYTNPYAKGKKNIKFNVLLTTYE 499
             F KW   LN+    +  + ++ S D    A+R F          K    + VL+  YE
Sbjct: 369 REFGKW---LNLSRIGVLTLSSRNSPDMDKMAVRNFL---------KVQRTYQVLIIGYE 416

Query: 500 YILKDRSELGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKE 557
            +L    EL   K     L  DE HRLKN  S +  +L S  +  +LL+TGTP+QN++ E
Sbjct: 417 KLLSVSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNE 476

Query: 558 LAALINFLMPG----------RFTI--DQEIDFENQDEEQ-----EEYIRDLHKRLQPFI 600
              +I+F+ PG          RF I   +  D  N+  E+     EE  +++ +  + FI
Sbjct: 477 FFTIIDFINPGILGSFASFKRRFIIPITRARDTANRYNEELLEKGEERSKEMIEITKRFI 536

Query: 601 LRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGSKGGHFSLLNI 657
           LRR    +EK LP KT+ IL  +    Q   +K+IL     ++  LT  S  G  +LL  
Sbjct: 537 LRRTNAILEKYLPPKTDIILFCKPYSQQILAFKDILQGARLDFGQLTFSSSLGLITLL-- 594

Query: 658 MSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDG 717
               KK  N P L     +   K       S+++  R L  S                  
Sbjct: 595 ----KKVCNSPGLV--GSDPYYKSHIKDTQSQDSYSRSL-NSGKLKVLMTLLEGIRKGTK 647

Query: 718 HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            +V++ S   + LDI+ + +++ G++  RLDG++P+ QR   +  FN   +    FLLS 
Sbjct: 648 EKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNRNPAIFG-FLLSA 706

Query: 778 RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
           ++GG+G+NL+    +I+FD+DWNP  DLQAM+R HR GQK    +YRLV+   ++E++L+
Sbjct: 707 KSGGVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQ 766

Query: 838 R 838
           R
Sbjct: 767 R 767

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  197 bits (501), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 151/502 (30%), Positives = 252/502 (50%), Gaps = 72/502 (14%)

Query: 404 ILADEMGLGKTVQTVAFISWLIYAR-------RQNGPHI--------VVVPLSTMPAWQE 448
           +LADEMGLGKT+ T+  I W +  +        Q G  +        +V P++ +  W++
Sbjct: 317 LLADEMGLGKTLMTITLI-WTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWKK 375

Query: 449 TFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSEL 508
            F KW P +N I  +    SR++  E +     + K  +   + VL+  YE +L  + EL
Sbjct: 376 EFKKWLP-MNRIGVL-TLHSRNSPTEDKAQVRSFLKVPRT--YQVLIVGYEKLLSIKDEL 431

Query: 509 GSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLM 566
            + K     +  DE HRLKN +S + + L S  +  +++++GTP+QN+++E   +I+F+ 
Sbjct: 432 QNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLEEFYTIIDFIN 491

Query: 567 PG------RF------TIDQEIDF---ENQDEEQEEYIRD--LHKRLQPFILRRLKKDVE 609
           PG      RF       I +  D    +NQ   ++  +R   L +  + FILRR  + ++
Sbjct: 492 PGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRFILRRTNEILQ 551

Query: 610 KSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGSKGGHFSLLN-IMSELKKAS 665
           + LP +T+ I+  + +  Q E +  ILT+   N+S +T  S  G  +L   I +  +   
Sbjct: 552 QYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLNFSNMTFNSSLGLITLFKKICNSTRLIK 611

Query: 666 NHPYLFDNAEERVLK--------KFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDG 717
             PY     EER+ +        KF  G++    +L  L+                    
Sbjct: 612 TDPYY----EERLSQVQTSSTSGKFTSGKL---RILLSLL------------HELKTKTD 652

Query: 718 HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            +V++ S   + LDI+  + S +G T  RLDG+  +  R   +  FN  D +  VFLLS 
Sbjct: 653 EKVVVISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFNN-DPSIFVFLLSA 711

Query: 778 RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
           ++GG+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQ+    +YRLV+   ++E++L+
Sbjct: 712 KSGGVGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCIDEKILQ 771

Query: 838 RARKKMILEYAIISLGVTDGSK 859
           R   K+ L    +    TD SK
Sbjct: 772 RQLMKIALSKKFLD-SATDQSK 792

>Scas_718.40
          Length = 926

 Score =  196 bits (498), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 150/492 (30%), Positives = 237/492 (48%), Gaps = 50/492 (10%)

Query: 404 ILADEMGLGKTVQTVAFISWLI--------YARRQNGPHI--------VVVPLSTMPAWQ 447
           +LADEMGLGKT+ T+  I  L+         A  Q+G  +        VV P++ +  W+
Sbjct: 305 LLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWK 364

Query: 448 ETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSE 507
             F KW  +LN I  +    SR+     +     + + ++   F VL+  YE +L    E
Sbjct: 365 REFAKWL-NLNRIGIL-TLSSRNTPEMDKTAVKNFLRVQRT--FQVLVIGYEKLLSVSEE 420

Query: 508 LGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFL 565
           L   +     L  DE HRLKN  S +   L + ++  ++L++GTP+QN++ E   +I+FL
Sbjct: 421 LHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTIIDFL 480

Query: 566 MPG----------RFT--IDQEIDFENQDEEQ-----EEYIRDLHKRLQPFILRRLKKDV 608
            PG          RF   I +  D EN+  E      E   +++    + F LRR    +
Sbjct: 481 NPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLRRTNAIL 540

Query: 609 EKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGSKGGHFSLLNIMSELKKAS 665
            K LP KT+ IL  + +  Q   + +IL++   +++ L+  S  G  +L       KK  
Sbjct: 541 SKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFANLSFNSSLGLITLF------KKIC 594

Query: 666 NHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQ 725
           N P L  +      K   DG + +E   R L                   +  +V+I S 
Sbjct: 595 NSPTLIGDDSYYQSKIRPDGVI-QERYDRSLNSGKLKILMTLLEKIKGNTNNEKVVIVSN 653

Query: 726 MVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGIN 785
             + LDI+ + ++   +   RLDG+ P+ QR   ++ FN   S    FLLS ++GG+G+N
Sbjct: 654 YTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPSIF-AFLLSAKSGGVGLN 712

Query: 786 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845
           L+ A  +I+FD+DWNP  DLQAM+R HR GQK H  +YRL++   ++E++L+R   K  L
Sbjct: 713 LIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQLMKHSL 772

Query: 846 EYAIISLGVTDG 857
               +    T G
Sbjct: 773 SKKFLDSSYTTG 784

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  192 bits (489), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 166/289 (57%), Gaps = 34/289 (11%)

Query: 371 VEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 430
           ++QP+ V+   L+ +Q+ G+NW+  L+    NGILADEMGLGKT+Q++A +++ IY    
Sbjct: 176 IQQPTLVRNCTLKPYQVEGVNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDT 234

Query: 431 NGPHIVVVPLSTMPAWQETFDKWAPDLNVICYM---GNQRSRDAIREFEFYTNPYAKGKK 487
            GP +V  PLS +  W   F+K+AP + V+ Y    G  +    ++EF          +K
Sbjct: 235 RGPFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRHAILKEF---------FRK 285

Query: 488 NIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLIT 547
           N    V++T+YE +++D + + S +W+FL VDE HRLKN    L   L      NRLL+T
Sbjct: 286 NSGEGVVVTSYEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTFNRLLLT 345

Query: 548 GTPLQNNIKELAALINFLMPGRFTIDQEI-----DFENQD--------------EEQEEY 588
           GTPLQNN+ EL +L+NF++P  F  D EI     DF + D              E ++  
Sbjct: 346 GTPLQNNLAELWSLLNFILPDVFA-DFEIFSKWFDFSDLDLKTSSQRWDKIIGEELEKNL 404

Query: 589 IRDLHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL 636
           + +LH  L+PF+LRRLK+ V   +LP K E I+   L+ +QT +YK  L
Sbjct: 405 VTNLHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYKMAL 453

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 116/200 (58%), Gaps = 10/200 (5%)

Query: 654 LLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXX 713
           L N+M +L++  +  +LF          +     + +  L  L+ +SG            
Sbjct: 524 LQNLMMQLRQIVDSTFLF----------YFPYLKAEDLQLPVLLQTSGKLQILQQLLPRL 573

Query: 714 XXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVF 773
               H+VLIFSQ V MLD++ D+  +   +  R+DG++ +  RR  I+ F+   S   +F
Sbjct: 574 LAAKHKVLIFSQFVSMLDLIEDWCELNNYSACRIDGSMDNETRREQINSFSEKGSPHSLF 633

Query: 774 LLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEE 833
           LLSTRAGGLGINL  AD+VI+FD+DWNPQ DLQAM R+HRIGQ++ V+VYRL    TVE 
Sbjct: 634 LLSTRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRSHRIGQQHPVIVYRLYCDKTVES 693

