Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.377977939460.0
YER162C (RAD4)75479319720.0
CAGL0L11726g82583319430.0
Kwal_56.2341772375014840.0
AGR162C76359013141e-170
KLLA0F14465g76757512981e-168
CAGL0H07293g6683561445e-09
YDR314C6922761411e-08
Sklu_2426.26644181142e-05
Kwal_27.12204368119790.18
ABR193W350119790.22
CAGL0H05753g348149731.1
Scas_579.838236702.8
Scas_665.30143944703.4
CAGL0J09526g107160684.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.3
         (779 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.3                                                           1524   0.0  
YER162C (RAD4) [1590] chr5 complement(500625..502889) Component ...   764   0.0  
CAGL0L11726g complement(1249886..1252363) similar to sp|P14736 S...   753   0.0  
Kwal_56.23417                                                         576   0.0  
AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH] (1049961..1...   510   e-170
KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736 Saccha...   504   e-168
CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces c...    60   5e-09
YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Membe...    59   1e-08
Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement          49   2e-05
Kwal_27.12204                                                          35   0.18 
ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH] complement(7...    35   0.22 
CAGL0H05753g complement(569862..570908) similar to tr|Q02890 Sac...    33   1.1  
Scas_579.8                                                             32   2.8  
Scas_665.30                                                            32   3.4  
CAGL0J09526g 931021..934236 similar to sp|P06777 Saccharomyces c...    31   4.8  

>Scas_576.3
          Length = 779

 Score = 1524 bits (3946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 742/779 (95%), Positives = 742/779 (95%)

Query: 1   MNDDLPKEYFELIRTALRNKKDEPQEERQLXXXXXXXXXXATSVPEKHEEQTTLDLSSPI 60
           MNDDLPKEYFELIRTALRNKKDEPQEERQL          ATSVPEKHEEQTTLDLSSPI
Sbjct: 1   MNDDLPKEYFELIRTALRNKKDEPQEERQLKKRKRRTRTTATSVPEKHEEQTTLDLSSPI 60

Query: 61  DKYSNTQLKSPERKEEHAGEASNSSNTEIQXXXXXXXXXXXXXXXXVTENNSTDENINDI 120
           DKYSNTQLKSPERKEEHAGEASNSSNTEIQ                VTENNSTDENINDI
Sbjct: 61  DKYSNTQLKSPERKEEHAGEASNSSNTEIQDEDDDDENYNSDDFEDVTENNSTDENINDI 120

Query: 121 SITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNSSKFI 180
           SITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNSSKFI
Sbjct: 121 SITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNSSKFI 180

Query: 181 VKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVACYMK 240
           VKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVACYMK
Sbjct: 181 VKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVACYMK 240

Query: 241 SWDEITTSTKPNSPFFLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNARLIMSCQPP 300
           SWDEITTSTKPNSPFFLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNARLIMSCQPP
Sbjct: 241 SWDEITTSTKPNSPFFLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNARLIMSCQPP 300

Query: 301 DITDLKEKCKPIDIDYDDMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPH 360
           DITDLKEKCKPIDIDYDDMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPH
Sbjct: 301 DITDLKEKCKPIDIDYDDMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPH 360

Query: 361 GVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLH 420
           GVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLH
Sbjct: 361 GVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLH 420

Query: 421 RRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGSKESGYLH 480
           RRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGSKESGYLH
Sbjct: 421 RRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGSKESGYLH 480

Query: 481 LQGXXXXXXXXXXXVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEE 540
           LQG           VYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEE
Sbjct: 481 LQGSKSKNKNKLLKVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEE 540

Query: 541 DEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPYAIKAAKFL 600
           DEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPYAIKAAKFL
Sbjct: 541 DEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPYAIKAAKFL 600

Query: 601 RINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKKLEEELESL 660
           RINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKKLEEELESL
Sbjct: 601 RINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKKLEEELESL 660

Query: 661 RCWHTLLSKLRIKKKLDVIYGTVGEENLNLGNVSDEDVAEGGGFFVPRTESFPEPNDSGT 720
           RCWHTLLSKLRIKKKLDVIYGTVGEENLNLGNVSDEDVAEGGGFFVPRTESFPEPNDSGT
Sbjct: 661 RCWHTLLSKLRIKKKLDVIYGTVGEENLNLGNVSDEDVAEGGGFFVPRTESFPEPNDSGT 720

