Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_576.0d48948921620.0
CAGL0I08613g55947417370.0
KLLA0C11913g52947915810.0
Kwal_56.2339053348115490.0
AGR155C49541510091e-132
Kwal_55.221736591991264e-07
CAGL0K03157g7242011202e-06
YHL016C (DUR3)735201970.001
Kwal_14.803693146810.076
KLLA0C17468g723119800.097
KLLA0C18909g692134780.17
ABR043W686141750.49
Kwal_26.8136721119740.56
KLLA0E15400g106978721.2
CAGL0H08778g106575711.3
KLLA0F28083g698140692.5
Sklu_2444.8695134664.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_576.0d
         (489 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_576.0d                                                           837   0.0  
CAGL0I08613g complement(839912..841591) weakly similar to sp|P33...   673   0.0  
KLLA0C11913g complement(1024233..1025822) similar to ca|CA4263|I...   613   0.0  
Kwal_56.23390                                                         601   0.0  
AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp...   393   e-132
Kwal_55.22173                                                          53   4e-07
CAGL0K03157g 290552..292726 highly similar to sp|P33413 Saccharo...    51   2e-06
YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permeas...    42   0.001
Kwal_14.803                                                            36   0.076
KLLA0C17468g complement(1532768..1534939) similar to sp|P33413 S...    35   0.097
KLLA0C18909g complement(1676552..1678630) similar to ca|CA4384|C...    35   0.17 
ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH] complement(4...    33   0.49 
Kwal_26.8136                                                           33   0.56 
KLLA0E15400g 1365717..1368926 gi|4809179|gb|AAD30128.1|AF136181_...    32   1.2  
CAGL0H08778g 854147..857344 some similarities with tr|Q12221 Sac...    32   1.3  
KLLA0F28083g complement(2594274..2596370) similar to ca|CA5245|C...    31   2.5  
Sklu_2444.8 , Contig c2444 22738-24825 reverse complement              30   4.8  

>Scas_576.0d
          Length = 489

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/489 (87%), Positives = 427/489 (87%)

Query: 1   TISLLNTVKRKMGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPL 60
           TISLLNTVKRKMGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPL
Sbjct: 1   TISLLNTVKRKMGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPL 60

Query: 61  AFNFVASGLGCGVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVL 120
           AFNFVASGLGCGVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVL
Sbjct: 61  AFNFVASGLGCGVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVL 120

Query: 121 TEWVFHRFGLICGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTI 180
           TEWVFHRFGLICGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTI
Sbjct: 121 TEWVFHRFGLICGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTI 180

Query: 181 YTSIGGFNISFITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVY 240
           YTSIGGFNISFITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVY
Sbjct: 181 YTSIGGFNISFITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVY 240

Query: 241 ILTFAIFTNDFFMSGFWLRTFASRSDKDLMIGCSXXXXXXXXXXXXXXXXXXXAVWAGLV 300
           ILTFAIFTNDFFMSGFWLRTFASRSDKDLMIGCS                   AVWAGLV
Sbjct: 241 ILTFAIFTNDFFMSGFWLRTFASRSDKDLMIGCSVACVILVVFCTVVGVTGFIAVWAGLV 300

Query: 301 QVADEENSGAAFFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLH 360
           QVADEENSGAAFFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLH
Sbjct: 301 QVADEENSGAAFFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLH 360

Query: 361 IMWXXXXXXXXXXXXXXXXXXAENVLNIYXXXXXXXXXXXXXXXXGFWSKFDDLWTAWEV 420
           IMW                  AENVLNIY                GFWSKFDDLWTAWEV
Sbjct: 361 IMWVRGIVVLIMVPVVVVGLIAENVLNIYLIVDLLSSSVVPVLVLGFWSKFDDLWTAWEV 420

Query: 421 XXXXXXXXXSVWIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFI 480
                    SVWIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFI
Sbjct: 421 IGGGLGGILSVWIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFI 480

Query: 481 LVIRLICVR 489
           LVIRLICVR
Sbjct: 481 LVIRLICVR 489

>CAGL0I08613g complement(839912..841591) weakly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3, hypothetical
           start
          Length = 559

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/474 (71%), Positives = 376/474 (79%)

Query: 12  MGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFVASGLGC 71
           MG LS   A+AIIWPTY VLLI+AS +AYWKRDSK+FLS+NGTQKA+PLAFNFVASGLGC
Sbjct: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60

