Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_569.4*1101105961e-81
YDR045C (RPC11)1101105571e-75
CAGL0H08415g1001005031e-67
Kwal_27.109391101105032e-67
KLLA0F18568g1121124911e-65
AGR029W1121124851e-64
Sklu_2357.91021024353e-57
KLLA0F09361g292351165e-08
KLLA0D03234g1221111073e-07
Scas_621.15307351103e-07
CAGL0D06160g306351095e-07
YGL043W (DST1)309351096e-07
Sklu_2213.5287351087e-07
AGR011W304351088e-07
Kwal_26.7521301351078e-07
Kwal_27.9972125431048e-07
Sklu_2119.4125451031e-06
AFR417W1251301021e-06
YJR063W (RPA12)125451022e-06
Scas_673.30*148451013e-06
CAGL0F00561g128451003e-06
Kwal_56.24054122110977e-06
KLLA0B13860g16043987e-06
YGL070C (RPB9)122110932e-05
CAGL0H03509g122114924e-05
Scas_720.22*122110915e-05
AFL088W122110872e-04
Sklu_1830.311049740.011
Scas_544.7d17379620.91
AFR518C43665583.3
ABL041W81848583.5
CAGL0M05027g74238575.5
KLLA0D10758g85029566.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_569.4*
         (110 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_569.4*                                                           234   1e-81
YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA polyme...   219   1e-75
CAGL0H08415g 824631..824933 highly similar to sp|Q04307 Saccharo...   198   1e-67
Kwal_27.10939                                                         198   2e-67
KLLA0F18568g complement(1708319..1708657) highly similar to sp|Q...   193   1e-65
AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH] complement...   191   1e-64
Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement      172   3e-57
KLLA0F09361g complement(864425..865303) similar to sp|P07273 Sac...    49   5e-08
KLLA0D03234g 270311..270679 highly similar to sp|P27999 Saccharo...    46   3e-07
Scas_621.15                                                            47   3e-07
CAGL0D06160g complement(580707..581627) highly similar to sp|P07...    47   5e-07
YGL043W (DST1) [1934] chr7 (417485..418414) Transcription elonga...    47   6e-07
Sklu_2213.5 YGL043W, Contig c2213 7532-8395                            46   7e-07
AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH] complement(...    46   8e-07
Kwal_26.7521                                                           46   8e-07
Kwal_27.9972                                                           45   8e-07
Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement         44   1e-06
AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH] complement...    44   1e-06
YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I s...    44   2e-06
Scas_673.30*                                                           44   3e-06
CAGL0F00561g complement(58585..58971) highly similar to sp|P3252...    43   3e-06
Kwal_56.24054                                                          42   7e-06
KLLA0B13860g 1215461..1215943 some similarities with sp|P32529 S...    42   7e-06
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    40   2e-05
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    40   4e-05
Scas_720.22*                                                           40   5e-05
AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH] complement(...    38   2e-04
Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement         33   0.011
Scas_544.7d                                                            28   0.91 
AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp...    27   3.3  
ABL041W [551] [Homologous to ScYMR089C (YTA12) - SH] complement(...    27   3.5  
CAGL0M05027g 544448..546676 similar to sp|Q05029 Saccharomyces c...    27   5.5  
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...    26   6.8  

>Scas_569.4*
          Length = 110

 Score =  234 bits (596), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%)

Query: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWD 60
           MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWD 60

Query: 61  NVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           NVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN
Sbjct: 61  NVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110

>YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination [333 bp, 110 aa]
          Length = 110

 Score =  219 bits (557), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 101/110 (91%), Positives = 103/110 (93%)

Query: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWD 60
           MLSFCP CNNMLLIT+ DSGVYTL CRSCPYEFPIEGIEIYDRK LPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD 60

Query: 61  NVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           NVDQTK QCPNY+ CGGESAYFFQLQIRSADEPMTTFYKCVNC HRWKEN
Sbjct: 61  NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN 110

>CAGL0H08415g 824631..824933 highly similar to sp|Q04307
           Saccharomyces cerevisiae YDR045c RPC11, start by
           similarity
          Length = 100

 Score =  198 bits (503), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 95/100 (95%)

Query: 11  MLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWDNVDQTKVQCP 70
           MLL+ T+D+GVY L+CRSCPYEFPIE IEIYDRK LPRKEVDDVLGGGWDNVDQTKVQCP
Sbjct: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60

Query: 71  NYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           NY+ CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN
Sbjct: 61  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 100

