Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.234933510651e-145
YER161C (SPT2)3333043687e-41
CAGL0L11704g3363053172e-33
Kwal_56.234133153052312e-21
AGR161C3373171979e-17
KLLA0F14487g3021381171e-06
YLR105C (SEN2)37772710.73
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.2
         (349 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.2                                                            414   e-145
YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like c...   146   7e-41
CAGL0L11704g complement(1248417..1249427) similar to sp|P06843 S...   126   2e-33
Kwal_56.23413                                                          94   2e-21
AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH] (1048663..1...    80   9e-17
KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843 Saccha...    50   1e-06
YLR105C (SEN2) [3520] chr12 complement(347048..348181) tRNA spli...    32   0.73 

>Scas_576.2
          Length = 349

 Score =  414 bits (1065), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 221/335 (65%), Positives = 221/335 (65%)

Query: 1   MSFLSKLSQLXXXXXXXXXXXXXXXXXIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60
           MSFLSKLSQL                 IPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL
Sbjct: 1   MSFLSKLSQLKKASTTNTSMKNTSKESIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60

Query: 61  RRKEQIKNGEFAKKHXXXXXXXXXXXXXXXDDDNLAADGYSRFKKKLGSTHTRPTPVRTL 120
           RRKEQIKNGEFAKKH               DDDNLAADGYSRFKKKLGSTHTRPTPVRTL
Sbjct: 61  RRKEQIKNGEFAKKHKKTNPSTTTKRKSKKDDDNLAADGYSRFKKKLGSTHTRPTPVRTL 120

Query: 121 TRKMEPIKKISFDELMKQXXXXXXXXXXXXXXXXXXXXXASRPHLHKPGFRSARDRNRVS 180
           TRKMEPIKKISFDELMKQ                     ASRPHLHKPGFRSARDRNRVS
Sbjct: 121 TRKMEPIKKISFDELMKQAENNASSKESSEGISKKESPSASRPHLHKPGFRSARDRNRVS 180

Query: 181 KPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLPVAQPNQRLKQRLESKRQRPSGXXX 240
           KPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLPVAQPNQRLKQRLESKRQRPSG   
Sbjct: 181 KPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLPVAQPNQRLKQRLESKRQRPSGRDR 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXVHRRMKLHRDDPGYDRDEIWAMFNKGRKRSXXXX 300
                                     VHRRMKLHRDDPGYDRDEIWAMFNKGRKRS    
Sbjct: 241 YGRPEYDYDDEDDMDDFIEDDEEDSEVHRRMKLHRDDPGYDRDEIWAMFNKGRKRSEYAY 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXXDKREAAW 335
                                       DKREAAW
Sbjct: 301 DEEEDDMEANEMEILEEEERAEEMARLEDKREAAW 335

>YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like
           chromatin protein that interacts with Snf1p through a
           conserved domain, negative regulator of HO gene
           transcription [1002 bp, 333 aa]
          Length = 333

 Score =  146 bits (368), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 114/304 (37%), Positives = 149/304 (49%), Gaps = 35/304 (11%)

Query: 1   MSFLSKLSQLXXXXXXXXXXXXXXXXXIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60
           MSFLSKLSQ+                 +P+K   E    SLLP NYIRDEDPAV+RLKEL
Sbjct: 1   MSFLSKLSQIRKSTTASKAQVQDP---LPKKNDEEY---SLLPKNYIRDEDPAVKRLKEL 54

Query: 61  RRKEQIKNGEFAKKHXXXXXXXXXXXXXXX----DDDNLAADGYSRFKKKLGSTHTRPTP 116
           RR+E +KNG  AKK                    +DD+    G  RFK+ +G++H    P
Sbjct: 55  RRQELLKNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGI-RFKRSIGASHAPLKP 113

Query: 117 VRTLTRKMEPIKKISFDELMKQXXXXXXXXXXXXXXXXXXXXXASRPHLHKPGFRSARDR 176
           V  + +K EPIKK+SF+ELMKQ                       RPH +KPGF+S++  
Sbjct: 114 V--VRKKPEPIKKMSFEELMKQAENNEKQPPKVKSSEPVTK---ERPHFNKPGFKSSK-- 166

Query: 177 NRVSKPVKHQTTLPRKKMSLSPIRNRPGSRDA-TPIKISLPV---AQPNQRLKQRLESKR 232
            R  K      TL      +S   N   S D+  P+K++LP    AQPN+RLK++LES++
Sbjct: 167 -RPQKKASPGATL----RGVSSGGNSIKSSDSPKPVKLNLPTNGFAQPNRRLKEKLESRK 221