Query: 72  GVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLI 131
           GVLS YPQIAN+DGLHGLLVYA++GGLPMFVFA+LGPLIRKKTP GFVLTEWVFHRFGL+
Sbjct: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120

Query: 132 CGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISF 191
           CGWYLSACTILTVYLFLVSEVASLKY I+T+T I +LPVIIIECVVTTIYTSIGGF+ISF
Sbjct: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180

Query: 192 ITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDF 251
           +TD LQVS VF+LL+IVA AMGS I IDR LIGPSGLLK NKLGWQLVYILT AIFTNDF
Sbjct: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240

Query: 252 FMSGFWLRTFASRSDKDLMIGCSXXXXXXXXXXXXXXXXXXXAVWAGLVQVADEENSGAA 311
           FMSGFWLRTFASRS+KDL+IGCS                   AVWAGL+   D+ENSGAA
Sbjct: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSGAA 300

Query: 312 FFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWXXXXXXXX 371
           F++LLAQLP+W++GFT+VFV VLSTCTLDSLQSALVSTISNDVFRN+LHIM         
Sbjct: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVVAI 360

Query: 372 XXXXXXXXXXAENVLNIYXXXXXXXXXXXXXXXXGFWSKFDDLWTAWEVXXXXXXXXXSV 431
                     A++VL+IY                G W K D++W+AWEV          V
Sbjct: 361 MVPVVVVGLIAQDVLSIYLIVDLLSSSVVPVLVVGLWGKLDEIWSAWEVIGGGCAGILGV 420

Query: 432 WIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFILVIRL 485
           WIFGTVYYHSA+EGGRLLLISNGLY DDW  FGAFVVAPG GLV S  IL IRL
Sbjct: 421 WIFGTVYYHSAKEGGRLLLISNGLYADDWGAFGAFVVAPGAGLVCSVIILAIRL 474

>KLLA0C11913g complement(1024233..1025822) similar to
           ca|CA4263|IPF2277 Candida albicans unknown function,
           start by similarity
          Length = 529

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/479 (64%), Positives = 362/479 (75%), Gaps = 3/479 (0%)

Query: 12  MGILSAVTANAIIWPTYMVLLISASAIAYWK--RDSKSFLSSNGTQKALPLAFNFVASGL 69
           MG +S   A+ I+WPTY+V+L+ AS +A+WK     K+FLS+NGTQ+ +PLAFNFVAS L
Sbjct: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60

Query: 70  GCGVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFG 129
           GCGVLSAYPQIANIDGL GLLVY+++G LPMF+FA+ GP+IRKK P GFVLTEWV  RFG
Sbjct: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120

Query: 130 LICGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNI 189
           +ICGWYLSACTI+T++LF+VSE+ASLKY IE++T IKALPVII+ECVVTTIYTSIGGF+I
Sbjct: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180

Query: 190 SFITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTN 249
           SFITD +QVS VF+LLIIV+CAMGSY+ ID+SLI  SGLLK + LGWQLVYILT AIFTN
Sbjct: 181 SFITDTIQVSIVFILLIIVSCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240

Query: 250 DFFMSGFWLRTFASRSDKDLMIGCSXXXXXXXXXXXXXXXXXXXAVWAGLVQVADEENSG 309
           DFFMSGFWLRTFA+R+DKDLMIGCS                   AVWAG + VAD+ENSG
Sbjct: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300

Query: 310 AAFFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWXXXXXX 369
           AAFFI+L Q+P WV+GF + FV +LSTCTLDSLQSALVSTISND+FRN+L I+W      
Sbjct: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRGIVV 360

Query: 370 XXXXXXXXXXXXAENVLNIYXXXXXXXXXXXXXXXXGFWSKFDDLWTAWEVXXXXXXXXX 429
                       A++VL IY                G  SKFD L TAWE+         
Sbjct: 361 LIMVPVVVVGLIADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFL-TAWEIIGGGFGGLL 419

Query: 430 SVWIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFILVIRLICV 488
           SVWIFGTVYY S REGG+LLLI NGLY DDW+ FGAFVVAP GGL+F  F+L +R I V
Sbjct: 420 SVWIFGTVYYDSPREGGKLLLIWNGLYADDWAAFGAFVVAPFGGLIFGFFVLFVRTIIV 478

