Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.540740718040.0
Sklu_2411.83821814727e-55
YMR021C (MAC1)4171664721e-54
Kwal_26.82193911894386e-50
ABR058C3501763982e-44
CAGL0M07590g4561673702e-39
KLLA0E07733g4691413352e-34
Scas_668.16291581491e-10
Scas_710.11743501308e-08
YGL166W (CUP2)225421232e-07
KLLA0A03047g567421272e-07
YPR008W (HAA1)694421272e-07
AEL295C544421253e-07
Kwal_14.1543599421253e-07
CAGL0L09339g877421253e-07
CAGL0I04180g265651126e-06
KLLA0B11253g47022654.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.5
         (407 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.5                                                            699   0.0  
Sklu_2411.8 YMR021C, Contig c2411 15729-16877                         186   7e-55
YMR021C (MAC1) [3985] chr13 complement(317164..318417) Transcrip...   186   1e-54
Kwal_26.8219                                                          173   6e-50
ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH] (501771..502...   157   2e-44
CAGL0M07590g 758940..760310 weakly similar to sp|P35192 Saccharo...   147   2e-39
KLLA0E07733g 694992..696401 weakly similar to sp|P35192 Saccharo...   133   2e-34
Scas_668.16                                                            62   1e-10
Scas_710.11                                                            55   8e-08
YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent tra...    52   2e-07
KLLA0A03047g 269553..271256 some similarities with sp|Q12753 Sac...    54   2e-07
YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein tha...    54   2e-07
AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W (...    53   3e-07
Kwal_14.1543                                                           53   3e-07
CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753 S...    53   3e-07
CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata metal-act...    48   6e-06
KLLA0B11253g 984132..985544 weakly similar to sp|P53270 Saccharo...    30   4.9  

>Scas_576.5
          Length = 407

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/407 (85%), Positives = 349/407 (85%)

Query: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60
           MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS
Sbjct: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60

Query: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120
           SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK
Sbjct: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120

Query: 121 GSSVSSKDNGNSKFIPEVEYLKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           GSSVSSKDNGNSKFIPEVEYLKQ                                     
Sbjct: 121 GSSVSSKDNGNSKFIPEVEYLKQLSGSSSGSGSNSLGSTPNSNTCCHHHTTCASMAAAAT 180

Query: 181 XXXXXQSLLSKXXXXXXXXXXXXXXXXLDIGKIEESLNSMEYFEQVLDSKTPLVDLFTHK 240
                QSLLSK                LDIGKIEESLNSMEYFEQVLDSKTPLVDLFTHK
Sbjct: 181 ANTSTQSLLSKNDNNMTTSTNMTEDNNLDIGKIEESLNSMEYFEQVLDSKTPLVDLFTHK 240

Query: 241 GVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNELMECTTSNC 300
           GVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNELMECTTSNC
Sbjct: 241 GVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNELMECTTSNC 300

Query: 301 ACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKLIPSQYWWDFLIGK 360
           ACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKLIPSQYWWDFLIGK
Sbjct: 301 ACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKLIPSQYWWDFLIGK 360

Query: 361 TVKLQEGDLESIDIIGWFDSLINKYPMELLDASDMESNNYHQRFYVI 407
           TVKLQEGDLESIDIIGWFDSLINKYPMELLDASDMESNNYHQRFYVI
Sbjct: 361 TVKLQEGDLESIDIIGWFDSLINKYPMELLDASDMESNNYHQRFYVI 407

>Sklu_2411.8 YMR021C, Contig c2411 15729-16877
          Length = 382

 Score =  186 bits (472), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 121/181 (66%), Gaps = 11/181 (6%)

Query: 233 LVDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNE- 291
           +V+L THKGVYLS+ CSCED NC C NCLIHR E+ELN YIRQSGIPLTN+G     ++ 
Sbjct: 195 MVELLTHKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDE 254

Query: 292 ---------LMECTT-SNCACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVI 341
                     + C+T S C C   DC+C  C+ HP EIIS+  +LL+G+L+  L+RKT+I
Sbjct: 255 NGHGNGSIKTISCSTESVCRCPPQDCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTII 314

Query: 342 KFKNKLIPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDASDMESNNYH 401
           K++NKLIPS+YWWDF+  +   +    LES+D++ WFDS++  Y   LL+    +  N H
Sbjct: 315 KYRNKLIPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYGSFLLEDHGDDMINLH 374

Query: 402 Q 402
           +
Sbjct: 375 E 375

 Score =  124 bits (311), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 95/149 (63%), Gaps = 24/149 (16%)

Query: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRI---- 56
           MII+  +KY+C +CIRGHRSSTCKH++RMLVKVRTRGRPSP ++R VIMVD+ S++    
Sbjct: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60

Query: 57  ----DAKSSCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVD 112
               D+   C  SN  SK        SC++ M +QP+LF+R   ++KA L++G L+I+V+
Sbjct: 61  HTPEDSNPCCQRSNANSK--------SCNK-MNKQPILFLRAMRTQKALLVDGMLKIMVE 111

Query: 113 DSADSNEKGSSVSSKDNGNSKFIPEVEYL 141
           D+        SVS       K + E EY+
Sbjct: 112 DN-------ESVSIDSKKKFKLVSEREYM 133

>YMR021C (MAC1) [3985] chr13 complement(317164..318417)
           Transcription factor involved in induction of genes
           required for the reduction and utilization of iron and
           copper [1254 bp, 417 aa]
          Length = 417

 Score =  186 bits (472), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 112/166 (67%), Gaps = 6/166 (3%)

Query: 234 VDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNELM 293
           V++ THKG++LS+ CSCED +CPC+NCLIHR+E+ELNSYI+QSG+PLTN+GEA+  +++M
Sbjct: 250 VEVLTHKGIFLSTQCSCEDESCPCVNCLIHRSEEELNSYIQQSGVPLTNIGEAQITDKMM 309

Query: 294 E------CTTSNCACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKL 347
           +      CT   C C   +C C  C  H T II  +K    G+L+  L RKT IKFK KL
Sbjct: 310 DYLDDCKCTDKECICPPDNCTCDGCFSHSTNIIPFEKFFFYGILNARLTRKTQIKFKGKL 369

Query: 348 IPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDAS 393
           +PS+YWWDFL  +   + +  LE +DI  WF  L++ Y   L DA+
Sbjct: 370 VPSKYWWDFLKLQVPLMTDAQLELLDIHAWFQKLVSNYAPHLSDAT 415

 Score =  138 bits (348), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 99/143 (69%), Gaps = 12/143 (8%)

Query: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60
           MII+   KYACASCIRGHRSSTC+H++RML+KVRTRGRPSP  IRD I+VDS+S    +S
Sbjct: 1   MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTS----QS 56

Query: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120
           + + +  Q    EGD    C   M +QP+LFVR    +KAR++NGKL IL+++   ++E 
Sbjct: 57  TEYENGAQ---IEGD----CCSAMNQQPILFVRASAVRKARMINGKLHILMEEGFTAHEP 109

Query: 121 GSSVSSKDNGNSKFIPEVEYLKQ 143
               +  D+GN K+I E E+L++
Sbjct: 110 KDISTFTDDGN-KYITETEFLRK 131

>Kwal_26.8219
          Length = 391

 Score =  173 bits (438), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 125/189 (66%), Gaps = 7/189 (3%)

Query: 217 LNSMEYFEQV--LDSK---TPLVDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNS 271
           L + ++ EQ+  LDS+   T +V+LFTHKGVYLS+ CSC++GNC C+NCLIHR E+EL S
Sbjct: 193 LPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQCSCDEGNCSCVNCLIHRKEEELES 252

Query: 272 YIRQSGIPLTNVGEAEYKNELMECTTSNCAC--TAVDCLCQDCIVHPTEIISIDKILLNG 329
           YI+QSG+PL+ +G       + + +     C  +A +C  QDC++HP EI+S++ I + G
Sbjct: 253 YIQQSGVPLSTIGNGRITFPIEQSSKDAFVCKYSAEECPIQDCLLHPAEILSLNHIFIYG 312

Query: 330 LLHMTLRRKTVIKFKNKLIPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMEL 389
           L+++ ++RK+VIKFK+KLIPS++WW  L  +   +      S DI  WF+ +I  +  E+
Sbjct: 313 LINVPIKRKSVIKFKHKLIPSKFWWHLLKEELPNMPHEQSASFDIFQWFEHIIETFNAEI 372

Query: 390 LDASDMESN 398
            + SD   N
Sbjct: 373 PNESDGSVN 381

 Score =  124 bits (311), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 89/141 (63%), Gaps = 10/141 (7%)

