Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.423723712631e-179
CAGL0L11748g2362317183e-96
YER163C2322256793e-90
Sklu_879.22332266691e-88
KLLA0C11649g2382316533e-86
AFR184C2182294593e-57
KLLA0B03432g68456643.2
CAGL0G05335g89026617.5
AFR133C97042609.3
KLLA0E10120g87626609.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.4
         (237 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.4                                                            491   e-179
CAGL0L11748g complement(1252608..1253318) similar to sp|P32656 S...   281   3e-96
YER163C (YER163C) [1591] chr5 complement(503079..503777) Member ...   266   3e-90
Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement           262   1e-88
KLLA0C11649g complement(1005591..1006307) similar to sp|P32656 S...   256   3e-86
AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211) ...   181   3e-57
KLLA0B03432g 311810..313864 some similarities with sgd|S0006389 ...    29   3.2  
CAGL0G05335g 501279..503951 highly similar to sp|P31688 Saccharo...    28   7.5  
AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH] (675260..67...    28   9.3  
KLLA0E10120g complement(896599..899229) similar to sp|P31688 Sac...    28   9.6  

>Scas_576.4
          Length = 237

 Score =  491 bits (1263), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 237/237 (100%), Positives = 237/237 (100%)

Query: 1   MTIDTDETMQGLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRV 60
           MTIDTDETMQGLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRV
Sbjct: 1   MTIDTDETMQGLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRV 60

Query: 61  VTLIPYDEIVSRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVRE 120
           VTLIPYDEIVSRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVRE
Sbjct: 61  VTLIPYDEIVSRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVRE 120

Query: 121 QNGYTLHEVEVHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEA 180
           QNGYTLHEVEVHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEA
Sbjct: 121 QNGYTLHEVEVHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEA 180

Query: 181 IHDTAKVISTSRGPSGPNIEYLKLLHDSIEFMSDNELLPTSDIYLNKLLRQVDKINN 237
           IHDTAKVISTSRGPSGPNIEYLKLLHDSIEFMSDNELLPTSDIYLNKLLRQVDKINN
Sbjct: 181 IHDTAKVISTSRGPSGPNIEYLKLLHDSIEFMSDNELLPTSDIYLNKLLRQVDKINN 237

>CAGL0L11748g complement(1252608..1253318) similar to sp|P32656
           Saccharomyces cerevisiae YER163c, start by similarity
          Length = 236

 Score =  281 bits (718), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 172/231 (74%), Gaps = 7/231 (3%)

Query: 11  GLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEIV 70
           G+WVLGYGSLIYKPPPHY +RIPA IYGFMRRFWQSS+DHRGTPDSPGRVVTLIP+DEI+
Sbjct: 7   GIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLIPHDEIM 66

Query: 71  SRPEFSQDLKLYSPNFDDIKG--ANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHE 128
             P F QD   Y  + + I     NDL T+GVVYYIP + AD+VREYLDVREQNGYTLHE
Sbjct: 67  KTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQNGYTLHE 126

Query: 129 VEVHLNTT--GEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAK 186
           VEVHL+ T     ++ L   + +LP H  T K++L TNVYIGTV+NEAFVGPE I  TA 
Sbjct: 127 VEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPETIEQTAS 186

Query: 187 VISTSRGPSGPNIEYLKLLHDSIEFMSDNELLPTSDIYLNKLLRQVDKINN 237
           VI+T+ GPSG N +YL++L +S+  M   E    +D YL  L ++V++I +
Sbjct: 187 VIATNVGPSGTNFDYLRMLCESMASMKTCE---ETDKYLEHLFKEVNRIRD 234

>YER163C (YER163C) [1591] chr5 complement(503079..503777) Member of
           the ChaC-like protein family, has moderate similarity to
           uncharacterized C. albicans Orf6.7p [699 bp, 232 aa]
          Length = 232

 Score =  266 bits (679), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 134/225 (59%), Positives = 164/225 (72%), Gaps = 2/225 (0%)

Query: 11  GLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEIV 70
           G+WVLGYGSLIYKPP HY +RIPA I+GF RRFWQSS DHRGTP +PGRV TLIPY++I+
Sbjct: 7   GIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLIPYEDII 66

Query: 71  SRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHEVE 130
            +  F +++ LYS +   I+  +DL T+GVVYYIP E A +VREYL+VREQNGYTLHEVE
Sbjct: 67  RQTAFLKNVNLYSES-APIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYTLHEVE 125

Query: 131 VHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAKVIST 190
           VHL T  E E  L   L +LP HN++ KR+L T+VYIGT+ NEAFVGPE + +TAKVI+ 
Sbjct: 126 VHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETAKVIAV 185

Query: 191 SRGPSGPNIEYLKLLHDSIEFMS-DNELLPTSDIYLNKLLRQVDK 234
           S GPSG N EYL  L  ++  M    E    +D YL  LL  V+K
Sbjct: 186 SHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVNK 230

>Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement
          Length = 233

 Score =  262 bits (669), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 130/226 (57%), Positives = 165/226 (73%), Gaps = 5/226 (2%)

Query: 10  QGLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEI 69
           +G+WVLGYGSLIYKPPPHY++RIP  IYGF RRFWQSS DHRGTP SPGRV TLI YD+I
Sbjct: 5   KGIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIAYDDI 64

Query: 70  VSRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHEV 129
           V  P+F +DL  Y  +   ++ A DL+  GV YYIP ++A +V +YL+VREQ+GY++H V
Sbjct: 65  VKHPKFLKDLYHYKKS--KVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVHCV 122