Query: 721 DDNEDINTRGFLLTNKRETGDSNESTERNESLDRQSTNDDELEDDYDKFMGDLDMSDPE 779
           DDNEDINTRGFLLTNKRETGDSNESTERNESLDRQSTNDDELEDDYDKFMGDLDMSDPE
Sbjct: 721 DDNEDINTRGFLLTNKRETGDSNESTERNESLDRQSTNDDELEDDYDKFMGDLDMSDPE 779

>YER162C (RAD4) [1590] chr5 complement(500625..502889) Component of
           the nucleotide excision repairosome, homolog of human
           XPC xeroderma pigmentosum gene product [2265 bp, 754 aa]
          Length = 754

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/793 (50%), Positives = 512/793 (64%), Gaps = 58/793 (7%)

Query: 1   MNDDLPKEYFELIRTALRNKKDEPQEERQLXXXXXXXXXXATSVPEKHEEQTTLDLSSPI 60
           MN+DLPKEYFELIR AL    +E + E+               +P+  ++  T     P 
Sbjct: 1   MNEDLPKEYFELIRKAL----NEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPR 56

Query: 61  DKYSNTQLKSPERKEEHAGEASNSSNTEIQXXXXXXXXXXXXXXXXVTENNSTDENINDI 120
           +      L S +      G  +  ++  ++                VT+ N     + DI
Sbjct: 57  ESVVTVNLDSSD-----DGVVTVPTDDSVEEIQSSEEDYDSEEFEDVTDGNEV-AGVEDI 110

Query: 121 SITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNSSKFI 180
           S+ I+  +KRN    +T  +RNVCS E+R RR  FHM  L+CLMVHG++RNEW+NS +  
Sbjct: 111 SVEIKPSSKRNSDARRT--SRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLS 168

Query: 181 VKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVACYMK 240
            KLS LVPEKVF+LLHP KDEELPLRSTRKLLDGLKK MELW KHWKI +KY+    YM+
Sbjct: 169 RKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNEGLYMR 228

Query: 241 SWDEITTSTKPNSPF-FLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNARLIMSCQP 299
           +W EI  S      F  L +  F+R V KG GD DI+ QG+VA+LRACNVNARLIMSCQP
Sbjct: 229 TWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQP 288

Query: 300 PDITDLKEKCKPIDID------YDDMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVKH 353
           PD T++K     ID        Y DMVKYPIFWCEVWDKF+KKWIT+D +N   IEQV+ 
Sbjct: 289 PDFTNMK-----IDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRL 343

Query: 354 RSKLEPHGVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWFN 413
            SKL P GVACC+RN LRYVI YDRK GCRDVTRRYA+W N+K RK+RITK+  GE+WF 
Sbjct: 344 HSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFR 403

Query: 414 KVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGS 473
           KV+T LH RKRTKIDDYED Y  QRD  E +PD++QDLKNHPYY+LE D+++ Q++KPG 
Sbjct: 404 KVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGC 463

Query: 474 KESGYLHLQGXXXXXXXXXXXVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAMR 533
           KE GYL + G           VY +++I DLKSARQWYM GR+LKTGSR  K +KR   R
Sbjct: 464 KECGYLKVHG----KVGKVLKVYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGR 519

Query: 534 PSLDDEEDEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPYA 593
           P  + EE++ERLYS +DT LY+PPLA++ GEIT N +GNIEVF PTMIPGNCCL+E+P A
Sbjct: 520 PKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVA 579

Query: 594 IKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKKL 653
           IKAA+FL + +  AVT FKFERG T KP++ G+VVA W R+A+++ IDGIE+  ++D + 
Sbjct: 580 IKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRK 639

Query: 654 EEELESLRCWHTLLSKLRIKKKLDVIYGTVGEENLNLG---NVSDE----DVAEGGGFF- 705
           E  L +L  W+TLL KLRI+ KL+  YG + EE  N+    N++D     +   GGGF  
Sbjct: 640 EHLLGALESWNTLLLKLRIRSKLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLP 699

Query: 706 -VPRTESFPEPNDSGTDDNEDINTRGFLLTNKRETGDSNESTERNESLDRQSTNDDELED 764
            +   E+ P    S  +D+ D     ++  +K E                +S  DD++ +
Sbjct: 700 GIANHEARPYSEPSEPEDSLD-----YVSVDKAE----------------ESATDDDVGE 738