>Kwal_27.10939
          Length = 110

 Score =  198 bits (503), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 99/110 (90%)

Query: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWD 60
           MLSFCP C+NML+++ A+SG Y L C SCPY FPIEG+E+YDRKTLPRKEVDDVLGGGWD
Sbjct: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWD 60

Query: 61  NVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           NVDQT VQCPNY++C GE AYFFQLQIRSADEPMTTFYKCV+C +RW+EN
Sbjct: 61  NVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110

>KLLA0F18568g complement(1708319..1708657) highly similar to
           sp|Q04307 Saccharomyces cerevisiae YDR045c RPC11 RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination singleton, start
           by similarity
          Length = 112

 Score =  193 bits (491), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 87/112 (77%), Positives = 98/112 (87%), Gaps = 2/112 (1%)

Query: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGG--G 58
           MLSFCPLCNNMLL++ ADSG+Y L C SCPY+F I+GIE+YDRK LPRKEVDDVLGG   
Sbjct: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60

Query: 59  WDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           WDNVDQT  QCPN+++C GE AYFFQLQIRSADEPMTTFYKCVNC H+W+EN
Sbjct: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWREN 112

>AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH]
           complement(768240..768578) [339 bp, 112 aa]
          Length = 112

 Score =  191 bits (485), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 88/112 (78%), Positives = 95/112 (84%), Gaps = 2/112 (1%)

Query: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGG--G 58
           MLSFCP CNNML ++  DSGVY L C SCPYEFPIEG+EIYDR+ LPRKEVDDVLGG   
Sbjct: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60

Query: 59  WDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           WDNVDQT VQCP +E CGGE AYFFQLQIRSADEPMTTFYKCV C H+W+EN
Sbjct: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 112

>Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement
          Length = 102

 Score =  172 bits (435), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 2/102 (1%)

Query: 11  MLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGG--GWDNVDQTKVQ 68
           MLLI T D+G+Y L C SCPYEFPIEGIE+YDRKTL RKEVDDVLGG   WDNVDQT  Q
Sbjct: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60

Query: 69  CPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           CPN++ CGG  AYFFQLQIRSADEPMTTFYKCV C H+W+EN
Sbjct: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102

>KLLA0F09361g complement(864425..865303) similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS
           (transcription elongation factor) singleton, start by
           similarity
          Length = 292

 Score = 49.3 bits (116), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (68%)

Query: 74  KCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108
           KC      ++QLQ RSADEP+TTF  C NC +RWK
Sbjct: 256 KCKQRKVSYYQLQTRSADEPLTTFCTCENCGNRWK 290

>KLLA0D03234g 270311..270679 highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9 DNA-directed RNA
           polymerase II, 14. 2 KD subunit singleton, start by
           similarity
          Length = 122

 Score = 45.8 bits (107), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 48/111 (43%), Gaps = 13/111 (11%)

Query: 2   LSFCPLCNNMLLITTADSGVYTL--TCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG--- 56
             FC  CNNML     D   + L   CR+CPY     G  +  R  L +  + +  G   
Sbjct: 4   FRFCRDCNNMLY-PREDKETHKLLFECRTCPY-VEEAGTPLVYRHEL-KTNIGETAGVVQ 60

Query: 57  --GGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 105
             G    + ++  +CP   KC      FFQ Q R  D  M  FY C++C+H
Sbjct: 61  DIGSDPTLPRSDKECP---KCHSRENVFFQSQQRRKDTSMVLFYVCLHCSH 108

>Scas_621.15
          Length = 307

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (68%)

Query: 74  KCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108
           KC  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 271 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 305

>CAGL0D06160g complement(580707..581627) highly similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS, start by
           similarity
          Length = 306

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (68%)

Query: 74  KCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108
           KC  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 270 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 304

>YGL043W (DST1) [1934] chr7 (417485..418414) Transcription
           elongation factor S-II, a DNA strand transfer protein
           catalyzing homologous DNA strand exchange [930 bp, 309
           aa]
          Length = 309

 Score = 46.6 bits (109), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (68%)

Query: 74  KCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108
           KC  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 273 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

>Sklu_2213.5 YGL043W, Contig c2213 7532-8395
          Length = 287

 Score = 46.2 bits (108), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (68%)

Query: 74  KCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108
           KC  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 251 KCKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 285

>AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH]
           complement(737606..738520) [915 bp, 304 aa]
          Length = 304

 Score = 46.2 bits (108), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (68%)

Query: 74  KCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108
           KC  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 268 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 302