Query: 834 EVLERARKKMILEYAIISLG 853
            +L RA  K  LE  +I +G
Sbjct: 694 VILARATNKRKLEQLVIQMG 713

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  191 bits (485), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 145/503 (28%), Positives = 234/503 (46%), Gaps = 76/503 (15%)

Query: 404 ILADEMGLGKTVQTVAFISWLI----YARRQNGPH------------IVVVPLSTMPAWQ 447
           ILAD+MGLGKT+ T+  I  L+    +A +                 ++V P++ +  W+
Sbjct: 311 ILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWK 370

Query: 448 ETFDKWAPDLNVICYMG----NQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILK 503
             F KW   LN I  +     N    D I    F        K N  + VL+  YE +L 
Sbjct: 371 REFKKWL-GLNRIGILTLNPKNNVDMDKISVRNFI-------KVNRTYQVLILGYEKVLT 422

Query: 504 DRSEL--GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAAL 561
            + EL     K   L  DE HRLKN  S + + L S  ++ ++++TGTP+QN++ E   +
Sbjct: 423 VQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFFTI 482

Query: 562 INFLMPGRF------------TIDQEIDFEN--------QDEEQEEYIRDLHKRLQPFIL 601
           I+F+ PG               I +  D  N        Q EE+   + +  KR   FIL
Sbjct: 483 IDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKR---FIL 539

Query: 602 RRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSEL 661
           RR    + K LP KT+ IL    +  Q + +++I+      +   +      L+N+M ++
Sbjct: 540 RRSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVDMNNITFNTSLGLINLMKKV 599

Query: 662 KKA----SNHPYLFDNAEERVL----KKFGDGQMSRENVLRGLIMSSGXXXXXXXXXXXX 713
             +     N PY   N +  +     K    G+++    L   I ++             
Sbjct: 600 CNSPSLLCNDPYYQSNVDSNIFTVSNKSNSSGKLTVLLELLLEIKATSPM---------- 649

Query: 714 XXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVF 773
                +V+I S   + LDI+   ++   ++  RLDG  P+ QR + ++ FN   +    F
Sbjct: 650 ----EKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNNNPNIFG-F 704

Query: 774 LLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEE 833
           LLS +AGG+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQK    +YRL++   ++E
Sbjct: 705 LLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDE 764

Query: 834 EVLERARKKMILEYAIISLGVTD 856
           ++L+R   K  L    +S   +D
Sbjct: 765 KILQRQLMKHNLTRKFLSSNTSD 787

>Kwal_27.10513
          Length = 900

 Score =  184 bits (468), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 139/488 (28%), Positives = 239/488 (48%), Gaps = 69/488 (14%)

Query: 404 ILADEMGLGKTVQTVAFISWLIYAR---------RQNGPHI--------VVVPLSTMPAW 446
           +LADEMGLGKT+ T+  + W +  +          QNG  +        VV P++ +  W
Sbjct: 295 LLADEMGLGKTLMTITLV-WTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVTLIGNW 353

Query: 447 QETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRS 506
           +  F KW  ++N I  +      +A ++ +     + + ++   + VL+  YE +L    
Sbjct: 354 KREFSKWL-NVNRIGILTLSSKSNAEKD-KLTVRNFLRVQRT--YQVLVIGYEKLLSVTE 409

Query: 507 EL--GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINF 564
           EL     K   +  DE HRLKN +S   ++++S +V  ++++TGTP+QN++ E   + +F
Sbjct: 410 ELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAEFFTIADF 469

Query: 565 L---MPGRFT---------IDQEIDFENQ-----DEEQEEYIRDLHKRLQPFILRRLKKD 607
           L   + G F+         I +  D  N+      E+  +  ++L +  + F LRR  + 
Sbjct: 470 LNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFTLRRTAET 529

Query: 608 VEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTAGSKGGHFSLLNIMSELKKA 664
           + K LPSKT+ +L  + +  Q + ++  L+    ++S LT  S  G  +L       KK 
Sbjct: 530 ISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRLTFNSSLGLITLF------KKI 583

Query: 665 SNHPYLF--DNAEERVLKKFGDGQMSREN-----VLRGLIMSSGXXXXXXXXXXXXXXDG 717
            N P L   D+     +K   + ++S  +     VL  L+                    
Sbjct: 584 CNSPSLISQDSYYLETIKPNSEVKISAPDSGKLRVLMALL-----------DNLRKLSPQ 632

Query: 718 HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            +V+I S   + LDI+ + +    ++F RLDG+  +  R   ++ FN   S    FLLS 
Sbjct: 633 EKVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPSIF-AFLLSA 691

Query: 778 RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
           ++GG+G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YRL++   ++E++ +
Sbjct: 692 KSGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEKIFQ 751

Query: 838 RARKKMIL 845
           R   K  L
Sbjct: 752 RQLAKTSL 759

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  152 bits (384), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 105/173 (60%), Gaps = 3/173 (1%)

Query: 696 LIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQ 755
           L+ +SG              +GH+VLIFSQ V MLD++ D+  +      R+DG++ +  
Sbjct: 29  LLQTSGKLQILQQLVPKLINEGHKVLIFSQFVNMLDLIEDWCELNDFQACRIDGSMDNEV 88

Query: 756 RRISIDHFNAPDS---TDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 812
           R+  I  FN+  +    +DVFLLSTRAGGLGINL  AD+V+IFDSDWNPQ DLQAM R H
Sbjct: 89  RQEQIGKFNSKTTDSHANDVFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAMDRTH 148

Query: 813 RIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGSKYTKKNE 865
           RIGQ   V+VYRL   +TVE  +L RA  K  LE  +I +G  +  K    NE
Sbjct: 149 RIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVIQMGKFNTLKRLALNE 201

>Scas_548.4
          Length = 1054

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/319 (33%), Positives = 164/319 (51%), Gaps = 38/319 (11%)

Query: 382 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLS 441
           L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F ++L     + GPH+VVVP S
Sbjct: 496 LKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISFFAYLKQIN-EPGPHLVVVPSS 554

Query: 442 TMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYI 501
           T+  W   F K+ P L +  Y G+Q  R  +RE    T          +++V++TTY   
Sbjct: 555 TLENWLREFQKFCPTLKIEPYYGSQNERADLREILERTAG--------QYDVIVTTYNLA 606

Query: 502 LKDRSELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKEL 558
             ++ ++  ++   +  +  DE H LKN+ S  +  L   + N RLL+TGTPLQNN++EL
Sbjct: 607 AGNKYDVSFLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLREL 666

Query: 559 AALINFLMPGRFTIDQEI-------DFENQDEEQ-------EEYIRDLHKRLQPFILRRL 604
            +L+ F+MP  F   +E          +  D+ +       +E I      ++PFILRR 
Sbjct: 667 MSLLEFIMPALFISKKESLASVFKQRAKTTDDNKGHNPLLVQEAIERAKTMMKPFILRRR 726

Query: 605 KKDVEKSLPSKTERILRVELSDVQTEYY----KNILTKNYSALTAG--------SKGGHF 652
           K  V K LP+K  +I    + D+Q + Y    K ++      L           +K    
Sbjct: 727 KDQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQSS 786

Query: 653 SLLNIMSELKKASNHPYLF 671
           S  N++  L+KA+ HP LF
Sbjct: 787 SSSNLIMTLRKAALHPLLF 805

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/131 (45%), Positives = 83/131 (63%), Gaps = 1/131 (0%)

Query: 719  RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTR 778
            +VLIFS   ++LDIL   LS     F RLDG+     R+  ID F   D T  +F+LST+
Sbjct: 892  KVLIFSLFTQVLDILELVLSELNYKFLRLDGSTQVNDRQSLIDKFYE-DDTIPIFILSTK 950

Query: 779  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 838
            AGG GINL+ A+ VIIFD  +NP  D QA  RAHR+GQ   V +  L++KD++EE++ + 
Sbjct: 951  AGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQL 1010

Query: 839  ARKKMILEYAI 849
            A+ K+ L+  I
Sbjct: 1011 AKNKLALDSHI 1021

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 104/205 (50%), Gaps = 41/205 (20%)

Query: 382 LRDFQLTGINWMAFLWSKND---NGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV 438
           L  FQL G++WMA L   N+    G+LADEMG+GKTVQ    IS L++A +  GP +VV 
Sbjct: 142 LLPFQLEGLHWMA-LQENNERYRGGVLADEMGMGKTVQ---MISLLLHANK--GPTLVVA 195

Query: 439 PLSTMPAWQETFDKW-APDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTT 497
           P   +  W+   DK+    L  + + G  RS              A  ++    +V+LTT
Sbjct: 196 PTVALIQWKNEIDKYTGGALRSLVFHGPGRS--------------AVSEELAAADVVLTT 241

Query: 498 YEY-----------------ILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKV 540
           Y                   +++++S L ++ +  + +DEAH +K+  S    S+N+ + 
Sbjct: 242 YAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYRVVLDEAHNIKDRSSGTARSVNALRA 301

Query: 541 NNRLLITGTPLQNNIKELAALINFL 565
             R  +TGTPLQN I E+ +LI FL
Sbjct: 302 VRRWCLTGTPLQNRIGEMYSLIRFL 326

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 77/138 (55%), Gaps = 3/138 (2%)