Query: 130 EVHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAKVIS 189
           E+HL TT  QE+ L+  L  LP H+ T K +L++ VYIGTV NE+FVGPE I  TA +I+
Sbjct: 123 EIHLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASIIA 182

Query: 190 TSRGPSGPNIEYLKLLHDSIEFMS---DNELLPTSDIYLNKLLRQV 232
            S GPSGPN EYLKLLHDS+  ++    ++L    D YL+ LL  V
Sbjct: 183 DSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHV 228

>KLLA0C11649g complement(1005591..1006307) similar to sp|P32656
           Saccharomyces cerevisiae YER163c singleton, start by
           similarity
          Length = 238

 Score =  256 bits (653), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 161/231 (69%), Gaps = 5/231 (2%)

Query: 10  QGLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEI 69
           +G+WV+GYGSLIYKPPPH+KY++   +YGF RRFWQSSIDHRGTPDSPGRV TLIP+D I
Sbjct: 6   EGIWVVGYGSLIYKPPPHWKYKVNGIVYGFKRRFWQSSIDHRGTPDSPGRVATLIPFDGI 65

Query: 70  VSRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHEV 129
            +  EF +DL+ +  N   +   +DL  L V YYIP E A  V E+LDVRE+NGYT H +
Sbjct: 66  TNNAEFEKDLRTW--NSKVVAKQDDLKLLAVAYYIPPEHAQFVTEHLDVREKNGYTAHRI 123

Query: 130 EVHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAKVIS 189
            +HL     +   L+ +L KLP H  T K IL + VYIGT  NEAF+GPE I+ TAKVIS
Sbjct: 124 FIHLQPPKSEPLELQALLHKLPVHETTGKHILDSLVYIGTSDNEAFIGPEDINVTAKVIS 183

Query: 190 TSRGPSGPNIEYLKLLHDSIEFMSD---NELLPTSDIYLNKLLRQVDKINN 237
            + GPSGPN EYLKLLHDS+  M+D     L    D YL+ LL+Q +++ +
Sbjct: 184 HNLGPSGPNYEYLKLLHDSLTEMADELGQSLEEIEDSYLDSLLKQTEQLRS 234

>AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211)
           [657 bp, 218 aa]
          Length = 218

 Score =  181 bits (459), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 126/229 (55%), Gaps = 29/229 (12%)

Query: 11  GLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEIV 70
           G WV+GYGSLIYKPPPHY  R+   ++GF RRFWQSS DHRGTP+ PGRV TL+P     
Sbjct: 7   GAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLVP----- 61

Query: 71  SRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHEVE 130
                                A D   L V Y+IP      V  YLDVREQ+GY    V 
Sbjct: 62  ---------------------AADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVP 100

Query: 131 VHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAKVIST 190
           VHL    +    L+  L  LP  + +   ++++ +YIG      FVGPE +  TA VI+ 
Sbjct: 101 VHLVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAH 160

Query: 191 SRGPSGPNIEYLKLLHDSIEFMSDN---ELLPTSDIYLNKLLRQVDKIN 236
           + GPSGPN EYLKLLH ++  +++     L    D YL++LL  VD++ 
Sbjct: 161 NHGPSGPNYEYLKLLHSALHSIAETFGARLCELEDHYLDELLEAVDRLR 209

>KLLA0B03432g 311810..313864 some similarities with sgd|S0006389
           Saccharomyces cerevisiae YPR185w APG13 protein required
           for the autophagic process, hypothetical start
          Length = 684

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 184 TAKVISTSRGPSGPNIEYLKLLHDSIEF-MSDNELLPTSDIYLNKLLR-QVDKINN 237
           TAK   ++  P    +E++KLL D  E  M  N +LP  DI  N L+R Q  K NN
Sbjct: 403 TAKPRKSTENPPEDLLEFVKLLEDKKELNMKPNTILPQQDIS-NSLMRFQSMKSNN 457

>CAGL0G05335g 501279..503951 highly similar to sp|P31688
           Saccharomyces cerevisiae YDR074w TPS2 alpha,
           alpha-trehalose-phosphate synthase, hypothetical start
          Length = 890

 Score = 28.1 bits (61), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 17  YGSLIYKPPPHYKYRIPATIYGFMRR 42
           YGSL + P  HY  RIP  +Y  + R
Sbjct: 396 YGSLNFSPVQHYYMRIPKDVYLSLLR 421

>AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH]
           (675260..678172) [2913 bp, 970 aa]
          Length = 970

 Score = 27.7 bits (60), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 5/42 (11%)

Query: 152 FHNETKKRILKTNVYIG-----TVTNEAFVGPEAIHDTAKVI 188
           F    +K++ K+ V +G        ++A++ PE  HDT K +
Sbjct: 848 FQKNLRKKLTKSGVVLGDDFPSAAVSDAYLNPEVDHDTTKFV 889

>KLLA0E10120g complement(896599..899229) similar to sp|P31688
           Saccharomyces cerevisiae YDR074w TPS2 alpha,
           alpha-trehalose-phosphate synthase, 102 KD subunit,
           start by similarity
          Length = 876

 Score = 27.7 bits (60), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 17  YGSLIYKPPPHYKYRIPATIYGFMRR 42
           YG+L Y P  HY  RIP  +Y  + R
Sbjct: 384 YGNLNYSPVQHYYLRIPQDVYYSLLR 409

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,733,795
Number of extensions: 395254
Number of successful extensions: 963
Number of sequences better than 10.0: 19
Number of HSP's gapped: 955
Number of HSP's successfully gapped: 19
Length of query: 237
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 139
Effective length of database: 13,203,545
Effective search space: 1835292755
Effective search space used: 1835292755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)