>Kwal_26.7521
          Length = 301

 Score = 45.8 bits (107), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (68%)

Query: 74  KCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 108
           KC  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 265 KCKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 299

>Kwal_27.9972
          Length = 125

 Score = 44.7 bits (104), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 68  QCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           +CP   +CG +  ++  LQ+RSADE  T FY C +C +R++ N
Sbjct: 85  KCP---QCGNDEMHYHTLQLRSADEGATVFYTCTSCGYRFRTN 124

>Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement
          Length = 125

 Score = 44.3 bits (103), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 66  KVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           K +CP   +CG +   +  LQ+RSADE  T FY C +C +R++ N
Sbjct: 83  KEKCP---QCGNDEMRYHTLQLRSADEGATVFYTCTSCGYRFRTN 124

>AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH]
           complement(1184595..1184972) [378 bp, 125 aa]
          Length = 125

 Score = 43.9 bits (102), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 55/130 (42%), Gaps = 33/130 (25%)

Query: 2   LSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEV-----DDVL- 55
           L FC  C N+L   +A +G + + C  C  +        YD+ T    +V     DD   
Sbjct: 7   LIFCVYCGNLLDNPSAVAGDH-VACALCDAQ--------YDKATFSNLKVVTATADDAFP 57

Query: 56  ---------------GGGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKC 100
                           G  ++    + +CP   +CG +   +  LQ+RSADE  T FY C
Sbjct: 58  SALRAKRSVVKTTLRKGELEDGATIREKCP---QCGHDEMQYHTLQLRSADEGATVFYTC 114

Query: 101 VNCAHRWKEN 110
            +C +R++ N
Sbjct: 115 TSCGYRFRTN 124

>YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I
           subunit A12.2 [378 bp, 125 aa]
          Length = 125

 Score = 43.9 bits (102), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 66  KVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           K +CP   +CG E   +  LQ+RSADE  T FY C +C ++++ N
Sbjct: 83  KEKCP---QCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTN 124

>Scas_673.30*
          Length = 148

 Score = 43.5 bits (101), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 66  KVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           K +CP   +CG +  ++  LQ+RSADE  T FY C  C ++++ N
Sbjct: 106 KEKCP---QCGNDEMHYHTLQLRSADEGATVFYTCTKCGYKFRTN 147

>CAGL0F00561g complement(58585..58971) highly similar to sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, start by similarity
          Length = 128

 Score = 43.1 bits (100), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 66  KVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           K +CP   KCG +   +  LQ+RSADE  T FY C+ C ++++ N
Sbjct: 86  KEKCP---KCGHDEMRYQTLQLRSADEGATVFYTCIKCNYKYRTN 127

>Kwal_56.24054
          Length = 122

 Score = 42.0 bits (97), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 45/110 (40%), Gaps = 11/110 (10%)

Query: 2   LSFCPLCNNMLL-ITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG---- 56
             FC  CNNML      D+      CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKDNQRLLFECRTCTYAEEAGTPMVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 105
            G    + ++  +CP   KC      FFQ Q R +D  M  F+ C+ C+H
Sbjct: 62  IGSDPTLPRSDRECP---KCHSHENVFFQSQQRRSDTSMVLFFVCLGCSH 108

>KLLA0B13860g 1215461..1215943 some similarities with sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, 13. 7 KD subunit singleton, hypothetical
           start
          Length = 160

 Score = 42.4 bits (98), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 68  QCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110
           +CP   KC  +  ++  LQ+RSADE  T FY C  C +R++ N
Sbjct: 120 KCP---KCANDKMHYHTLQLRSADEGATVFYTCTACGYRFRTN 159

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 40.4 bits (93), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 11/110 (10%)

Query: 2   LSFCPLCNNMLL-ITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG---- 56
             FC  CNNML      ++      CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 105
            G    + ++  +CP   KC      FFQ Q R  D  M  F+ C++C+H
Sbjct: 62  IGSDPTLPRSDRECP---KCHSRENVFFQSQQRRKDTSMVLFFVCLSCSH 108

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 40.0 bits (92), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 45/114 (39%), Gaps = 19/114 (16%)

Query: 2   LSFCPLCNNMLL-ITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG---- 56
             FC  CNNML      ++      CR+C Y      IE      + R E+   +G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSY------IEEAGSPLVYRHELITNIGETAG 57

Query: 57  -----GGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 105
                G    + ++  +CP   KC      FFQ Q R  D  M  F+ C+ C+H
Sbjct: 58  VVQDIGSDPTLPRSDRECP---KCHSRENVFFQSQQRRKDTSMVLFFVCLACSH 108