Query: 721 LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
           ++FSQ   MLD++   L   G    +L G++   QR  +I++F   +   +VFL+S +AG
Sbjct: 597 IVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRAETINYF-MDNVHCEVFLVSLKAG 655

Query: 781 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 656 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQHRPVKITRFCIEDSIESRIIELQE 715

Query: 841 KKMILEYAIISLGVTDGS 858
           KK  + +A  +LG  +G+
Sbjct: 716 KKANMIHA--TLGQDEGA 731

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 76/128 (59%), Gaps = 2/128 (1%)

Query: 719  RVLIFSQMVRMLDILGDYLSIK-GITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            +++IFSQ     +ILG ++    G+ F R DG++ S+QR   I+ F   D+   V L+S 
Sbjct: 1448 KLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESF-YQDNNYRVMLISM 1506

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
            +AG  G+ L  A+ VI+ D  WNP  + QAM R HRI Q+  V V+RL+ K +VE+ ++E
Sbjct: 1507 KAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVEDRIVE 1566

Query: 838  RARKKMIL 845
               KK  L
Sbjct: 1567 LQNKKKTL 1574

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 153/362 (42%), Gaps = 90/362 (24%)

Query: 386  QLTGINWMAFLW-SKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPH--------IV 436
            Q  G+ W+  +  S    G+LAD+MGLGKTVQ++A +         N P         +V
Sbjct: 923  QRQGLRWLVSMEKSSKRGGLLADDMGLGKTVQSLALL-------MANKPEPKSAIKTTLV 975

Query: 437  VVPLSTMPAWQ-ETFDKWAPDLN--VICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNV 493
            V P++ +  W+ E   K   D+N  V+ + G + +    R +          K   ++++
Sbjct: 976  VAPVAVLRVWKDEVAVKIKKDVNVKVVIFGGGENNSSKFRSW----------KDLAEYDI 1025

Query: 494  LLTTYEYILKDRSELGSIKW-----------------------------------QFLAV 518
            +L +Y+ +  +  +   + W                                   +F  V
Sbjct: 1026 VLVSYQTLASEFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRV 1085

Query: 519  --DEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFL-MP-----GRF 570
              DEA  +KN ++   ++  +     R  ++GTP+QNNI EL +LI FL +P      +F
Sbjct: 1086 ILDEAQNIKNKKTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKF 1145

Query: 571  ------TIDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLK------KDVEKSLPSKTER 618
                   ++ +  ++  D E++  ++ +   L+  +LRR K      K + + LP K  +
Sbjct: 1146 HSDIGAVLNTKKPYDYNDSERQRAMKKVQVLLRAIMLRRTKTSQIDGKPILQ-LPEKHLK 1204

Query: 619  ILRVELSDVQTEYYKNILTKNYSAL-----TAGSKGGHFSLLNIMSELKKASNHPYLFDN 673
                +L   + E+Y+ + +K+         +   +G + S+L ++  L++A  H  L   
Sbjct: 1205 ESANKLEGDELEFYQALESKSRDKAKKMLESKQKQGAYSSILTLLLRLRQACLHSELVKI 1264

Query: 674  AE 675
             E
Sbjct: 1265 GE 1266

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 106/209 (50%), Gaps = 37/209 (17%)

Query: 382 LRDFQLTGINWMAFLWSKNDNG-ILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPL 440
           L  FQL G++W+      + NG +LADEMG+GKT+QT+A    L+ +     P +VV P 
Sbjct: 194 LLPFQLEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIA----LLMSDITRKPSLVVAPT 249

Query: 441 STMPAWQETFDKWA-PDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYE 499
             +  W+   ++     L+V  Y G  R+ + + +F+               +V+LTTY 
Sbjct: 250 VALMQWKNEIEQHTNKKLSVYMYHGANRTNN-LGDFK-------------DVDVILTTYA 295

Query: 500 YI-----------------LKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNN 542
            +                 +K++S L SI +  + +DEAH +K+  S+  +++NS +   
Sbjct: 296 VLESVYRKQVYGFKRKAGTVKEKSLLHSINFYRVILDEAHNIKDRTSNTAKAVNSLQTKK 355

Query: 543 RLLITGTPLQNNIKELAALINFLMPGRFT 571
           R  ++GTPLQN I E+ +LI FL    FT
Sbjct: 356 RWCLSGTPLQNRIGEMYSLIRFLNIEPFT 384

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 721 LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
           ++FSQ   MLD++   L   G    +L G++   QR  +I +F   +   +VFL+S +AG
Sbjct: 651 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYF-MENIHCEVFLVSLKAG 709

Query: 781 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 710 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQE 769

Query: 841 KKMILEYAIIS 851
           KK  + +A I+
Sbjct: 770 KKASMIHATIN 780

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 113/232 (48%), Gaps = 44/232 (18%)

Query: 362 SARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDN----GILADEMGLGKTVQT 417
           +A P   +  +QP  +   +L  FQL G++W   L S+ ++    G+LADEMG+GKT+QT
Sbjct: 165 NAPPYVPQRSKQPDGMTI-KLLPFQLEGLHW---LISQEESIYAGGVLADEMGMGKTIQT 220

Query: 418 VAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAP-DLNVICYMGNQRSRDAIREFE 476
           +A    L+       P +VV P   +  W+   ++     L +  Y G  R+ D I++ +
Sbjct: 221 IA----LLMNDLTKSPSLVVAPTVALMQWKNEIEQHTKGQLKIYIYHGASRTTD-IKDLQ 275

Query: 477 FYTNPYAKGKKNIKFNVLLTTYEYI-----------------LKDRSELGSIKWQFLAVD 519
            Y             +V+LTTY  +                  K  S L +I +  + +D
Sbjct: 276 GY-------------DVVLTTYAVLESVFRKQNYGFRRKNGLFKQPSVLHNIDFYRVILD 322

Query: 520 EAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFT 571
           EAH +K+ +S+   ++N+ K   R  ++GTPLQN I E+ +LI FL    FT
Sbjct: 323 EAHNIKDRQSNTARAVNNLKTQKRWCLSGTPLQNRIGEMYSLIRFLNINPFT 374

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 721 LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
           ++FSQ   MLD++   L   G    +L G++   QR  +I +F   +   +VFL+S +AG
Sbjct: 641 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETIKYF-MNNIQCEVFLVSLKAG 699

Query: 781 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 700 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQE 759

Query: 841 KKMILEYAIIS 851
           KK  + +A I+
Sbjct: 760 KKANMIHATIN 770

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 110/224 (49%), Gaps = 45/224 (20%)

Query: 365 PKFE-KLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDN----GILADEMGLGKTVQTVA 419
           PK+E     QP+ +   +L  FQL G++WM    S+ D+    G+LADEMG+GKT+QT+A
Sbjct: 208 PKYEPHRAPQPADMGV-KLLPFQLEGLHWM---LSQEDSIYNGGVLADEMGMGKTIQTIA 263

Query: 420 FISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYT 479
               L+   R   P +VV P   +  W+   +              Q +  A+  + ++ 
Sbjct: 264 ----LLMNDRSKKPSLVVAPTVALMQWKNEIE--------------QHTNGALSTYIYHG 305

Query: 480 NPYAKGKKNIK-FNVLLTTYEYI-----------------LKDRSELGSIKWQFLAVDEA 521
                   ++K  +V+LTTY  +                 +K++S L +I +    +DEA
Sbjct: 306 ASRTINIHDLKDIDVILTTYSVLESVFRKQNYGFRRKNGLVKEKSLLHNIDFYRAILDEA 365

Query: 522 HRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFL 565
           H +K+  S+   ++N+ K   R  ++GTPLQN I E+ +LI FL
Sbjct: 366 HNIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRIGEMYSLIRFL 409

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 721 LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
           ++FSQ   MLD++   L   G    +L G++   QR  +I +F   +   +VFL+S +AG
Sbjct: 681 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDQTIKYF-MDNIECEVFLVSLKAG 739

Query: 781 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 740 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQE 799

Query: 841 KKMILEYAIIS 851
           KK  + +A I+
Sbjct: 800 KKANMIHATIN 810

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 142/338 (42%), Gaps = 58/338 (17%)

Query: 386  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMP 444
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A +     +      +++V P+S + 
Sbjct: 737  QRLGLQWLLNAETSKRKGGLLADDMGLGKTVQAIALMLANRSSNESKKTNLIVAPVSVLR 796

Query: 445  AWQ---ETFDKWAPDLNVICYMGNQ----RSRDAIREFEFYTNPYAKGKKNIK------- 490
             W+   ET  K + D N   Y G      RS D +  F+     Y      +K       
Sbjct: 797  VWKGEIETKIKESSDFNSAIYGGVNGIKFRSWDKLSNFDVILVSYQTLANELKKHWPERL 856