Query: 233 QRPSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHRRMKLHRDDPGYDRDEIWAMFNKG 292
           Q+                                 H + K H + PGYDRDEIWAMFN+G
Sbjct: 222 QK-------SRYQDDYDEEDNDMDDFIEDDEDEGYHSKSK-HSNGPGYDRDEIWAMFNRG 273

Query: 293 RKRS 296
           +KRS
Sbjct: 274 KKRS 277

>CAGL0L11704g complement(1248417..1249427) similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein, start by similarity
          Length = 336

 Score =  126 bits (317), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 143/305 (46%), Gaps = 40/305 (13%)

Query: 1   MSFLSKLSQLXXXXXXXXXXXXXXXXXIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60
           MSFLSKLS+L                  P+K + +E+I SLLP NY+R+EDPAV RLKEL
Sbjct: 1   MSFLSKLSELKKTKPKTVISP-------PQKANKQEEI-SLLPKNYVREEDPAVTRLKEL 52

Query: 61  RRKEQIKNGEFAKKHXX------XXXXXXXXXXXXXDDDNLAADGYSRFKKKLGSTHTRP 114
           RR+E +KN E AKK                       DDN+     SRFK+K+GS   +P
Sbjct: 53  RRQELLKNPELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLV---SRFKRKVGS--DKP 107

Query: 115 TPVRTLTRKMEPIKKISFDELMKQXXXXXXX-XXXXXXXXXXXXXXASRPHLHKPGFRSA 173
                + +K +PIKK+SF+ELMKQ                           L+KPGF+++
Sbjct: 108 AVPIQVKKKPQPIKKLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKTS 167

Query: 174 RDRNRVSKPVKH-QTTLPRKKMSLSPIRNRPGSRDATPIKISLP-VAQPNQRLKQRLESK 231
           R ++    P  H   T   K  S +  ++ P       +KI +P  AQPN+RLK++LE  
Sbjct: 168 RPKSL--SPTTHINKTDHGKDKSTAKEKSEP------VVKIGIPKFAQPNERLKKKLEM- 218

Query: 232 RQRPSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHRRMKLHRDDPGYDRDEIWAMFNK 291
           RQR                                 +   +    DPGYDRDEIWAMFNK
Sbjct: 219 RQR---------VNKSRRYEDEEDDMDDFIEDDEEEYSSYRTTSKDPGYDRDEIWAMFNK 269

Query: 292 GRKRS 296
           GRKRS
Sbjct: 270 GRKRS 274

>Kwal_56.23413
          Length = 315

 Score = 93.6 bits (231), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/305 (29%), Positives = 130/305 (42%), Gaps = 55/305 (18%)

Query: 1   MSFLSKLSQLXXXXXXXXXXXXXXXXXIPRKKSIEED----IPSLLPTNYIRDEDPAVRR 56
           MSFL+K SQL                   +    +ED      SLLP  Y+R+EDPA+RR
Sbjct: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIRR 60

Query: 57  LKELRRKEQIKNGEFAKKHXXXXXXXXXXXXXXXDDDNLAADGYSRFKKKLGSTHTRPTP 116
           LKELRRKEQ+KN    K                   D  +A+  ++F++K+G +     P
Sbjct: 61  LKELRRKEQLKNAPKNKPAAPSRKRK----------DENSANTETKFRRKVGESLQSRKP 110

Query: 117 VRTLTRKMEPIKKISFDELMKQXXXXXXX-XXXXXXXXXXXXXXASRP--HLHKPGFRSA 173
           V  + R   P+KK+SFDELMK+                       + P   L +PGF+SA
Sbjct: 111 VAPVKRT--PLKKLSFDELMKEAEEKSKNPSTDPIDSTSRSKALQNNPPVRLQRPGFKSA 168

Query: 174 --RDRNRVSKPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLPVAQPNQRLKQRLES- 230
             RDR  +S P      + ++K  +  ++  P  R +        +AQP  +LK++LE+ 
Sbjct: 169 ARRDRKPLSTP-----KITKQKSPVESLQRLPAPRPS--------IAQPGAKLKRKLENL 215

Query: 231 KRQRPSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHRRMKLHRDDPGYDRDEIWAMFN 290
           K+ R +                                          G++RDEIWAMFN
Sbjct: 216 KKHRQTDRYRSSEEEDMDDFIEDDEEEQ--------------------GFNRDEIWAMFN 255