Query: 765 DYDKFMGDLDMSD 777
           DY  FM +L+MS+
Sbjct: 739 DYSDFMKELEMSE 751

>CAGL0L11726g complement(1249886..1252363) similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein, start by similarity
          Length = 825

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/833 (48%), Positives = 517/833 (62%), Gaps = 72/833 (8%)

Query: 2   NDDLPKEYFELIRTALRNKKDEPQEERQLXXXXXXXXXXATSVPEKHEEQTTLDLSSPID 61
           +D +P EYF+LIR  L+NK D  QE R L          +       E ++  +   P +
Sbjct: 3   SDQIPSEYFDLIRDVLKNKGDATQE-RPLKRRKRRRAVTS-------ELESGYENPQPTE 54

Query: 62  KYSNTQLKSPERKEEHAGEASNS----SNTEIQXXXXXXXXXXXXXXXXVTE--NNSTDE 115
                 L S    E+  G ASN+    S+ E+Q                  E  + S DE
Sbjct: 55  AKIVVNLDSDPELEDKLG-ASNTISLVSDGEVQHTEASEDGAESDEAYESEEFEDVSADE 113

Query: 116 N---INDISITIEDPTKRNEAKGKTAST-RNVCSREDRDRRYAFHMADLLCLMVHGYLRN 171
                +++S+TI    K +++K +++   +N+CS EDR  R   H   LLCLM HG++ N
Sbjct: 114 MQMPSDNLSVTINVNKKDSQSKKESSKIQKNMCSNEDRKFRTHMHCLYLLCLMCHGHIIN 173

Query: 172 EWLNSSKFIVKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQK 231
            WLN+SK   KLS ++PEKVF +LHP KDEELPLRSTRKLLDGLKK ME+W KHW+I+Q+
Sbjct: 174 HWLNNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQR 233

Query: 232 YEGVACYMKSWDEITTSTKPNSPFFLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNA 291
           Y+GV CYM+ WDE+    K      L+K  FI+ ++KG GDRD+A QG+VALLR+CNVNA
Sbjct: 234 YKGVNCYMRYWDELQICDKSRKT--LTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNA 291

Query: 292 RLIMSCQPPDITDLKEK-CKPIDIDYDDMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQ 350
           RL+MSCQPPD T+LK+       + Y+DM KYP+FWCEVWDKF+KKWITID      IEQ
Sbjct: 292 RLVMSCQPPDFTNLKKSYGTEKKVSYEDMTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQ 351

Query: 351 VKHRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEE 410
           V+  SK EP GV+ CKRN +RYVIG+DRK GCRD+TRRY +W+N+KTRKKRITKE  GE 
Sbjct: 352 VRLSSKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGER 411

Query: 411 WFNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLK 470
           W+ +VL +LH+RKRTKIDDYEDAY +QR+ DE MPDN+QD K HPYY+LE D+R+NQVLK
Sbjct: 412 WYERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLK 471

Query: 471 PGSKESGYLHLQGXXXXXXXXXXXVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRR 530
            G KE GYL L             VY +K+I+DLKSA+QWYMEGR+LKTG+R+LKTV+++
Sbjct: 472 SGCKECGYLKLHN----KTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKK 527

Query: 531 AMRPSLDDEEDEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIES 590
             R +  +E++EERLY  DDT LYV PLAT  GEI  N +GNIEVFVP+MIP NCCL+ES
Sbjct: 528 RGRFTDPEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVES 587

Query: 591 PYAIKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDND 650
           P AIKAA F+RI + +AVT FKFE+GR+ KP I GVVVA W+RDA+ + IDGI  +   +
Sbjct: 588 PVAIKAASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEE 647

Query: 651 KKLEEELESLRCWHTLLSKLRIKKKLDVIYGTVGEE------------------------ 686
           K +E ELE+L  WH L++KLRIK KL+  YG V EE                        
Sbjct: 648 KHIEHELEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDS 707

Query: 687 -----------------NLNLGNVSDEDVAEGGGFFVPRTESFPEPNDSGTDDNEDINTR 729
                              +    SD ++ E GGF    + S     D+   DNE +   
Sbjct: 708 GDEFPQGGFLPTDINHDGTSHNETSDNEIEEPGGFVPTNSNSSNANPDADYHDNEIVGNG 767