Query: 491  ---------------FNVLLTTYEY---ILKDRSELGSIKWQFLAVDEAHRLKNAESSLY 532
                            N L T  EY      D S    I      +DE   +KN ++   
Sbjct: 857  KTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRI-----ILDEGQNIKNMKTQAA 911

Query: 533  ESLNSFKVNNRLLITGTPLQNNIKELAALINFL-MPG-----RFTIDQEIDFEN-----Q 581
            ++  +     R +++GTP+QNN++EL +LI FL +P      RF  D    F N      
Sbjct: 912  KACCTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIGRPFSNLKQNYD 971

Query: 582  DEEQEEYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYKNIL 636
             E +++ I+ +   L+  +LRR K D         LP K          D + E+YK + 
Sbjct: 972  SESRKQAIKKVRVLLRAIMLRRSKTDKIDGVPILELPPKNVNAQETTFKDDELEFYKALE 1031

Query: 637  TKNYS----ALTAGSKGGHFSLLNIMSELKKASNHPYL 670
             KN       L +  +G + S+L ++  L++A  HP L
Sbjct: 1032 HKNKQLAKKLLESKVQGNYSSVLTLLLRLRQACCHPEL 1069

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIK-GITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFL 774
            D  +++IFSQ    LD+L   L+ +  I+  +  G + +  R   I  F + +    V L
Sbjct: 1249 DSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSEEDKR-VLL 1307

Query: 775  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 834
            +S +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V+RL  K++VE+ 
Sbjct: 1308 ISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVEDR 1367

Query: 835  VLE 837
            +LE
Sbjct: 1368 ILE 1370

>Scas_591.10
          Length = 772

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 101/195 (51%), Gaps = 19/195 (9%)

Query: 381 ELRDFQLTGINWMA------FLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPH 434
           +L  FQL G++W+       F       G+LADEMG+GKT+QT+A +   +  R    P 
Sbjct: 165 KLLPFQLEGLHWLIQQEEGIF-----KGGVLADEMGMGKTIQTIALLMNDLTKR----PS 215

Query: 435 IVVVPLSTMPAWQETFDKWAPD-LNVICYMGNQRSRD--AIREFEFYTNPYAKGKKNI-K 490
           +VV P   +  W+   ++     L V  + G  ++ D   + E++     YA  +    K
Sbjct: 216 LVVAPTVALMQWKNEINQHTDGKLKVYMFHGTSKNIDIKTLSEYDVVLTTYAVLESVFRK 275

Query: 491 FNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTP 550
            N        ++K+ S L +I++  + +DEAH +K+ +S+   ++N+ K   R  +TGTP
Sbjct: 276 QNYGFKRKHGVVKELSVLHNIEFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLTGTP 335

Query: 551 LQNNIKELAALINFL 565
           LQN I E+ +LI FL
Sbjct: 336 LQNRIGEMYSLIRFL 350

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 721 LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
           ++FSQ   MLD++   L   G    +L G++   QR  +I +F   +   +VFL+S +AG
Sbjct: 623 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETIKYF-MNNIECEVFLVSLKAG 681

Query: 781 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 682 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQE 741

Query: 841 KKMILEYAIIS 851
           KK  + +A I+
Sbjct: 742 KKANMIHATIN 752

>Kwal_23.3660
          Length = 768

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 1/131 (0%)

Query: 721 LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
           ++FSQ   MLD++   L   G    +L G++   QR  +I +F   ++  +VFL+S +AG
Sbjct: 619 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYF-MDNTHCEVFLVSLKAG 677

Query: 781 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + R   +D++E  ++E   
Sbjct: 678 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIESRIIELQE 737

Query: 841 KKMILEYAIIS 851
           KK  + +A I+
Sbjct: 738 KKANMIHATIN 748

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 101/204 (49%), Gaps = 37/204 (18%)

Query: 381 ELRDFQLTGINWM-AFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVP 439
           +L  FQL G++W+ +   S  + G+LADEMG+GKT+QT+A    L+       P +VV P
Sbjct: 161 KLLPFQLEGLHWLISQEHSVYNGGVLADEMGMGKTIQTIA----LLMNDVTKKPSLVVAP 216

Query: 440 LSTMPAWQETFDKW-APDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTY 498
              +  W+   ++     L    + G  R+ + + EF+               +VLLTTY
Sbjct: 217 TVALMQWKNEIEQHTGGKLKTHIFHGANRTSN-VGEFK-------------DVDVLLTTY 262

Query: 499 EY-----------------ILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVN 541
                              + K+ S L ++ +  + +DEAH +K+ +S+  +++NS    
Sbjct: 263 AVLESVFRKQNYGFKRKSGVYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTE 322

Query: 542 NRLLITGTPLQNNIKELAALINFL 565
            +  +TGTPLQN I E+ +LI FL
Sbjct: 323 KKWCLTGTPLQNRIGEMYSLIRFL 346

>Kwal_14.1868
          Length = 1357

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 86/354 (24%), Positives = 152/354 (42%), Gaps = 78/354 (22%)

Query: 382  LRDFQLTGINWMAFLWSKN-DNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPL 440
            L   Q  G++W+  +   N   G+LAD+MGLGKTVQ +A +            +++V P+
Sbjct: 675  LMKHQRQGLHWLLTVEKSNRKGGLLADDMGLGKTVQAIALMLANKSGVENCKTNLIVAPV 734

Query: 441  STMPAWQ---ETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTT 497
            + +  WQ   +T  K    L V+ Y G   ++      E Y       +  ++ +V+L +
Sbjct: 735  AVLRVWQAEVKTKVKKTSGLKVLIYGGGNGAK-----VENY-------RSLLRHDVVLVS 782

Query: 498  YEYI--------------------------------LKDRSELGS------IKWQFLAVD 519
            Y+ +                                LK+R E  S       K+  + +D
Sbjct: 783  YQTLASELKKHWPARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILD 842

Query: 520  EAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEI--- 576
            EA  +KN ++   ++  +     R  ++GTP+QNNI EL +LI FL    +  +Q+    
Sbjct: 843  EAQNIKNKKTQSAKACCTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKFKLD 902

Query: 577  ----------DFENQDEEQEEYIRDLHKRLQPFILRRLK--KDVEKSLPSKTERILRVE- 623
                      D+++ D +Q   I+ +   L+  +LRR K  K   K +    E+I+    
Sbjct: 903  IGNPLGKATNDYDSHDRQQA--IKKVQVLLRAIMLRRTKDSKIDGKPILELPEKIITNRE 960

Query: 624  --LSDVQTEYYKNILTKNYSA----LTAGSKGGHFSLLNIMSELKKASNHPYLF 671
              L   + ++Y ++  KN       L   +KG + S+L ++  L++A  HP L 
Sbjct: 961  DVLQGAELQFYSDLEAKNQKKVEKLLNNRAKGSYSSILTLLLRLRQACCHPELV 1014

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 86/163 (52%), Gaps = 9/163 (5%)

Query: 719  RVLIFSQMVRMLDILGDYLSIK-GITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            ++++FSQ     D+L  ++    G  + R DG++ S  R  +I+ F        + L+S 
Sbjct: 1196 KIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEEFYR-SLERRILLISM 1254

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
            +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q   V V+RL+ K++VE+ +LE
Sbjct: 1255 KAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQVHRLLVKNSVEDRILE 1314

Query: 838  RARKKM-ILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFGA 879
              +KK  ++E A+      D SK  + N+    EL  +    A
Sbjct: 1315 LQKKKRELVEIAM------DPSKIREVNQLGRRELGFLFGLNA 1351

>Scas_721.100
          Length = 1137

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 75/136 (55%), Gaps = 6/136 (4%)

Query: 717  GHRVLIFSQMVRMLDILGDYLSIKGIT----FQRLDGTVPSAQRRISIDHFNAPD-STDD 771
            G +V+IFSQ    LDIL D L     T      + DG +   +R   +  F   D S   
Sbjct: 980  GEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLKERSTVLQDFQIKDLSRQK 1039

Query: 772  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 831
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V R + ++++
Sbjct: 1040 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHRIGQTNNVKVVRFIIENSI 1099

Query: 832  EEEVLE-RARKKMILE 846
            EE++L  + RK+ I E
Sbjct: 1100 EEKMLRIQERKRTIGE 1115

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 134/303 (44%), Gaps = 68/303 (22%)

Query: 403 GILADEMGLGKTVQTVAFISWLIYAR---------------RQNGPHI---------VVV 438
           GIL+DEMGLGKT+ T+A I    Y                 R+  PH+         +VV
Sbjct: 502 GILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIVV 561

Query: 439 PLSTMPAWQETFDKW--APDLNVICYMGNQRSRDAIREFEFYT-NPYAKGKKNIKFNVLL 495
           P+S +  W   F+K   + D+    Y G   S  ++++    T NP           V++
Sbjct: 562 PMSLLNQWNTEFNKANNSSDMRSEIYYGGNVS--SLKKLLTKTHNPPT---------VVI 610

Query: 496 TTYEYI----------------LKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 539
           TTY  +                ++  S L S+ +  + +DE H ++N  +   +++    
Sbjct: 611 TTYGIVQSEWSKIFKKQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLT 670