Query: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60
           MII+  EKY+C SCIRGHRSSTCKH+NRMLVKVRTRGRPS   +R VI+VD+SS++++  
Sbjct: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60

Query: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120
                +          ++     M +QP+LF+R   ++KA L++G L+I+++D+  +   
Sbjct: 61  HTEEDDQGQSPCCSSSASRSCTKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAF-- 118

Query: 121 GSSVSSKDNGNSKFIPEVEYL 141
                   +G  KF+ E +YL
Sbjct: 119 --------HGKYKFVSERDYL 131

>ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH]
           (501771..502826) [1056 bp, 351 aa]
          Length = 350

 Score =  157 bits (398), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 113/176 (64%), Gaps = 17/176 (9%)

Query: 234 VDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVG-EAEYKNEL 292
           V+ +T+KGVYLS+ CSC+D  C C NCLIHR E+EL+ +IRQSG+PLT+V  E     E 
Sbjct: 160 VEPYTYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEA 219

Query: 293 MECTT----------------SNCACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLR 336
             C                  ++CAC+ V C+C+DC +H  E++S++++LL+G+L+  L+
Sbjct: 220 GACCGDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLK 279

Query: 337 RKTVIKFKNKLIPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDA 392
           RK  I++K KLI S++WWD L  +    +E  LE++D++ WFD++I  +   L DA
Sbjct: 280 RKMSIQYKGKLINSKFWWDILYLQCAVAREPQLEALDLLQWFDNIIETHGAALPDA 335

 Score =  124 bits (311), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 96/148 (64%), Gaps = 26/148 (17%)

Query: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRI---- 56
           MII+  EKY+CA+CIRGHRS+TCKH++RMLVKVRTRGRPSP +IR VI+VD+ S++    
Sbjct: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMED 60

Query: 57  -DAKSSCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSA 115
            D +  C            D   +C + M+RQP+LF++   ++KA L++G L+I+++D A
Sbjct: 61  EDTEECC------------DGGKTCGK-MDRQPILFLKALKTQKALLVDGALKIMIEDRA 107

Query: 116 DSNEKGSSVSSKDNGNSKFIPEVEYLKQ 143
           +S+          +   KF+ E E+L Q
Sbjct: 108 NSDGV--------DKRFKFVTEKEFLLQ 127

>CAGL0M07590g 758940..760310 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c metal binding
           activator, start by similarity
          Length = 456

 Score =  147 bits (370), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 104/167 (62%), Gaps = 2/167 (1%)

Query: 230 KTPLVDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAE-- 287
           K P   L T +GVYLS+ CSC   NC C NCLIHR E+E+N+YI  SG+PLTN+  +   
Sbjct: 226 KYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDSSTSL 285

Query: 288 YKNELMECTTSNCACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKL 347
                +E    +C C   +C C  C +H  E++   +I+++GL++  L +KT+I+++ KL
Sbjct: 286 QATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYRKKL 345

Query: 348 IPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDASD 394
           I  +YWWD+ +     L+  + + +DI+G+FD++I ++  EL DA +
Sbjct: 346 IGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKE 392

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 70/126 (55%), Gaps = 25/126 (19%)

Query: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60
           MII+ ++KYAC  CIRGHRSS C HT RMLVKVR RGR    ++RD I+V    R   K 
Sbjct: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHR---KR 57

Query: 61  SCHSSNHQSKLAEGDDS------------------NSCSQNMERQPVLFVRVKDSKKARL 102
           SC  ++  +    GDDS                  NS    M +QP+LFVR K   KA+L
Sbjct: 58  SCECASGHA----GDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQL 113

Query: 103 LNGKLQ 108
           + G+L+
Sbjct: 114 IGGELK 119

>KLLA0E07733g 694992..696401 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c MAC1 metal binding
           activator singleton, start by similarity
          Length = 469

 Score =  133 bits (335), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/141 (49%), Positives = 95/141 (67%), Gaps = 8/141 (5%)

Query: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60
           MII+  EKY+C SCIRGHRSS+CKH+ RMLVKVRTRGRPSP +IR VI+VD +SR++   
Sbjct: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60

Query: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120
                N       GD+S  C   M +QPVLF+R   +KKA L+NG L+I+V  +++S   
Sbjct: 61  GSGQDN-----GAGDESQLCC-GMNKQPVLFLRAIATKKALLINGDLKIMV--TSESGTP 112