>Kwal_56.23390
          Length = 533

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/481 (61%), Positives = 364/481 (75%), Gaps = 9/481 (1%)

Query: 12  MGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFVASGLGC 71
           MG LS   A+ IIWP Y VLL++A A+AYWK+D+K+FLS+NGTQK +PLAFNFVAS LG 
Sbjct: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60

Query: 72  GVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLI 131
           GV S YPQIANI GLHGLLVYA++GGLPMF+FA+ GP+IRKK P GFVLTEWVFHR+G++
Sbjct: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120

Query: 132 CGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISF 191
            G YLSACTILT++LF+VSE+ASLK+CIE++T+IKALPV+I+ECV+TTIYT++GGF+ISF
Sbjct: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180

Query: 192 ITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDF 251
           +TD +QVS VFV+L+IVACAMG+YIEID S IGPSGLLKQNKLGWQLVYIL  AIFTNDF
Sbjct: 181 LTDTMQVSVVFVILVIVACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240

Query: 252 FMSGFWLRTFASRSDKDLMIGCSXXXXXXXXXXXXXXXXXXXAVWAGLVQVADEENSGAA 311
           F+SGFWLRTFA+R+DKDL+IGCS                   AVWAGLV+VAD+E  G++
Sbjct: 241 FLSGFWLRTFAARTDKDLLIGCSLAFAVLVAIVALIGVTGFLAVWAGLVEVADQELGGSS 300

Query: 312 FFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWXXXXXXXX 371
           FFILL  +P+WVMGF + F+T+LSTCTLDSLQSA+VSTISND+FRN+L +++        
Sbjct: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRGLVALI 360

Query: 372 XXXXXXXXXXAENVLNIYXXXXXXXXXXXXXXXXGFWSKFDDLWTAWEVXXXXXXXXXSV 431
                     AE+VL+I+                G WS+   L +AWE+         +V
Sbjct: 361 MVPVVVVGLIAEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFL-SAWEIVGGGLGGIFAV 419

Query: 432 WIFGTVYYHSAREGGRLLLISNGL--------YVDDWSTFGAFVVAPGGGLVFSGFILVI 483
           WIFGTVYY S REGGRLLL+SNGL        Y +DWS FGAFVVAP GG++    IL +
Sbjct: 420 WIFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILAL 479

Query: 484 R 484
           R
Sbjct: 480 R 480

>AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp,
           495 aa]
          Length = 495

 Score =  393 bits (1009), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/415 (53%), Positives = 290/415 (69%), Gaps = 3/415 (0%)

Query: 6   NTVKRKMGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFV 65
           +T   +MG LS V ANAI+WPTY V+L  AS +AY  R+ ++FLS+NGTQKA+PLA NF+
Sbjct: 56  HTDGTEMGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFI 115

Query: 66  ASGLGCGVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVF 125
           ASGLGCGVL AYPQ+AN+ GL GLLVY ++  LPM+VFA+ GPLI++  P GFVLTEWV 
Sbjct: 116 ASGLGCGVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVL 175

Query: 126 HRFGLICGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIG 185
            RFG +   YLSACTILT+YLF+VSE+ SL+  ++ ++ IK +PV++++CVVTTIYT+IG
Sbjct: 176 RRFGRVAALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPVVVVQCVVTTIYTAIG 235

Query: 186 GFNISFITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFA 245
           GF+ISF+TD LQ + V +L+++ A A+G+ ++ID + IGPSGLL+ ++LGWQLVYILT A
Sbjct: 236 GFHISFVTDSLQATVVLLLVVVGAVAVGTSVKIDPARIGPSGLLRPSRLGWQLVYILTVA 295

Query: 246 IFTNDFFMSGFWLRTFASRSDKDLMIGCSXXXXXXXXXXXXXXXXXXXAVWAGLVQVADE 305
           IFTNDFFMSGFWLRTFA+RS++DL++GCS                   AVWAG   VAD 
Sbjct: 296 IFTNDFFMSGFWLRTFAARSNRDLLLGCSLAAVLLAVVLLLVGVTGLLAVWAGYAPVADL 355

Query: 306 ENSGAAFFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWXX 365
           ++  A+FF+LLA LP W  G  +  V VLSTCTLDS QSALVSTISND+FRNRL  ++  
Sbjct: 356 DS--ASFFLLLAALPAWANGVVLALVVVLSTCTLDSFQSALVSTISNDLFRNRLPPLYAR 413