Query: 540 VNNRLLITGTPLQNNIKELAALINFL------MPGRFTIDQEIDFENQDEEQEEYIRDLH 593
              + ++TGTP+ N + +L +L+ FL        G + +     FEN++ +Q   +  ++
Sbjct: 671 SKCKWVLTGTPIINRLDDLYSLVRFLKLEPWSQIGYWKMFVSTPFENKNFKQAFDV--VN 728

Query: 594 KRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGS 647
             L+P +LRR K  KD++      LP K   + R++LS  Q   YK +L +   ++  G 
Sbjct: 729 AILEPVLLRRTKQMKDIDGKPLVELPPKEVIVERLKLSKAQNAVYKYLLDRAEQSVILGL 788

Query: 648 KGG 650
             G
Sbjct: 789 ARG 791

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 88/162 (54%), Gaps = 20/162 (12%)

Query: 719  RVLIFSQMVRMLDILGDYLS-IKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            ++++FSQ     DIL  ++  +  +++ R DGT+    R   I+ F   +  + + L+S 
Sbjct: 1420 KLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYR-EKNERLLLISM 1478

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
            +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q+  V ++RL+ K+T+E+ ++E
Sbjct: 1479 KAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVE 1538

Query: 838  -RARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFG 878
             + RK+ ++E A+                 +P EL E+ + G
Sbjct: 1539 LQNRKRTLVENAM-----------------DPTELREVNRLG 1563

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 143/350 (40%), Gaps = 79/350 (22%)

Query: 386  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMP 444
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A +     A      ++VV P++ + 
Sbjct: 900  QRQGLYWLLKTESSKFKGGLLADDMGLGKTVQAIALMLANRSADSTCKTNLVVGPVAVLR 959

Query: 445  AWQETFD---KWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYI 501
             W +  +   K     +V+ Y G    +  +  F+   N          ++V+L +Y+ +
Sbjct: 960  VWHDEINTKVKKQAQFSVMIYGGFGGKK--VENFKAMHN----------YDVVLVSYQTL 1007

Query: 502  -----------LKDRSELG-------SIK-----------WQ----------FLAVDEAH 522
                       L+  SE G       SIK           W            + +DEA 
Sbjct: 1008 AVEFKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQ 1067

Query: 523  RLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEI------ 576
             +KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL    +  +Q+       
Sbjct: 1068 NIKNKQTQAAKACCTLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGN 1127

Query: 577  -------DFENQDEEQEEYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVEL 624
                   DF++ D ++   ++ +   L+  +LRR K           LP+K  R     L
Sbjct: 1128 ALLSRGGDFDSMDTKRA--LKKVRVLLRAIMLRRAKTSQINGQPILELPAKHIRKKEDIL 1185

Query: 625  SDVQTEYYKNI----LTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYL 670
                 E+YK++      +  + L         ++L ++  L++A  H  L
Sbjct: 1186 DGQDLEFYKSLEHETAIQARALLNERKASSSSNILTLLLRLRQACCHQEL 1235

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 72/138 (52%), Gaps = 5/138 (3%)

Query: 717  GHRVLIFSQMVRMLDILGDYL----SIKGITFQRLDGTVPSAQRRISIDHFNAPD-STDD 771
            G +V++FSQ    LDIL   L    S   +   + DG +   +R   ++ F   D +   
Sbjct: 993  GEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLKERTAVLEDFKVKDYAVQK 1052

Query: 772  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 831
            V LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V R V   ++
Sbjct: 1053 VLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNSVKVIRFVIDGSI 1112

Query: 832  EEEVLERARKKMILEYAI 849
            EE++L    +K  L  A+
Sbjct: 1113 EEKMLRIQDRKRTLGEAM 1130

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 131/310 (42%), Gaps = 73/310 (23%)

Query: 401 DNGILADEMGLGKTVQTVAFI-----------SWLIYARRQN------------------ 431
           + GIL+DEMGLGKT+  ++ +             L +    N                  
Sbjct: 507 NGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAY 566

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVIC---YMGNQRSRDAIREFEFYTNPYAKGKKN 488
              +++VP+S +  W++ FDK   +  + C   Y GN  S  ++             +KN
Sbjct: 567 KTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSL----------LIKRKN 616

Query: 489 IKFNVLLTTYEYILKDRSELG----------------SIKWQFLAVDEAHRLKNAESSLY 532
               V+LTTY  +  + ++L                 SI++  + +DE H ++N  +   
Sbjct: 617 PP-TVVLTTYGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITS 675

Query: 533 ESLNSFKVNNRLLITGTPLQNNIKELAALINFL------MPGRFTIDQEIDFENQDEEQE 586
           +++       R ++TGTP+ N + +L +L+ FL        G +       FE ++ +Q 
Sbjct: 676 KAVLELSSKYRWILTGTPIINRLDDLYSLVKFLKLEPWSQIGYWKQFITNPFEERNFKQA 735

Query: 587 EYIRDLHKRLQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNILTKNY 640
             +  ++  ++P +LRR K  KD + +    LP K   I +++LS  Q   Y+  L +  
Sbjct: 736 FDV--VNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFLQRAE 793

Query: 641 SALTAGSKGG 650
               +G + G
Sbjct: 794 KTFRSGLQSG 803

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 5/138 (3%)

Query: 717  GHRVLIFSQMVRMLDILGDYL----SIKGITFQRLDGTVPSAQRRISIDHFNAPD-STDD 771
            G +V+IFSQ    LDIL   L    S       + DG +   +R   +  F   D S   
Sbjct: 1012 GEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYSRQK 1071

Query: 772  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 831
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V R + +D++
Sbjct: 1072 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQDSI 1131

Query: 832  EEEVLERARKKMILEYAI 849
            EE++L    KK  +  A+
Sbjct: 1132 EEKMLRIQEKKRTIGEAM 1149

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 81/337 (24%), Positives = 138/337 (40%), Gaps = 74/337 (21%)

Query: 403 GILADEMGLGKTVQTVAFISWLIY---------------ARRQNGPH------------- 434
           GIL+DEMGLGKTV   + +    +               A   N P              
Sbjct: 528 GILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASKT 587

Query: 435 -IVVVPLSTMPAWQETFDKW--APDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
            ++VVP+S +  W   F K   +PD+    Y G   S          +      K     
Sbjct: 588 TLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVS----------SLKTLLTKTKTPP 637

Query: 492 NVLLTTYEYILKD----------------RSELGSIKWQFLAVDEAHRLKNAESSLYESL 535
            V+LTTY  +  +                 S L S+ +  + +DE H ++N  +   +++
Sbjct: 638 TVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKAV 697

Query: 536 NSFKVNNRLLITGTPLQNNIKELAALINFLM--PGRFTIDQEIDFENQDEEQEEYIRD-- 591
            + +   + ++TGTP+ N + +L +L+ FL   P R  I+    F +   E + Y +   
Sbjct: 698 MALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWR-QINYWKTFVSTPFESKNYKQAFD 756

Query: 592 -LHKRLQPFILRRLKKDVEK------SLPSKTERILRVELSDVQTEYYKNILTKNYSALT 644
            ++  L+P +LRR K+  +K       LP K   I R+  S  Q   YK +L K   ++ 
Sbjct: 757 VVNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLYKFLLDKAEVSVK 816

Query: 645 AGSKGG-----HFSLLNIMSELKKASNHPYLFDNAEE 676
           +G   G     + ++L  +  L++   HP L  + +E
Sbjct: 817 SGIARGDLLKKYSTILVHILRLRQVCCHPGLIGSQDE 853

>Scas_674.12d
          Length = 1323

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 2/128 (1%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLS-IKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFL 774
            D  +++IFSQ     DI   +L  +  + + +  G + + QR   I  F    + + + L
Sbjct: 1164 DTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKFYR-QANERILL 1222

Query: 775  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 834
            +S +AG  G+ L  A+ VII D  WNP  + QA  R +RI Q   V V+RL  KD+VE+ 
Sbjct: 1223 ISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLFIKDSVEDR 1282

Query: 835  VLERARKK 842
            + E   KK
Sbjct: 1283 IAELQEKK 1290

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/331 (25%), Positives = 144/331 (43%), Gaps = 46/331 (13%)

Query: 386 QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMP 444
           Q  G++W+  +  SK   G+LAD+MGLGKTVQ +A +       +    +++V P++ + 
Sbjct: 654 QKIGLHWLLNVEASKKKGGLLADDMGLGKTVQGIALMLANRSKDQACKTNLIVAPVAVLR 713

Query: 445 AWQ---ETFDKWAPDLNVICYMGNQR--------SRDAIR------EFEFYTN-PYAKGK 486
            W    ET  K   + +   Y G  +          DAI         EF  + P + GK
Sbjct: 714 VWGGELETKIKKEANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPASLGK 773

Query: 487 KNIKFNVLLTTYEY-ILKDRSELGS------IKWQFLAVDEAHRLKNAESSLYESLNSFK 539
              +   +        LK + E  S        +  + +DE   +KN ++   ++  S  
Sbjct: 774 DQKQLPAIPQLAAMNSLKKKDEYFSPFFCNESTFYRIILDEGQNIKNKKTRAAKACCSLD 833