Query: 121 GSSVSSKDNGNSKFIPEVEYL 141
              V+ K + ++KF+ E E+L
Sbjct: 113 DYEVARKVSDDNKFVTEHEFL 133

 Score =  110 bits (275), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 102/179 (56%), Gaps = 17/179 (9%)

Query: 233 LVDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEA------ 286
           +V+LFT  G YLS+ CSC +    C NCLIHR E EL  Y+ +   P+ N+G A      
Sbjct: 207 VVELFTQNGAYLSTTCSCNENCQ-CNNCLIHREEAELERYLTELNQPMINLGSAQILTAD 265

Query: 287 ----EYKNELMECTTSN------CACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLR 336
               E   +     T +      C C    C C +C  HP E++++ ++LL G+L+   +
Sbjct: 266 SSQVEPSKDFFHGETDDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWK 325

Query: 337 RKTVIKFKNKLIPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDASDM 395
           +K VIK++NK+I S+YWW +L  +   + E  L S+D++ WFD+LI+ +  EL +A+D+
Sbjct: 326 KKMVIKYRNKVIHSKYWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPEANDL 384

>Scas_668.16
          Length = 291

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 38/58 (65%), Gaps = 5/58 (8%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT-----EIRDVIMVDSS 53
          MI+   EKYAC  CIRGHRSS+C H +R L K++ +GRPS T     E+R V  V+ S
Sbjct: 1  MIMLNGEKYACDLCIRGHRSSSCNHRDRQLTKLKPKGRPSTTCMHCKEMRKVKNVNPS 58

>Scas_710.11
          Length = 743

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 5/50 (10%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT-----EIR 45
          M++    KYAC  CIRGHR +TC HT++ L+ ++ +GRPS T     EIR
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCSYCKEIR 50

>YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent
          transcription factor responsible for induction of
          CUP1A, CUP1B, CRS5, and SOD1 [678 bp, 225 aa]
          Length = 225

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT 42
          M++    KYAC +CIRGHR++ C HT+  L  +R +GRPS T
Sbjct: 1  MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPSTT 42

>KLLA0A03047g 269553..271256 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 567

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT 42
          M++    KYAC  CIRGHR +TC HT++ L  ++ +GRPS T
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGRPSTT 42

>YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein that
          activates transcription of several genes including TPO2
          and YRO2, has homology to the copper-activated
          transcription factor Ace1p [2085 bp, 694 aa]
          Length = 694

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT 42
          M++    KYAC  CIRGHR +TC HT++ L+ ++ +GRPS T
Sbjct: 1  MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTT 42

>AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W
          (CUP2) - SH] (88054..89688) [1635 bp, 544 aa]
          Length = 544

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT 42
          M++    KYAC  CIRGHR +TC HT++ L+ ++ +GRPS T
Sbjct: 1  MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTT 42

>Kwal_14.1543
          Length = 599

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT 42
          M++    KYAC  CIRGHR +TC HT++ L+ ++ +GRPS T
Sbjct: 1  MVLVNGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTT 42

>CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 877

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPT 42
          M++    KYAC  CIRGHR +TC H+++ L+ ++ +GRPS T
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHSDQPLMMIKPKGRPSTT 42

>CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata
          metal-activated transcriptional activator, identified
          start
          Length = 265

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 1  MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60
          M++    KYAC SCI+ H+++ C+H +R L  ++ RGRP PT       +  +  ++   
Sbjct: 1  MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRP-PTTCDHCKDMRKTKNVNPSG 59

Query: 61 SCHSS 65
          SC+ S
Sbjct: 60 SCNCS 64

>KLLA0B11253g 984132..985544 weakly similar to sp|P53270
           Saccharomyces cerevisiae YGR117c hypothetical protein
           singleton, start by similarity
          Length = 470

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%)

Query: 267 DELNSYIRQSGIPLTNVGEAEY 288
           D L SY+R+SG+ +T+V + EY
Sbjct: 24  DSLASYLRESGVSMTSVKQTEY 45

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,382,327
Number of extensions: 464602
Number of successful extensions: 1612
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1610
Number of HSP's successfully gapped: 36
Length of query: 407
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 303
Effective length of database: 12,995,837
Effective search space: 3937738611
Effective search space used: 3937738611
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)