Query: 366 XXXXXXXXXXXXXXXXAENVLNIYXXXXXXXXXXXXXXXXGFWSKFDDLWTAWEV 420
                           A ++L IY                GFW +   L +AWE+
Sbjct: 414 AAVAVVMVPVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARL-SAWEL 467

>Kwal_55.22173
          Length = 659

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 98/199 (49%), Gaps = 33/199 (16%)

Query: 81  ANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFG------LICGW 134
           A + G+ G  +YA+ G + + +FA+L   I+++ P    ++E ++ RFG       +C  
Sbjct: 79  AYLHGISGAWLYAVGGTIQITLFAFLALQIKQRAPSAHTVSEMLYVRFGKSGHIMYLC-- 136

Query: 135 YLSACTILTVYLFLV--SEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISFI 192
           Y +A  ++   L L+  S+  +    + T+     LP+ ++      +YT++GG   +FI
Sbjct: 137 YCAATNVMVSSLLLLGGSQAFAAATGMHTVAASFLLPLNVV------VYTALGGLKATFI 190

Query: 193 TDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDFF 252
           +D++    ++V+L+         +  + SLIG  G +      W+L+     A  ++   
Sbjct: 191 SDWVHTVIIYVILLTTCYT----VYCNSSLIGSPGKM------WELLKDAQVAFPSS--- 237

Query: 253 MSGFWLRTFASRSDKDLMI 271
            SG   +++ S  DKD+++
Sbjct: 238 -SG---KSYLSFKDKDMIL 252

>CAGL0K03157g 290552..292726 highly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c Urea active
           transporter, start by similarity
          Length = 724

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 18/201 (8%)

Query: 15  LSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFVASGLGCGVL 74
           L  V A  +I  TYM+       I      ++ F ++  T K   +A   V+S + C  L
Sbjct: 20  LGTVFAVGMILTTYMLRRYQKEIIT-----AEEFTTAGRTVKTGLVAAAVVSSWIWCSTL 74

Query: 75  --SAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLI- 131
             SA  Q+   DG+ G   Y+      +  FA L    ++K P      E V  R+G I 
Sbjct: 75  LTSASKQL---DGMLGGYSYSAGACFQIVAFAILAIKTKQKAPNAHTYLELVRKRYGKIG 131

Query: 132 -CGW--YLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFN 188
            C +  Y  A  IL   + L S  A      E+MT + ++    +  V   IYT  GG  
Sbjct: 132 HCCYLFYAFATNILVTAMLLTSGAA----VFESMTGMNSVASCFLLPVGVVIYTLFGGIK 187

Query: 189 ISFITDFLQVSTVFVLLIIVA 209
            +F+TDF+    + V++++ A
Sbjct: 188 ATFLTDFIHTCVIIVIIMVFA 208

>YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permease,
           member of the solute:sodium symporter (SSS) family of
           membrane transporters [2208 bp, 735 aa]
          Length = 735

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 86/201 (42%), Gaps = 17/201 (8%)

Query: 15  LSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFVASGLGCGVL 74
           L AV A  ++  TY++       I      ++ F ++  + K   +A   V+S + C  L
Sbjct: 20  LGAVFAGMMVLTTYLLKRYQKEIIT-----AEEFTTAGRSVKTGLVAAAVVSSWIWCSTL 74

Query: 75  SAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLI--- 131
                    DG+ G   YA      +  FA L    ++  P      E V  R+G I   
Sbjct: 75  LTSSTKEYADGIFGGYAYAAGACFQIIAFAILAIKTKQMAPNAHTYLELVRTRYGKIGHG 134

Query: 132 CGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKA---LPVIIIECVVTTIYTSIGGFN 188
           C  + +  T + V   L++  +++   +  M TI +   LPV ++      +YT  GG  
Sbjct: 135 CYLFYAIATNILVTSMLLTSGSAVFSDLTGMNTIASCFLLPVGVV------VYTLFGGIK 188

Query: 189 ISFITDFLQVSTVFVLLIIVA 209
            +F+TD++    + +++++ A
Sbjct: 189 ATFLTDYMHTCVIIIIVLVFA 209

>Kwal_14.803
          Length = 693

 Score = 35.8 bits (81), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 65/146 (44%), Gaps = 29/146 (19%)