Query: 730 GFLLTNKRETGDSNESTERNESLDRQSTND-----DELEDDYDKFMGDLDMSD 777
           GF+ T  +      E  E  E  D     D       L++DY  FM +LDMS+
Sbjct: 768 GFITTRNQSPAGVTEYEEIKEPGDNLEPEDIDNQESHLDEDYKDFMDELDMSE 820

>Kwal_56.23417
          Length = 723

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/750 (42%), Positives = 452/750 (60%), Gaps = 83/750 (11%)

Query: 5   LPKEYFELIRTALRNKKDEPQE--------ERQLXXXXXXXXXXATSVPEKHEEQTTLDL 56
           LP+EYF+L+R A++  K  P+         E               S  +   + T+  L
Sbjct: 4   LPQEYFDLVRQAVKEDKQTPRRKRRRLPKYESNDISRPADVIINLDSDTDNETKFTSEGL 63

Query: 57  SSPIDKYSNTQLKSPERKEEHAGEASNSSNTEIQXXXXXXXXXXXXXXXXVTENNSTDEN 116
           S   +  SN  L     K         S+N                    V++ + +++ 
Sbjct: 64  SKSFESQSNRDLDDDNEK--------GSNNGGDYDDDDDDDEFNSDDFEDVSDADVSEQT 115

Query: 117 IN-DISITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLN 175
            N ++SIT+ +P K  +  G    ++N+ S E+R  R  FH+  L+ LMVHGY+RN+WLN
Sbjct: 116 SNAELSITL-NPQKPQKKTG----SKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLN 170

Query: 176 SSKFIVKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGV 235
            +K   KLSKLVP+ VF+LLHP +D+ELPLRSTRKLLDGLK+ ME+W KH+  + ++E  
Sbjct: 171 DAKLHQKLSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWETP 230

Query: 236 ACYMKSWDEITTSTKPNSPF-----FLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVN 290
             YM  WDE+      + P+     ++S+K F ++V  G+G  +IAAQG+VA+LRAC VN
Sbjct: 231 GLYMLDWDEL------DGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVN 284

Query: 291 ARLIMSCQPPDITDLKEKCK-----PID-IDYDDM-----------------VKYPIFWC 327
           ARLIM+ QPPD T+ K   +     P + +D  DM                  ++ +FWC
Sbjct: 285 ARLIMNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWC 344

Query: 328 EVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPHGVACCKRNNL-RYVIGYDRKNGCRDVT 386
           EVWDK +KKWIT+D M    IEQ+++++ L+P G A  KRNNL RY+I YDRK GCRDVT
Sbjct: 345 EVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSA--KRNNLFRYIIAYDRKLGCRDVT 402

Query: 387 RRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPD 446
           RRY   +N+KTRK+RIT++ +GE+W  +VL  LH+RKRT+ DD+EDAY  QRD  E +PD
Sbjct: 403 RRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPD 462

Query: 447 NLQDLKNHPYYILETDLRRNQVLKPGSKESGYLHLQGXXXXXXXXXXXVYERKNILDLKS 506
           N+QDLKNHPYY+L+ D + N+VLK G KE G+L  +            VY R+++L LK+
Sbjct: 463 NMQDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKN------NTSLKVYRREDVLVLKT 516

Query: 507 ARQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEEDEERLYSIDDTVLYVPPLATSDGEIT 566
           AR WY EGRVLK G+ +LKT K R  +     E  EERLY+ D+T L++P     + E+ 
Sbjct: 517 ARTWYTEGRVLKPGASALKTTKSRDFKTG---EATEERLYAFDETELFIPEDLGPNNEVP 573

Query: 567 PNAYGNIEVFVPTMIPGNCCLIESPYAIKAAKFLRINYGRAVTGFKFERGRTSKPIIGGV 626
            N YGNI+++  +MIP   CLIESP A+KAA  L I + +AVTGFKFE+ R +KP I G+
Sbjct: 574 TNVYGNIDIYTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGI 633

Query: 627 VVANWYRDAVKSCIDGIEYSVDNDKKLEEELESLRCWHTLLSKLRIKKKLDVIYGTVGEE 686
           VV+  YR+AV+S IDG+EYS++ D++ E ELE+L+ W+  L+KLRIK++L+  +G V   
Sbjct: 634 VVSQEYREAVESMIDGVEYSLEEDERQERELEALQHWNLFLAKLRIKQRLNTTHGKVSSA 693