Query: 540 VNNRLLITGTPLQNNIKELAALINFL-MPG-----RFTIDQEIDFENQ-----DEEQEEY 588
              R + +GTP+QN++ EL +LI FL +P      RF  D    F  +     D ++++ 
Sbjct: 834 ATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIGRPFLRKNGNYDDFDRKQA 893

Query: 589 IRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYKNILTKNYS-- 641
           I+ +   L   +LRR K D+        LP K   I    L   + E+Y ++  KN    
Sbjct: 894 IKKVQVLLSAIMLRRSKSDMIDGKPLLELPPKQIEIDSAALEGDELEFYTDLEAKNRKLA 953

Query: 642 --ALTAGSKGGHFSLLNIMSELKKASNHPYL 670
              L   +KG + S+L ++  L++A  H  L
Sbjct: 954 ERLLKRKAKGNYSSVLTLLLRLRQACVHSEL 984

>Kwal_47.17771
          Length = 972

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 71/138 (51%), Gaps = 5/138 (3%)

Query: 717 GHRVLIFSQMVRMLDIL----GDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTD-D 771
           G ++++FSQ    LDI+        S       + DG +   +R   +  F   D T   
Sbjct: 815 GEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLK 874

Query: 772 VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 831
           + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V R + + ++
Sbjct: 875 ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSI 934

Query: 832 EEEVLERARKKMILEYAI 849
           EE++L    +K  L  A+
Sbjct: 935 EEKMLRIQERKRTLGEAV 952

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 148/364 (40%), Gaps = 82/364 (22%)

Query: 403 GILADEMGLGKTVQTVAFISWL----IYARRQ---------------------------N 431
           GILADEMGLGKT+  +A I  +     Y + +                           +
Sbjct: 336 GILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYAS 395

Query: 432 GPHIVVVPLSTMPAWQETFDKWAPDLNVIC---YMGNQRSRDAIREFEFYTNPYAKGKKN 488
           G  +VVVP+S +  WQ+ F+K +      C   Y GN  S  ++             K  
Sbjct: 396 GTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKSLL-----------TKTK 444

Query: 489 IKFNVLLTTYEYIL--------------KDRSELGSIKWQFLAVDEAHRLKNAESSLYES 534
               VL+TTY  +                D S L S+++  + +DE H ++N  +    S
Sbjct: 445 SPPTVLITTYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRS 504

Query: 535 LNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFT-IDQEIDFENQDEEQEEY---IR 590
           L   K     ++TGTP+ N + +L +L+ F+    ++ I     F +   E++ Y     
Sbjct: 505 LMDLKSTRSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAFD 564

Query: 591 DLHKRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALT 644
            +   L+P ILRR K  +DV+      LP K   I +V  +  +   YK  L K  S++ 
Sbjct: 565 IVSSILEPVILRRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALYKYFLNKAESSVK 624

Query: 645 AGSKGG-----HFSLLNIMSELKKASNHPYLF--------DNAEERVLKKFGDGQMSREN 691
            G   G     + ++L  +  L++   H  L         D AE R+L +    Q    N
Sbjct: 625 EGLDRGDLLKKYSTILVHILRLRQVCCHADLLGSQDENDEDIAENRLLAEKASTQRPIVN 684

Query: 692 VLRG 695
            ++G
Sbjct: 685 EVKG 688

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 74/134 (55%), Gaps = 6/134 (4%)

Query: 717  GHRVLIFSQMVRMLDILG----DYLSIKGITFQRLDGTVPSAQRRISIDHFNAPD-STDD 771
            G ++++FSQ    LDIL      +L    +   + DG +   +R   ++ F+  D S   
Sbjct: 957  GEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDMKERTRILEQFHDKDLSCIK 1016

Query: 772  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 831
            + LLS + GG+G+NL  A    + D  W+P  + QA+ R HRIGQ+  V V R +  ++V
Sbjct: 1017 LLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIHRIGQQQTVKVVRFIIDNSV 1076

Query: 832  EEEVLE-RARKKMI 844
            EE++L  + RK+M+
Sbjct: 1077 EEKMLRIQERKRML 1090

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 134/308 (43%), Gaps = 75/308 (24%)

Query: 401 DNGILADEMGLGKTVQTVAFISWLIY---------------------------ARRQNGP 433
           + GILADEMGLGKT+  +A I    Y                            R     
Sbjct: 478 NGGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHK 537

Query: 434 H--------IVVVPLSTMPAWQETFDKWAPDLNVIC--YMGNQRSRDAIREFEFYT-NPY 482
           H        ++VVP+S +  WQ  F+K   DL   C  Y GN      I++   Y   P 
Sbjct: 538 HDTYAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGNN-----IKDLRAYVLGPN 592

Query: 483 AKGKKNIKFNVLLTTY-----EYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNS 537
           A        +V++TTY     EY     S L ++ +  + +DE H ++N  +   +++ +
Sbjct: 593 AP-------SVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIA 645

Query: 538 FKVNNRLLITGTPLQNNIKELAALINFL---------MPGRFTIDQEIDFENQDEEQEEY 588
            + + + ++TGTP+ N + +L +L+ FL            R+     + FE  +  Q   
Sbjct: 646 LRSSRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYV---SVPFEKGNYAQAFD 702

Query: 589 IRDLHKRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSA 642
           +  ++  L+P +LRR K  KDV+     SLP K   + +++LS  +   Y+++L    ++
Sbjct: 703 V--INAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLEDAENS 760

Query: 643 LTAGSKGG 650
           +  G   G
Sbjct: 761 VKEGLAKG 768

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 68/129 (52%), Gaps = 5/129 (3%)

Query: 719  RVLIFSQMVRMLDILGDYL----SIKGITFQRLDGTVPSAQRRISIDHFNAPDSTD-DVF 773
            +V++FSQ    LDIL + L    +       + DG +   +R   +  F         V 
Sbjct: 930  QVVVFSQFSSYLDILENELRQSFASDICEIYKFDGRLDLKERSNVLAKFTEKSLVKMKVL 989

Query: 774  LLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEE 833
            LLS +AGG+G+NL  A    I D  W+P  + QAM R HRIGQ N V +YR + ++++EE
Sbjct: 990  LLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMDRIHRIGQSNTVKIYRFIVENSIEE 1049

Query: 834  EVLERARKK 842
            ++L    KK
Sbjct: 1050 KMLRIQEKK 1058

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 124/289 (42%), Gaps = 63/289 (21%)

Query: 402 NGILADEMGLGKTVQTVAFISWL------IYARRQNGPHI-------------------- 435
            GILADEMGLGKT+  +A I+ +      +    Q  P +                    
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 436 -VVVPLSTMPAWQETFDKWAPDLNVIC---YMGNQRSRDAIREFEFYTNPYAKGKKNIKF 491
            +VVP+S +P W+  F +      + C   Y GN  +   +             K+    
Sbjct: 515 LIVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLV-----------KQKSPP 563

Query: 492 NVLLTTYEYILKDRSELG------------SIKWQFLAVDEAHRLKNAESSLYESLNSFK 539
           +V+LTTY  +  + S+L             S+++  + +DE H ++N  +   +++ +  
Sbjct: 564 SVVLTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALT 623

Query: 540 VNNRLLITGTPLQNNIKELAALINFL-MPGRFTIDQEIDFENQDEEQEEY---IRDLHKR 595
              + ++TGTP+ N + +L +LI F+       ID    F +   E+++Y   +  +   
Sbjct: 624 SRRKWVLTGTPIMNRLDDLFSLIKFMNFEPWCKIDYWRQFVSDPFEKKDYSSALEVIQAV 683

Query: 596 LQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNILTK 638
           + P +LRR K  KD + +    LP K   I  +  SD +   YK  L+K
Sbjct: 684 MGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSK 732

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 83/162 (51%), Gaps = 20/162 (12%)

Query: 719  RVLIFSQMVRMLDILGDYLSIK-GITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            +++IFSQ     +IL  +L  K    + +  G++ +AQRR  + +    D    + L+S 
Sbjct: 1463 KIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSM-NAQRRSDVINEFYRDPEKRILLISM 1521

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
            +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V++L  KD+VE+ + E
Sbjct: 1522 KAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQVHKLFIKDSVEDRISE 1581

Query: 838  -RARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKFG 878
             + RKK +++ A+                 +PG++ E+   G
Sbjct: 1582 LQKRKKEMVDSAM-----------------DPGKIKEVNSLG 1606

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 150/348 (43%), Gaps = 61/348 (17%)

Query: 386  QLTGINWMAFLW-SKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMP 444
            Q  G++W+  +  S    G+LAD+MGLGKT+Q +A +        +   +++V P+S + 
Sbjct: 947  QRLGLHWLLQVENSAKKGGLLADDMGLGKTIQAIALMLANRSEESKCKTNLIVAPVSVLR 1006