>Scas_720.22*
          Length = 122

 Score = 39.7 bits (91), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 11/110 (10%)

Query: 2   LSFCPLCNNMLL-ITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG---- 56
             FC  CNNML      ++      CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGAPLVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 105
            G    + ++  +CP   +C      FFQ Q R  D  M  F+ C+ C+H
Sbjct: 62  IGSDPTLPRSDRECP---RCHARDNVFFQSQQRRKDTSMVLFFVCLQCSH 108

>AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH]
           complement(276175..276543) [369 bp, 122 aa]
          Length = 122

 Score = 38.1 bits (87), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 43/110 (39%), Gaps = 11/110 (10%)

Query: 2   LSFCPLCNNMLL-ITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG---- 56
             FC  CNNML      +       CR+C Y        +Y  + +    + +  G    
Sbjct: 4   FRFCRDCNNMLYPREDKEEQRLLFECRTCTYAEEAGTPLVYRHELI--TNIGETAGVVQD 61

Query: 57  -GGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 105
            G    + ++  +CP   +C      FFQ Q R  D  M  F+ C+ C+H
Sbjct: 62  IGSDPTLPRSDRECP---RCHSHDNVFFQSQQRRRDTSMVLFFVCLGCSH 108

>Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement
          Length = 110

 Score = 33.1 bits (74), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 57  GGWDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 105
           G    + ++  +CP   KC      FFQ Q R  D  M  F+ C+ C+H
Sbjct: 51  GSDPTLPRSDRECP---KCHSHENVFFQSQQRRKDTSMVLFFVCLACSH 96

>Scas_544.7d
          Length = 173

 Score = 28.5 bits (62), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 21/79 (26%)

Query: 5   CPLCNNMLLITTADSGV---YTLTCRSCPYEFPIEGIEIYDRKTLPR-----KEVDDV-- 54
           CP C   L +  A S     Y  TC+ C Y++    + + D +++ +      E  +V  
Sbjct: 61  CPNCETALTVLLAKSSRKKRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVEY 120

Query: 55  -----------LGGGWDNV 62
                      LGGG DNV
Sbjct: 121 LRFQELKKNIELGGGIDNV 139

>AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp,
           436 aa]
          Length = 436

 Score = 26.9 bits (58), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 38  IEIYDRKTLPRKEVDDVLGGGWDNVDQTKVQCPNYEK---CGGESAYFFQLQIRSADEPM 94
           IEI  R+ L  +E+++  G  W N D+   +  N  K   C  E      L+++   E +
Sbjct: 345 IEIASRRRLTIRELENSYGSSWRNADKNFSRQINRRKKIWCAIEQGLLDGLELKECFEIL 404

Query: 95  TTFYK 99
             + +
Sbjct: 405 ENYVR 409

>ABL041W [551] [Homologous to ScYMR089C (YTA12) - SH]
           complement(318701..321157) [2457 bp, 818 aa]
          Length = 818

 Score = 26.9 bits (58), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 9   NNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG 56
           +N++ +   ++G++ L  R   Y F I  +E ++RK    +E  D LG
Sbjct: 216 SNVVKVVLNENGMHQLQNRDTSYYFTIGSVENFERKL---REAQDELG 260

>CAGL0M05027g 544448..546676 similar to sp|Q05029 Saccharomyces
           cerevisiae YMR237w or Saccharomyces cerevisiae YOR299w
           BUD7, start by similarity
          Length = 742

 Score = 26.6 bits (57), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 19  SGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLG 56
           S V      +C YE  I+ I+I +R+ LP  E DD + 
Sbjct: 322 SIVLARVLMACDYE--IDAIDIINRELLPHGEEDDTIS 357

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score = 26.2 bits (56), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 15/29 (51%)

Query: 5   CPLCNNMLLITTADSGVYTLTCRSCPYEF 33
           CP+C   +      S V  +TC SC ++F
Sbjct: 290 CPICVKHVPTKVTSSSVAIVTCNSCDFKF 318

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,694,292
Number of extensions: 141212
Number of successful extensions: 288
Number of sequences better than 10.0: 36
Number of HSP's gapped: 285
Number of HSP's successfully gapped: 36
Length of query: 110
Length of database: 16,596,109
Length adjustment: 80
Effective length of query: 30
Effective length of database: 13,826,669
Effective search space: 414800070
Effective search space used: 414800070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)