Query: 687 NLN---------------LGNVSDEDVAEG 701
            ++               +G  SDE+  EG
Sbjct: 694 TVSTWDDNEPDQSDTSDGVGVGSDENTFEG 723

>AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH]
           (1049961..1052252) [2292 bp, 763 aa]
          Length = 763

 Score =  510 bits (1314), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 253/590 (42%), Positives = 371/590 (62%), Gaps = 22/590 (3%)

Query: 143 VCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNSSKFIVKLSKLVPEKVFQLLHPVKDEE 202
           V   E R  R +FHM  +  L+ H ++RN WLN  +   +L+ LVP++V+  +HP +DE+
Sbjct: 144 VVDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRLQSRLAALVPDEVYASMHPERDEQ 203

Query: 203 LPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVACYMKSWDEITTSTKPNSPFFLSKKQF 262
           LPLRSTRKLLD L+K M+LW KH K +   +G   YM+ W ++       +   L++K F
Sbjct: 204 LPLRSTRKLLDALRKCMKLWEKHCKRIIGRDG-GLYMRPWAQLGQRYSSGAAL-LTRKAF 261

Query: 263 IRQVIKGQG-DRDIAAQGYVALLRACNVNARLIMSCQPPDITDLKEKC------KPIDID 315
            R + KG    R +A +G+VALLR C +NARL+ S QPPD+TD+K          P D +
Sbjct: 262 NRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPPDLTDMKPAGDARGSDPPGDSE 321

Query: 316 YD-DMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPHGVACCKRNNLRYVI 374
            D D  ++P+ WCEVWD+++K WIT+D +   ++EQV+++SKLEP G    + N +RYV+
Sbjct: 322 DDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTG-KFARFNQMRYVV 380

Query: 375 GYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLHRRKRTKIDDYEDAY 434
           G+DRK GCRD+TRRY   YNAK R++RIT++  G  W++ +L  LH+RKR K DDYED Y
Sbjct: 381 GFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEY 440

Query: 435 LEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGSKESGYLHLQGXXXXXXXXXXX 494
             +RD  E +P+N+ DL+NHP+Y+LE DLR++++L+P +++ GY+  +            
Sbjct: 441 FARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATEQCGYVRFK-TTKRSAGSTLK 499

Query: 495 VYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEEDEERLYSIDDTVLY 554
           V+ R +I+   S R W+++G+VL+   R+ KTV  +  R     E +EERLY   +T  Y
Sbjct: 500 VFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVKDHRTG---ESEEERLYPESETEPY 556

Query: 555 VPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPYAIKAAKFLRINYGRAVTGFKFE 614
           VPP    DG I  N++GNI+++ P+MIP  C LIE+P A++AA F+ + + +AVTGF FE
Sbjct: 557 VPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAAFIGVPFAKAVTGFSFE 616

Query: 615 RGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKKLEEELESLRCWHTLLSKLRIKK 674
           RGRT KP   GVVV + YRDAV + IDGIE   D  +  E EL +L+ W  LL++LR+K+
Sbjct: 617 RGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQERELGALQSWALLLAQLRVKQ 676

Query: 675 KLDVIYGTVGEENLNLGNVSDEDVAEGGGFF-------VPRTESFPEPND 717
           +L   +G V E   +  +  +    E GGFF       VPR+     P++
Sbjct: 677 RLIDRHGAVSEHTSDSDSEPEASDTEAGGFFPDDSASPVPRSPPIRAPSE 726

>KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein singleton, start by similarity
          Length = 767

 Score =  504 bits (1298), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 272/575 (47%), Positives = 367/575 (63%), Gaps = 15/575 (2%)

Query: 116 NINDISITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLN 175
           N  +ISITI D + + ++  K   T +      ++ R   HM  LL L+ H Y RNEW N
Sbjct: 95  NNGNISITI-DTSAQKKSTKKKKKTEHGLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCN 153

Query: 176 SSKFIVKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKI--LQKYE 233
             K   KL+KLV + +F  LHP KD+E+PLRSTRKLLD L+  M+ WNK +K+     YE
Sbjct: 154 DEKLQKKLAKLVSDDIFNNLHPQKDDEMPLRSTRKLLDALRMLMKHWNKKFKLELTSPYE 213