Query: 445  AWQ---ETFDKWAPDLNVICYMGNQRS-----RDAIR------EFEFYTNPYAK------ 484
             W+   ET  K         + G+        RD  R       ++   N + K      
Sbjct: 1007 VWKGELETKVKKRAKFTTFIFGGSGNGKVKHWRDLARYDAVLVSYQTLANEFKKHWPKKL 1066

Query: 485  -GKKNI--------KFNVLLTTYEY----ILKDRSELGSIKWQFLAVDEAHRLKNAESSL 531
             G++N           N L T+ EY       D +      +  + +DE   +KN  +  
Sbjct: 1067 DGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDST------FYRILLDEGQNIKNKNTRA 1120

Query: 532  YESLNSFKVNNRLLITGTPLQNNIKELAALINFL-MP-----GRFTID------QEIDFE 579
             ++  +     R +++GTP+QN++ EL +LI FL +P      RF +D      +   ++
Sbjct: 1121 SKACCTINGMYRWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQRFKLDIGRFFQRNKQYQ 1180

Query: 580  NQDEEQEEYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYKN 634
              +E+++  +R +   L   +LRR K D         LP K   +    L   + ++Y  
Sbjct: 1181 YDNEDRKNALRKVRVLLNAIMLRRSKADKIDGKPLLELPPKIVEVDESRLKGEELKFYTA 1240

Query: 635  ILTKNYS----ALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERV 678
            + +KN +     L   ++G + S+L ++  L++A  H  L    E++ 
Sbjct: 1241 LESKNQALAKKLLNNSTRGSYSSVLTLLLRLRQACCHSELVVMGEKKA 1288

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 129/291 (44%), Gaps = 67/291 (23%)

Query: 403 GILADEMGLGKTVQTVAFISWLI--------------------YARRQNGPH-----IVV 437
           G+LADEMGLGKT+ T+A IS +                     Y  + + P+     ++V
Sbjct: 496 GLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLIV 555

Query: 438 VPLSTMPAWQETFDKWAPDLNVIC--YMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLL 495
           VP+S +  WQ+ F+K   + N  C  Y G  R+ + I       NP           ++L
Sbjct: 556 VPMSLLFQWQKEFEKANNNPNAHCEIYYGG-RAGNLITLLTKTKNPPT---------IIL 605

Query: 496 TTYEYILKDRSELG----------------SIKWQFLAVDEAHRLKNAESSLYESLNSFK 539
           T+Y  I  + S+L                 S+++  + +DE H ++N  +   +++    
Sbjct: 606 TSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAVMDLS 665

Query: 540 VNNRLLITGTPLQNNIKELAALINFL------MPGRFTIDQEIDFENQDEEQEEYIRDLH 593
            + + ++TGTP+ N + +L +L+ F+        G +       FE ++ +Q   +  + 
Sbjct: 666 SSRKWVLTGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYKQAFDV--VS 723

Query: 594 KRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTK 638
             L+P +LRR K  KD+      +LP K   I +V+ +  +   YK  L K
Sbjct: 724 SVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILYKFFLNK 774

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 717  GHRVLIFSQMVRMLDILGDYL----SIKGITFQRLDGTVPSAQRRISIDHF-NAPDSTDD 771
            G +V++FSQ    LDIL + L    S       + DG +    R   +D F     S   
Sbjct: 970  GEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNLKDRSRVLDTFATKDLSKLK 1029

Query: 772  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTV 831
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ+++V + R + ++++
Sbjct: 1030 ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVHRIGQESNVKIIRFIMENSI 1089

Query: 832  EEEVLERARKKMILEYAI 849
            EE++L    +K  L  A+
Sbjct: 1090 EEKMLSIQDRKRTLGEAV 1107

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 77/162 (47%), Gaps = 6/162 (3%)

Query: 716  DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLL 775
            D  +V+++SQ    L ++G  L +  I  + L     +A    +I++F    S     LL
Sbjct: 1378 DPPQVILYSQKTEYLKVIGKVLKLYHI--EHLACLSNTANVGETINNFKRQPSVT-CLLL 1434

Query: 776  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 835
            + +  G G+NL+ A  + + D   N   +LQAM R +RIGQ     V+  + ++TVEE +
Sbjct: 1435 NVKTLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEENI 1494

Query: 836  LERARKKMILEYAIISLGVTDGSKYTKKNEPNPGELSEILKF 877
            L   R K ILE          G KY +  +    E S+  KF
Sbjct: 1495 L---RYKCILEERKRKEKSKKGDKYDEAQDETDNEESDDAKF 1533

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 108/279 (38%), Gaps = 51/279 (18%)

Query: 403 GILADEMGLGKTVQTVAFISWLIYARRQNGPHIVVV-----------------PLSTMPA 445
           G+LA+EMGLGKT++ ++ I  L+  R+        +                 P + +  
Sbjct: 387 GVLAEEMGLGKTIEILSLI--LLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQ 444

Query: 446 WQETFDKWAPDLNVICYMG-NQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKD 504
           W E  +  A  L    Y G N+  +D     E              +N++ T   +   +
Sbjct: 445 WLEEIELHANSLKWYTYRGYNEIMKDCKTVDEAVQQLCQYDIIVTSYNIIATEVHHAEFN 504

Query: 505 RS----ELGSIKWQF---LAVDEAHRLKNAESSLYESLNSFKVNNRLL--------ITGT 549
           RS     L S K+ +   LA+ + +R+   E  +  S +++      L        ++GT
Sbjct: 505 RSIRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIHTWGVSGT 564

Query: 550 PLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQPFILRRLKKDVE 609
           P+Q NI     ++++L    F    E+DF          IR L + ++   LR   KD  
Sbjct: 565 PIQ-NIYNFRMIMSYLKLHPFC--DEVDF----------IRTLQEEIK---LRNEAKDYT 608

Query: 610 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSK 648
            +      + +R  + D    +Y+  L   +S     S+
Sbjct: 609 SNDFVCQLKGVRFSIKDCMNIFYRYDLCIRHSKANVASQ 647

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 10/130 (7%)

Query: 719  RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDV--FLLS 776
            ++L++SQ    + ++   LS+  I     +        R   D       T D+   LL+
Sbjct: 1299 QILMYSQSFDFMKVVSQVLSLHNI-----NNICCLQNNRNVGDMIARFKKTSDITCLLLN 1353

Query: 777  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL 836
             R+ G G+NL+ A  + + D   N   ++QAM+R +RIGQ+    V+  + ++TVEE ++
Sbjct: 1354 IRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVEESIM 1413

Query: 837  ERARKKMILE 846
               R K +LE
Sbjct: 1414 ---RYKCVLE 1420

>Scas_573.9
          Length = 1502

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 719  RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTR 778
            ++L++SQ    L +LG  L+   I  + L     S+     I  F +  S     LL+ +
Sbjct: 1333 QILLYSQSANFLKVLGKILTKNDI--EHLTCLSNSSTIGKKIARFKS-QSNITCLLLNVK 1389

Query: 779  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
              G G+NL+ A  + + D   N   +LQAM R +RIGQK    V+ L+  ++VEE + +
Sbjct: 1390 TLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVEENIFK 1448

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 18/83 (21%)

Query: 403 GILADEMGLGKTVQTVAFISWLIYAR----------------RQNGPHIVVVPLSTMPAW 446
           G+L++EMGLGKT++ +A I  ++  R                R+    ++V P + +  W
Sbjct: 371 GLLSEEMGLGKTIEVLALI--MLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQW 428

Query: 447 QETFDKWAPDLNVICYMGNQRSR 469
               +    +L +  YMG+  +R
Sbjct: 429 INETNAHTENLKIFHYMGSLATR 451

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 719  RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNA-PDSTDDVFLLST 777
            +++IFS     L IL   L+   +T  R       A+   ++D F   P+ T    LL+ 
Sbjct: 1353 QIVIFSSHSAFLSILSTLLTAHNVTHARPLRNTKFAK---AVDTFRKDPNCT--CLLLNV 1407

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
             +   G+ L+ A  +I+ +   +   + QA++R HRIGQK+   V+  + ++TVEE ++ 
Sbjct: 1408 HSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMVRNTVEESIM- 1466

Query: 838  RARKKMILE 846
              + K +LE
Sbjct: 1467 --KYKAVLE 1473

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 20/92 (21%)

Query: 399 KNDNGILADEMGLGKTVQTVAFISWLIY----------------ARRQNGPHIVVVPLST 442
           K   G+LADEMGLGKT++ +  IS  +                   R+   +++V P S 
Sbjct: 349 KKARGVLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESI 408

Query: 443 MPAWQETFD----KWAPDLNVICYMGNQRSRD 470
           +  W +  D    K   D  V  Y G +++R+
Sbjct: 409 LQQWIDEIDLHINKKVSDFKVFHYEGFEKTRN 440

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 8/129 (6%)

Query: 719  RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNA-PDSTDDVFLLST 777
            +++I+SQ   +L+I+   L    I F      V +  +   ++ F A P+ T    LL T
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNSIKFLTTTKNVRNFAK--VVETFKADPEIT--CLLLDT 1414