Query: 291 KGRKR 295
           KG+KR
Sbjct: 256 KGKKR 260

>AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH]
           (1048663..1049676) [1014 bp, 337 aa]
          Length = 337

 Score = 80.5 bits (197), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 89/317 (28%), Positives = 130/317 (41%), Gaps = 59/317 (18%)

Query: 1   MSFLSKLSQLXXXXXXXXXXXXXXXXXIPRKKSIEEDIPSL------LPTNYIRDEDPAV 54
           MSFL+KLSQL                    K + +ED PSL      LP  Y+R EDPA+
Sbjct: 1   MSFLAKLSQLKKSTTSSTDTGSG------SKATKKEDNPSLDFKSPILPEYYVRKEDPAI 54

Query: 55  RRLKELRRKEQIKNGEFAKKHXXXXXXXXXXXXXXXDDDNLAADGYSRFKKKLGSTHTR- 113
           RRLKE RR+EQ++ G   K                 +   +A+ G     ++ GST  + 
Sbjct: 55  RRLKEKRRQEQLRKGTLKK--------ASSQRRSKANGGEVASGGV----RQEGSTRWKL 102

Query: 114 PTPVRTLT---RKMEPIKKISFDELMKQXXXXXXXXXXXXXXXXXXXXXASRPHLHKPGF 170
           P P  T+        P+KK+SF+ELMKQ                     A  P + KPGF
Sbjct: 103 PRPKSTVVAAAAPAPPLKKLSFEELMKQAEEKAKSPAASGKRTAPAGPSA--PAVSKPGF 160

Query: 171 R------SARDRNRVSKPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLP----VAQP 220
           +      +A    +V+   K        + + +P   R G +    I I LP    +A+P
Sbjct: 161 KPRSNSGAAVVGGKVAGADKGARNGGADRTAHAPNSAR-GMKAKQAIAIDLPSGGGLAKP 219

Query: 221 NQRLKQRLE--SKRQRPSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHRRMKLHRDDP 278
           N++L++ LE   +R+R +G                                         
Sbjct: 220 NEKLRRILEKQERRKRSAGEYEEDDSDLDDFIADDDGEEEGGSY---------------- 263

Query: 279 GYDRDEIWAMFNKGRKR 295
           GYD++EIW++FNKGR+R
Sbjct: 264 GYDKEEIWSIFNKGRRR 280

>KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein singleton, start by
           similarity
          Length = 302

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 64/138 (46%), Gaps = 18/138 (13%)

Query: 1   MSFLSKLSQLXXXXXXXXXXXXXXXXXIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60
           MSFL+KL QL                     +S E+    LLP +Y+R+ DPA++RLKE 
Sbjct: 1   MSFLAKLQQLKQTTKINEPNHSANQNKAKSLQSEEK----LLPKDYVREVDPAIQRLKEA 56

Query: 61  RRKEQIKNGEFAKKHXXXXXXXXXXXXXXXDDDNLAADGYSRFKKKLG-STHTRPTPVRT 119
           RR   +K G  +                  D+  +       +KKK G +T +   PV  
Sbjct: 57  RR---LKQG-ISSTSTKPAAKARHKASSPKDEAPI-------YKKKPGVNTTSGKYPV-- 103

Query: 120 LTRKMEPIKKISFDELMK 137
           +  K EPIKK+SFDELMK
Sbjct: 104 VVPKREPIKKLSFDELMK 121

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (93%)

Query: 280 YDRDEIWAMFNKGRKR 295
           YDRDEIW++FNKG KR
Sbjct: 232 YDRDEIWSIFNKGSKR 247

>YLR105C (SEN2) [3520] chr12 complement(347048..348181) tRNA
           splicing endonuclease, beta subunit, has active site for
           5' splice site cleavage [1134 bp, 377 aa]
          Length = 377

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 164 HLHKPGFRSARDRNRVSKPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLPVAQPNQR 223
           +L   GF      +R S+P     T  R  ++ +P+ NR G++  T  +++L      +R
Sbjct: 74  YLWNNGFFGTGQFSR-SEPTWKARTEARLGLNDTPLHNRGGTKSNTETEMTLEKVTQQRR 132

Query: 224 LKQRLESKRQRP 235
           L QRLE K++R 
Sbjct: 133 L-QRLEFKKERA 143

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,574,964
Number of extensions: 245515
Number of successful extensions: 756
Number of sequences better than 10.0: 8
Number of HSP's gapped: 749
Number of HSP's successfully gapped: 14
Length of query: 349
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 246
Effective length of database: 13,030,455
Effective search space: 3205491930
Effective search space used: 3205491930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)