Query: 234 GVACYMKSWDEITTSTKPNSPFFLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNARL 293
               YM  WD +      +  F   KK F R     +G  +I+ QG+V +LR C +NARL
Sbjct: 214 FNHLYMVHWDSVLKHKCESVTFKTFKKFFTRM----RGPANISVQGFVTMLRGCGLNARL 269

Query: 294 IMSCQPPDITDLKEKCKPIDIDYD-DMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVK 352
           I S QPPD TD K   K +    + + +KYPIFWCEVWDKFAK+WITID +   IIEQV+
Sbjct: 270 IHSLQPPDFTDSKIYNKRVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVR 329

Query: 353 HRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWF 412
           ++SKLEP G      N +RYVI +DRK GC+DV+RRY      K RKKRIT+E K  EWF
Sbjct: 330 YKSKLEPIGRINSAFNMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWF 389

Query: 413 NKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPG 472
           N ++  L++R R +IDDYED Y + R+  E +PD+LQD+KNHP+Y+LE DLR NQVLKPG
Sbjct: 390 NSIIKFLNKRNRNRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPG 449

Query: 473 SKESGYLHLQGXXXXXXXXXXXVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAM 532
           +++ G+L L+            V+ RK+++   SAR WYM+GR LK+G++ L T K   +
Sbjct: 450 AQQCGFLRLRN----KSNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLTHK---I 502

Query: 533 RPSLDDEEDEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPY 592
           +  ++++EDEERLY I  T   +P    +DG+I  N YGNI+++ P MIP  CCL+E+P 
Sbjct: 503 KNPVEEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPN 562

Query: 593 AIKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKK 652
           +IKAA FLR+ + +AVTGFKFE GR  KP + GVVV N Y DA+ + I+ IE   D+  +
Sbjct: 563 SIKAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAAR 622

Query: 653 LEEELESLRCWHTLLSKLRIKKKLDVIYGTVGEEN 687
            E ELE+L  W  LL+KLRIK +L   +G V +E+
Sbjct: 623 HELELEALNGWSLLLTKLRIKSRLVEEHGAVADED 657

>CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces
           cerevisiae YDR314c, hypothetical start
          Length = 668

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 82/356 (23%), Positives = 151/356 (42%), Gaps = 69/356 (19%)

Query: 370 LRYVIGYDRKN-GCRDVTRRYAE----WYNAKTRKKRI--TKEPKGEEWFNKVL--TTLH 420
            +YVI  D K+   RDV+ RY       Y  +TR   +  T++ K   +F +VL  T+ +
Sbjct: 340 FQYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETTRQSKSHHFFMRVLKSTSRY 399

Query: 421 RRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGSKESGYLH 480
           R   T +       +  ++Y   +P ++ +LK  P +     L++++ +   +K  G + 
Sbjct: 400 RNDNTVLM----KTIAAKNY--KLPKSISELKRSPNFKGLRILKQSETVSSKAKPVGKVQ 453

Query: 481 LQGXXXXXXXXXXXVYERKNILDLKSARQWYMEGRVLKTGSRSLKT----VKRRAMRPSL 536
             G           +Y   +IL LK+ + WY+ GR +K  ++ ++T    +++R    S 
Sbjct: 454 YGGKKDK-------IYRISDILPLKTRQHWYLLGRTVKEDAKPIRTKTIPLRKRNAISSA 506

Query: 537 DDEEDEERLYSIDDTVLYVPPLATS------------DGEITPNAYGNIEVFVPTMIPGN 584
            +      L+S + T L  P   +S            D +   N Y N+E++  ++IP  
Sbjct: 507 QELNFARELFSYEQTDL-TPKYPSSYKDVYGIYHVVCDVDFYKNKYKNVEIYSKSVIPTG 565

Query: 585 CCLIES---PYAIKAAKFLR-------------INYGRAVTGFKFERGRTSKPIIGGVVV 628
             L+ +    Y     + ++             I Y   V+GF F +G+ + PI   ++V
Sbjct: 566 FRLMRTFDKDYKFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFRKGQAT-PIKTHILV 624

Query: 629 ANW-YRDAVKSCIDGIEYSVDNDKKLEEELESLRCWHTLLSKLRIKKKLDVIYGTV 683
               YR  +    D I            EL  L  W   +++L+IK +L+  YG +
Sbjct: 625 NYMDYRKILSLQKDYI------------ELLRLESWSNFITRLKIKCELEDKYGKL 668

>YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Member
           of the DNA repair protein Rad4 family, has low
           similarity to uncharacterized C. albicans Orf6.3103p
           [2079 bp, 692 aa]
          Length = 692

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 117/276 (42%), Gaps = 47/276 (17%)

Query: 443 AMPDNLQDLKNHPYYILETDLRRNQVLKPGSKESGYLHLQGXXXXXXXXXXXVYERKNIL 502
            +P ++ ++K    +++ + L+ N+VLK  +K++                  ++ R++++
Sbjct: 433 TLPKSVTEIKRTDNFVIPSLLKSNEVLKACAKQAATF------TKGDNSQEPIFWRRDVI 486

Query: 503 DLKSARQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEEDE---ERLYSIDDTV------- 552
            LKS + W + GR +   ++ LK  K   MR  +    D+   + L+S + T+       
Sbjct: 487 QLKSKQHWAILGRSILPNAQPLKRKKYLPMRERMVRNLDKYVIKELFSYEQTMKSPKYPS 546

Query: 553 LYVPPLA----TSDGEITPNAYGNIEVFVPTMIPGNC------------CLIESPYAIKA 596
            Y   L      +D     N +GNIE++     P               CLI+  Y    
Sbjct: 547 TYCDHLGQEHVITDLSHYKNKFGNIEIYSKETKPDGFELIPLSKEVDIKCLIKE-YNKGK 605

Query: 597 AKFLRINYGRAVTGFKFERGR-TSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKKLEE 655
            K  +I Y   V+GF F++ +  + P I  ++V      AV+             K+  +
Sbjct: 606 RKMQKIKYLDVVSGFDFKQKKGHAIPKIESILVKETDYKAVQLL-----------KQQTK 654

Query: 656 ELESLRCWHTLLSKLRIKKKLDVIYGTVG--EENLN 689
            L  L  W  LL KLR+  +L+  YG VG  EE L+
Sbjct: 655 VLLGLSFWDILLRKLRVNDRLNAEYGNVGNNEETLD 690

>Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement
          Length = 664

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 94/418 (22%), Positives = 161/418 (38%), Gaps = 73/418 (17%)

Query: 316 YDDMVKYPIFW--CEVWDKF--AKKWITID----CMNFHIIEQVKHRSKLEPHGVACCKR 367
           YD  +  P FW  C+V D        + +D     M     E V H   L+   +   +R
Sbjct: 265 YDTDLLSPYFWIECKVRDDLYIIDPIVNVDQKRIVMKARADEYVPHIKPLDDLKINYTQR 324

Query: 368 NNLRYVIGYDRKNGCRDVTRRYAE-----WYNAKTRKKRITKEPKGEEWFNKVLTTLHRR 422
               Y++         DV+ RY +     ++N  +     +K  K    F K L      
Sbjct: 325 --FHYIVSIANDMHMMDVSPRYLDNICYRYFNTPSTVFSSSKPLKSSILFRKFLRKYGTI 382

Query: 423 KRTK-IDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPGSKESGYLHL 481
           +++K  +   D  L+    +  +P  L  +K    + + + L+ N+V+   ++  G    
Sbjct: 383 EKSKEYNSLVDLALQ----NYKIPKTLIGMKRSDNFTMPSLLKANEVISASTRPVGTF-- 436

Query: 482 QGXXXXXXXXXXXVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEED 541
                        VY +K+IL LKS + W + GR +K  +  +K+ K   M+        
Sbjct: 437 ----CRGQQTEEYVYWKKDILRLKSRQHWALLGRTVKMDAVPMKSKKVHTMK-----MRR 487

Query: 542 EERLYSIDDTVLYV--PPLAT------------SDGEIT-----PNAYGNIEVFVPTMIP 582
           E+RLY  +   LY     +AT              G IT      NA+G++E++   + P
Sbjct: 488 EKRLYMYEIRELYAFEQTIATPKMNNTYLTSVGGRGLITDVYHFKNAHGHVEIYNANLKP 547

Query: 583 GNCCLIESPYAIKAAKFLRINYGRAV-TGFKFERGRTSKP------------IIGGVVVA 629
                 E   A K  K L   Y R +  G  F + +   P            ++ G    
Sbjct: 548 DG---FEMFAATKETKLLIRQYNRDIRKGIGFLKDKYVVPKLQCLEPLKFLDVVSGFDFK 604