Query: 102 VFAWLGPLIRKKTPKGFVLTEWVFHRFGLICGWYLSACTILTVYLFLVSEVASLKYCIET 161
           V A LG   +KK PKG    E V  R+G        +  IL ++L LV+ + S    I  
Sbjct: 107 VMALLGIHAKKKIPKGHTCLEIVHLRYG-------KSTHILYMFLCLVNNLLSTSAMI-- 157

Query: 162 MTTIKALPVII--IECVVTTI--------YTSIGGFNISFITDFLQVSTVFVLLIIVACA 211
           +    A+ +I   +  V +T+        YT +GG   +F+TD++       +L+ +  A
Sbjct: 158 LAAAGAISIICGDLHIVASTMLIPFGVMAYTVVGGLKATFLTDYVHSLIALAILVYINTA 217

Query: 212 MGSYIEIDRSLIGPSG-----LLKQN 232
           +     I+   IG  G     +LKQ+
Sbjct: 218 V-----INSEHIGGIGGLYDLVLKQD 238

>KLLA0C17468g complement(1532768..1534939) similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3 urea transport
           protein singleton, start by similarity
          Length = 723

 Score = 35.4 bits (80), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 55/119 (46%), Gaps = 12/119 (10%)

Query: 85  GLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLI---CGWYLSACTI 141
           G+ G   YA   G  + +F+ L    +++ P      E +  R+G I   C  + +  T 
Sbjct: 85  GISGGYFYAAGAGYQVILFSALAIKCKQRAPNAHTYLEIIKARYGTIGHFCYMFYALATN 144

Query: 142 LTVYLFLVSEVASLKYCIETMTTIKA---LPVIIIECVVTTIYTSIGGFNISFITDFLQ 197
           + V   L++  +++   +  M T+ A   LPV ++      +YT  GG   +F+TD++ 
Sbjct: 145 VLVTAMLLTGGSAVVSDLTGMHTVAACFLLPVGVV------LYTIFGGIKATFLTDYVH 197

>KLLA0C18909g complement(1676552..1678630) similar to
           ca|CA4384|CaDUR34 Candida albicans Urea transport
           protein (by homology), start by similarity
          Length = 692

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 56/134 (41%), Gaps = 22/134 (16%)

Query: 85  GLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFG-----------LICG 133
           G+ G   YA+ G + + VF+ +   ++          E  + RFG           ++C 
Sbjct: 83  GISGSYFYAVGGLIQVSVFSIVASKVKANANLVTTFPEAGYLRFGNAGHLAFLWCGMVCN 142

Query: 134 WYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISFIT 193
             +SAC +L          A++   I  M T  AL ++ + C    IY   GG   +FI+
Sbjct: 143 TIVSACILLGG--------AAVINAITGMNTYAALYLLPLVC---AIYVYFGGLRATFIS 191

Query: 194 DFLQVSTVFVLLII 207
           D L    + V LII
Sbjct: 192 DALHTFPLLVFLII 205

>ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH]
           complement(474297..476357) [2061 bp, 686 aa]
          Length = 686

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 59/141 (41%), Gaps = 14/141 (9%)

Query: 85  GLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGL------ICGWYLSA 138
           G+ G   YA    + + +F+ L    +++ P      E +  R+G       +C   ++ 
Sbjct: 85  GVSGPFYYAAGACVQIILFSTLAIKCKQRAPNAHTFLEIIKARYGRKAHILHMCYALVTN 144

Query: 139 CTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISFITDFLQV 198
             + T+ L   S V S    + T      LPV +I      IYT  GG   +F+TD+  V
Sbjct: 145 VLVTTMLLTGGSAVVSELTGMHTAAACFLLPVGVI------IYTLFGGIKATFLTDY--V 196

Query: 199 STVFVLLIIVACAMGSYIEID 219
            TV ++ II+      Y   D
Sbjct: 197 HTVIIVGIILTFTFSVYRTSD 217

>Kwal_26.8136
          Length = 721

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 12/119 (10%)

Query: 85  GLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGL---ICGWYLSACTI 141
           G+ G   Y       +  FA L    +++ P      E +  R+G    IC  + +  T 
Sbjct: 85  GISGGYYYGAGACFQIIAFATLAIKAKQRAPNAHTFLEIINARYGKAAHICYMFYALATN 144