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
            +    G+ L+ A  V + +   N   + QA+ R HRIGQ +   V+  +  +TVE  +L 
Sbjct: 1415 KRQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL- 1473

Query: 838  RARKKMILE 846
              R K ILE
Sbjct: 1474 --RYKSILE 1480

>Kwal_14.1287
          Length = 1518

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 9/134 (6%)

Query: 719  RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNA-PDSTDDVFLLST 777
            +++I+SQ    L +L   L  K  + Q  + T  S +    ++ F   P+ T    LL+ 
Sbjct: 1332 QIIIYSQYSEFLGLLSKVL--KQHSIQHCN-TAGSGKFSKIVEKFKKNPEVT--CLLLNV 1386

Query: 778  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
                 G+ L+ A  V I D   N   +LQA+ R HRIGQ     V+  V ++TVE+ ++ 
Sbjct: 1387 TRQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIV- 1445

Query: 838  RARKKMILEYAIIS 851
              R K +LE  I S
Sbjct: 1446 --RLKGVLEERIAS 1457

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 18/64 (28%)

Query: 399 KNDNGILADEMGLGKTVQTVAFISWLIYARRQNGP----------------HIVVVPLST 442
           K+  G+L++EMGLGKT++ +A +  L++ R  NG                 +++V P S 
Sbjct: 351 KHAKGVLSEEMGLGKTLEILALM--LVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSI 408

Query: 443 MPAW 446
           +  W
Sbjct: 409 LQQW 412

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 69/163 (42%), Gaps = 27/163 (16%)

Query: 360  NNSARPKFEKLVEQPSYVKFGELRDFQLT---------GINWMAFLWSKND-NGILADEM 409
            N S R   E L +  + ++  EL   +LT         G++W+  +   N   G+LAD+M
Sbjct: 854  NESLRNLLEGLKQHETEIEGEELTPEELTVNLLKHQRRGLHWLLNVEKSNKRGGLLADDM 913

Query: 410  GLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMPAWQ---ETFDKWAPDLNVICYMGNQ 466
            GLGKTVQ +A +            +++V P++ +  WQ   +T  K         Y GN 
Sbjct: 914  GLGKTVQAIALMIANRSELESCKTNLIVAPVAVLRVWQAEIQTKIKKNATFKAFIYGGN- 972

Query: 467  RSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELG 509
                         N     K  ++++ +L +Y+ +  +   +G
Sbjct: 973  -------------NKVVSYKDLLRYDAVLVSYQTLASELKNIG 1002

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 17/102 (16%)

Query: 759  SIDHFNAP--------------DSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 804
            SI HFN                DS+    L++ +    G+ L  A  VI+ +     +  
Sbjct: 1324 SISHFNTEFGQDLAKEAELFKRDSSITCLLMNPKWCSRGLKLTNATHVILMEPMSEGRIQ 1383

Query: 805  LQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 846
             QA+ R HRIGQ     V+ L++++T EE  L   + +M+LE
Sbjct: 1384 EQAVERIHRIGQGKDTFVWHLMTRNTAEESTL---KYRMLLE 1422

>CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces
           cerevisiae YKR024c DBP7 RNA helicase, start by
           similarity
          Length = 715

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 6/113 (5%)

Query: 717 GHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDD----V 772
           G  V + S+  ++L  + D   + GI   +L G++    R +++ HF A DS       +
Sbjct: 439 GDSVRVLSKGNKILPSIKDE-ELPGIICYKLHGSLSQQMRTMTLKHF-ATDSEQTKGKHL 496

Query: 773 FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRL 825
            L  T     G++L    TVI FD  +  +  L  + R  R G+    +++ L
Sbjct: 497 ILFCTDVASRGLDLPDVSTVIEFDPPFAVEDHLHRIGRTARAGRSGEALLFLL 549

>KLLA0F10505g complement(966736..969174) some similarities with
           sp|P21372 Saccharomyces cerevisiae YBR237w PRP5 pre-mRNA
           processing RNA-helicase, hypothetical start
          Length = 812

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 4/125 (3%)

Query: 718 HRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLST 777
            + +IF    ++ D+L D L + GIT   +    PSA+R  ++  F     TD+  L+ T
Sbjct: 501 EKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFK---ETDNGILICT 557

Query: 778 RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLE 837
                G+N+     VII+++       +  + R  R G  N V +  ++  +     +L 
Sbjct: 558 EVLSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGR-GTNNGVALSFVMVDELASAYILV 616

Query: 838 RARKK 842
           +  K+
Sbjct: 617 KCMKE 621

>AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH]
           (576175..578307) [2133 bp, 710 aa]
          Length = 710

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 744 FQRLDGTVPSAQRRISIDHFN---APDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWN 800
           F +L G++P A R  ++ HF+   A      + L  T     G++L    TVI  D  + 
Sbjct: 467 FYKLHGSLPQAVRVATLRHFSSDAAATRGKHLVLFCTDVASRGLDLPRVSTVIEMDPPFA 526

Query: 801 PQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERAR 840
            +  L  + R  R G     +++ L  +   EE  +E  R
Sbjct: 527 VEDHLHRIGRTARAGVAGESLLFLLPGE---EEGYMEHIR 563

>ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C
           (DBP1) - SH] (225070..226941) [1872 bp, 623 aa]
          Length = 623

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 59/131 (45%), Gaps = 6/131 (4%)

Query: 716 DGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLL 775
           DG   L+F +  RM D L D+L ++ ++   + G    A+R  ++  F    +     L+
Sbjct: 401 DGGLTLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRAN---VLV 457

Query: 776 STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN-HVMVYRLVSKDTVEE- 833
           +T     G+++     VI +D   +    +  + R  R G        +   +K+ V+E 
Sbjct: 458 ATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFNRGNKNVVKEL 517

Query: 834 -EVLERARKKM 843
            ++LE A +++
Sbjct: 518 VDILEEANQEV 528

>CAGL0K03817g 354005..357958 similar to sp|P39685 Saccharomyces
           cerevisiae YMR129w nuclear pore protein, start by
           similarity
          Length = 1317

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%)

Query: 313 LVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTNYN 360
           L  WK+ N  E T        + AP+   HF+  +  KILP+N+   N
Sbjct: 201 LSAWKKFNAKEFTITGNTIKNRQAPDYSSHFKGALTVKILPENTAFLN 248

>AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH]
            (888186..890792) [2607 bp, 868 aa]
          Length = 868

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 1001 TSKRRA--RNDLTSIGESEIRAIYKAVLKYGDLTNLFEELISDGNL--PVKSIDKYQEVY 1056
             SK+RA   N  TSI  SE   + + + +  +LTN  +ELI DGN    ++++DK + +Y
Sbjct: 136  VSKKRALTSNRRTSIKISESIILIEKIFQMLELTNKCQELIRDGNFYKALQNLDKLERIY 195

>Kwal_56.24760
          Length = 433

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 721 LIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAG 780
           +IF       +IL   L    +    L   +P  +R  S+  F A  +     L++T   
Sbjct: 259 IIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAAR---VLIATDVA 315

Query: 781 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVL-ERA 839
             G+++ T   V+ +D   NP   +    R  R G+K   + + +  +D    + + ER 
Sbjct: 316 SRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICF-VAQRDVSRIQAIEERI 374

Query: 840 RKKM 843
            KKM
Sbjct: 375 NKKM 378

>Scas_642.2*
          Length = 849

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 7/115 (6%)

Query: 588 YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGS 647
           ++ D HKR   F + R   DV  +L    +      +  ++T+Y+ N  TK  +A    S
Sbjct: 201 WLGDGHKRDPYFAINREDVDVNSTLEEYGK------IWGMETKYWANPHTKGGTAEMGLS 254

Query: 648 KGGHFSLLNIMSELKKASNH-PYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSG 701
           +    +   + S L +A N   +L D  +   +K   D ++ RE+++ GLI S G
Sbjct: 255 QPHRLTFNLVHSPLWRAINKLQFLLDKKKNFPIKYVMDERIVRESLIAGLIDSDG 309

>Scas_716.42
          Length = 208

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 970  MNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRARNDL 1010
            MN++ N L+++K   NGDG  ++   +SS R  KR+ R DL
Sbjct: 54   MNKQQNFLERMKMKANGDG-NLEGISKSSIRRRKRKMREDL 93

>Scas_700.23
          Length = 640

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 3/96 (3%)

Query: 720 VLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRA 779
            LIF +  RM D L D+L ++      + G     +R  ++  F A  +T    L++T  
Sbjct: 429 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTAT---ILVATAV 485

Query: 780 GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIG 815
              G+++     VI FD   +    +  + R  R G
Sbjct: 486 AARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAG 521

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 47,156,222
Number of extensions: 2104748
Number of successful extensions: 7867
Number of sequences better than 10.0: 182
Number of HSP's gapped: 7699
Number of HSP's successfully gapped: 249
Length of query: 1457
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1343
Effective length of database: 12,649,657
Effective search space: 16988489351
Effective search space used: 16988489351
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)