Query: 630 NWYRDAVKSCIDGIEYSVDNDKKLE------EELESLRCWHTLLSKLRIKKKLDVIYG 681
                AV   ++ I  + ++  +LE       EL++L  W  LL  L++K+++D  YG
Sbjct: 605 QTPGYAV-PVLNQILVNHNDFCRLELLIGQNRELQNLNYWQNLLQALQVKRRIDKQYG 661

>Kwal_27.12204
          Length = 368

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 326 WCEVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDV 385
           WCE +  F K+W+ +D            +S  EPH  +      + YVI ++    C DV
Sbjct: 226 WCEFYSTFLKRWVHVDAC---------EQSFDEPHIYSVNWNKKMSYVIAFE-PYSCVDV 275

Query: 386 TRRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAM 444
           ++RY         + ++ ++   E+    +L  + RR+R  + D E      RD  E +
Sbjct: 276 SKRY-------IIQNQLPRDQIKEDDLQFLLDMITRRQRMLLTDDEVYVQACRDEQERL 327

>ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH]
           complement(768355..769407) [1053 bp, 350 aa]
          Length = 350

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 17/119 (14%)

Query: 326 WCEVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDV 385
           WCEV+    K+W+ +D            +S  EPH  +      + YVI +  ++  +DV
Sbjct: 212 WCEVYSNALKRWVHVDSC---------EKSFDEPHIYSVNWNKAMSYVIAFSNRS-VKDV 261

Query: 386 TRRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAM 444
           +RRY      + R  R   +    ++  K LT L    R ++ D E   L  RD  EA+
Sbjct: 262 SRRYI----VRNRLPRDQIDEDDLQFLTKYLTKL---LRLQLPDEERYLLHCRDELEAI 313

>CAGL0H05753g complement(569862..570908) similar to tr|Q02890
           Saccharomyces cerevisiae YPL096w PNG1, hypothetical
           start
          Length = 348

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 24/149 (16%)

Query: 326 WCEVWDKFAKKWITIDCMNFHIIEQVKHRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDV 385
           WCE +  + K+WI +D            +S  EP   +     ++ Y IG+ R  G  DV
Sbjct: 206 WCEYYSPYLKRWIHVDSC---------EQSFDEPFIYSKNWNKSMSYCIGFWRY-GVVDV 255

Query: 386 TRRYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMP 445
           ++RY         + ++ ++   E+    +   L +R RT + D E   +  R       
Sbjct: 256 SKRY-------ILQNQLPRDIIKEDDLQFLCHALTKRLRTGLSDDESYKMYCR------- 301

Query: 446 DNLQDLKNHPYYILETDLRRNQVLKPGSK 474
           D+L+ L+ +P      ++++ ++ K G+K
Sbjct: 302 DDLEQLELNPSATPTKEMQKLKISKTGNK 330

>Scas_579.8
          Length = 382

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 686 ENLNLGNVSDEDVAEGGGFFVP-RTESFPEPNDSGT 720
           E L+LGNV+D D   G G F+P   ES   PND  T
Sbjct: 344 EELSLGNVNDND--NGDGTFIPSHNESLNRPNDDVT 377

>Scas_665.30
          Length = 1439

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 24/44 (54%)

Query: 420 HRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDL 463
           H++  T    Y+  YL+ + +++  P N+ DL    +YI E DL
Sbjct: 36  HKKTTTSGGGYQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDL 79

>CAGL0J09526g 931021..934236 similar to sp|P06777 Saccharomyces
           cerevisiae YPL022w RAD1 component of the nucleotide
           excision repairosome, start by similarity
          Length = 1071

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 357 LEPHGVACCKRNN----LRYVIG-YDRKNGCRDVTRRYAEWYNAK-TRKKRITKEPKGEE 410
           +E   +  C  N     LR VI  YD + G R++     EWY  K   +KRI ++ K EE
Sbjct: 501 IEGSTLIVCNNNTTVLQLRRVISKYDNEFGMRNIMLSKLEWYKMKREERKRIVRDFKKEE 560

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,183,530
Number of extensions: 1265128
Number of successful extensions: 5961
Number of sequences better than 10.0: 87
Number of HSP's gapped: 6055
Number of HSP's successfully gapped: 93
Length of query: 779
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 669
Effective length of database: 12,788,129
Effective search space: 8555258301
Effective search space used: 8555258301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)