Query: 142 LTVYLFLVSEVASLKYCIETMTTIKA---LPVIIIECVVTTIYTSIGGFNISFITDFLQ 197
           + V   L++  +++   +  M T+ A   LP+ +I      IYT  GG   +F+TD++ 
Sbjct: 145 ILVTAMLLTGGSAVVNDLTGMDTVAACFLLPLGVI------IYTLFGGIKATFLTDYVH 197

>KLLA0E15400g 1365717..1368926 gi|4809179|gb|AAD30128.1|AF136181_1
           Kluyveromyces lactis potassium transporter, start by
           similarity
          Length = 1069

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 172 IIECV--VTTIYTSIG------GFNISFITDFLQVST-VFVLLIIVACAMGSYIEIDRSL 222
           + +C+  V + Y ++G      G N SF   F  +S  V + ++I     G    +DR++
Sbjct: 782 VFQCLFEVVSAYGTVGLSLGYPGSNQSFSGQFTTISKLVIIAMLIRGRHRGLPYTLDRAI 841

Query: 223 IGPSGLLKQNKLGWQLVY 240
           I PS  LK+N L  +L +
Sbjct: 842 ILPSAKLKENDLLHELTH 859

>CAGL0H08778g 854147..857344 some similarities with tr|Q12221
           Saccharomyces cerevisiae YPR042c PUF2 or sp|P47135
           Saccharomyces cerevisiae YJR091c JSN1, hypothetical
           start
          Length = 1065

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 130 LICGWYLSACTILTVYLFLVSEVASLKYCIE-------TMTTIKALPVIIIECVVTTIYT 182
           L+  WYL +CT    Y  ++S +  + + +E       ++T +K L + I +CV  +I T
Sbjct: 782 LLVTWYLDSCTFEEKYAMIISSL--IPHIVELCSHRLGSLTVLKLLNLRIDQCVKDSILT 839

Query: 183 SI-GGFNISFITDFL 196
           +I G  N +  ++ L
Sbjct: 840 AIFGDLNDNKPSENL 854

>KLLA0F28083g complement(2594274..2596370) similar to
           ca|CA5245|CaDUR32 Candida albicans Urea transport
           protein (by homology), start by similarity
          Length = 698

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 23/140 (16%)

Query: 102 VFAWLGPLIRKKTPKGFVLTEWVFHRFGLICGWYLSACTILTVYLFLVSEVASLKYCIET 161
           + A LG   +KK P G    E V  R+G        +  IL +++ LV+ + S    I  
Sbjct: 107 LMALLGIQAKKKIPNGHTCLEIVELRYG-------KSAHILYMFMCLVNNLLSSSSMI-- 157

Query: 162 MTTIKALPVII--IECVVTTI--------YTSIGGFNISFITDFLQVSTVFVLLIIVACA 211
           + +  A+ +I   +  V +T+        YT +GG   +F+TD++      ++L+    A
Sbjct: 158 LGSAAAISIISGNLHIVASTMLIPFGVMCYTVVGGLKATFLTDYMHSLIALIILVYFNTA 217

Query: 212 MGSYIEIDRSLIGPSGLLKQ 231
           + S  +I     G SGL  +
Sbjct: 218 VISSDKIG----GISGLYDK 233

>Sklu_2444.8 , Contig c2444 22738-24825 reverse complement
          Length = 695

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 54/134 (40%), Gaps = 22/134 (16%)

Query: 85  GLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFG-----------LICG 133
           G+ G  +YA+ G + + VF+ +   ++          E  F RFG           ++C 
Sbjct: 83  GVSGGYLYAVGGFIQVSVFSVVASKVKANANLVTTFPEAGFLRFGALGHLSFLWCGIVCN 142

Query: 134 WYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISFIT 193
             +SAC +L          A++   +  M    AL ++   C    IY   GG   +FI+
Sbjct: 143 TIVSACILLGG--------AAVINALTGMNIYAALYLLPFVC---AIYVYFGGLRATFIS 191

Query: 194 DFLQVSTVFVLLII 207
           D      + V LII
Sbjct: 192 DASHTFPLLVFLII 205

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.141    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,667,845
Number of extensions: 454937
Number of successful extensions: 1256
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1258
Number of HSP's successfully gapped: 23
Length of query: 489
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 383
Effective length of database: 12,926,601
Effective search space: 4950888183
Effective search space used: 4950888183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)