Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_569.333333317070.0
YDR044W (HEM13)32832714820.0
CAGL0K12100g32732714160.0
Kwal_27.1093534432713910.0
Sklu_2357.834132913720.0
KLLA0F18546g37532013110.0
AGR030C32432011201e-154
Sklu_2284.445274710.74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_569.3
         (333 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_569.3                                                            662   0.0  
YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen I...   575   0.0  
CAGL0K12100g 1183383..1184366 highly similar to sp|P11353 Saccha...   550   0.0  
Kwal_27.10935                                                         540   0.0  
Sklu_2357.8 YDR044W, Contig c2357 11533-12558                         533   0.0  
KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1 Kluyver...   509   0.0  
AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...   436   e-154
Sklu_2284.4 YOR051C, Contig c2284 4372-5730                            32   0.74 

>Scas_569.3
          Length = 333

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/333 (95%), Positives = 318/333 (95%)

Query: 1   MSSYSIMPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGT 60
           MSSYSIMPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGT
Sbjct: 1   MSSYSIMPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGT 60

Query: 61  SMVIANGSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFAC 120
           SMVIANGSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFAC
Sbjct: 61  SMVIANGSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFAC 120

Query: 121 GLSMVIHPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELH 180
           GLSMVIHPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELH
Sbjct: 121 GLSMVIHPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELH 180

Query: 181 KKALDKHDKTLYPKYKKWCDEYFYIAHRKETXXXXXXXXXXXXXXXPQEILKICEDCFDA 240
           KKALDKHDKTLYPKYKKWCDEYFYIAHRKET               PQEILKICEDCFDA
Sbjct: 181 KKALDKHDKTLYPKYKKWCDEYFYIAHRKETRGIGGIFFDDFDDRDPQEILKICEDCFDA 240

Query: 241 FLPSYLPIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMS 300
           FLPSYLPIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMS
Sbjct: 241 FLPSYLPIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMS 300

Query: 301 LPEHASWLYNHHPAPGSREAKLLEVTTNPREWA 333
           LPEHASWLYNHHPAPGSREAKLLEVTTNPREWA
Sbjct: 301 LPEHASWLYNHHPAPGSREAKLLEVTTNPREWA 333

>YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen III
           oxidase, catalyzes the oxidative decarboxylation of
           coproporphyrinogen III to proto-porhyrinogen IX, the
           sixth step in heme biosynthetic pathway, repressed by
           oxygen [987 bp, 328 aa]
          Length = 328

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/327 (82%), Positives = 290/327 (88%)

Query: 7   MPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIAN 66
           MPAPQD  +LPIRQQMEALIRRKQAEIT+GLES+DTVKFHAD+WTRGNDGGGGTSMVI +
Sbjct: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60

Query: 67  GSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVI 126
           G+TFEKGGVNVSVVYG L+P AV AMK DHKNL+LP+DPKTGLPV DGVKFFACGLSMVI
Sbjct: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120

Query: 127 HPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDK 186
           HP NPHAPTTHLNYRYFETWN DGTPQ+WWFGGGADLTP YLYEED + FH+LHK ALDK
Sbjct: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180

Query: 187 HDKTLYPKYKKWCDEYFYIAHRKETXXXXXXXXXXXXXXXPQEILKICEDCFDAFLPSYL 246
           HD  LYP++KKWCDEYFYI HRKET               PQEILK+ EDCFDAFLPSYL
Sbjct: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240

Query: 247 PIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 306
            I+++RKDMPYT+EE+QWQ IRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS
Sbjct: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300

Query: 307 WLYNHHPAPGSREAKLLEVTTNPREWA 333
           WLYNHHPAPGSREAKLLEVTT PREW 
Sbjct: 301 WLYNHHPAPGSREAKLLEVTTKPREWV 327

>CAGL0K12100g 1183383..1184366 highly similar to sp|P11353
           Saccharomyces cerevisiae YDR044w HEM13
           coproporphyrinogen III oxidase, start by similarity
          Length = 327

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/327 (79%), Positives = 281/327 (85%), Gaps = 1/327 (0%)

Query: 7   MPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIAN 66
           M APQD  HLPIRQQMEALIRRKQ EIT+GLES+DTVKF AD+W RGNDGGGGTSMVI N
Sbjct: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60

Query: 67  GSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVI 126
           GSTFEKGGVNVSVVYG LTP AVLAMK +HK+LKLP +   GLP  +GVKFFACGLSMVI
Sbjct: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVI 119

Query: 127 HPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDK 186
           HP NP APTTHLNYRYFETWNPDGTPQ+WWFGGGADLTPFYL+EEDA+HFH+LHK ALDK
Sbjct: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179

Query: 187 HDKTLYPKYKKWCDEYFYIAHRKETXXXXXXXXXXXXXXXPQEILKICEDCFDAFLPSYL 246
           HD  LYP++KKWCDEYFYIAHR ET               PQEILKICEDCFDAFLPSYL
Sbjct: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239

Query: 247 PIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 306
            I+++RKD+PY E++K WQLIRRGRY EFNLIYDRGTQFGLRTPGSRVESILMSLP HAS
Sbjct: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299

Query: 307 WLYNHHPAPGSREAKLLEVTTNPREWA 333
           W+YNHHP PGS EAKLLEVTT PREW 
Sbjct: 300 WVYNHHPEPGSEEAKLLEVTTKPREWV 326

>Kwal_27.10935
          Length = 344

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/327 (77%), Positives = 275/327 (84%)

Query: 7   MPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIAN 66
           MPAP D T +PIRQQME LIRRKQ EIT+GLE+LDTVKF  DSWTRGNDGGGGTSMV+ N
Sbjct: 18  MPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTSMVLQN 77

Query: 67  GSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVI 126
           G+TFEKGGVNVSVVYG L+P A+ AMK DHKNLKLP DP+TGLP  DGVKFFACGLSMVI
Sbjct: 78  GTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACGLSMVI 137

Query: 127 HPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDK 186
           HP NPHAPTTHLNYRYFETWNPDGTPQ+WWFGGGADLTP YLYEEDA+ FH+ HKKALDK
Sbjct: 138 HPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHKKALDK 197

Query: 187 HDKTLYPKYKKWCDEYFYIAHRKETXXXXXXXXXXXXXXXPQEILKICEDCFDAFLPSYL 246
           HD +LYP+YKKWCDEYF+I HR ET               PQEIL + EDCFDAFLPSYL
Sbjct: 198 HDTSLYPRYKKWCDEYFFIKHRNETRGIGGIFFDDKDDRDPQEILSLIEDCFDAFLPSYL 257

Query: 247 PIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 306
           PII +RKDMP+TEEEKQWQLIRRGRYVEFNL+ DRGTQFGLRTPGSR ESILMSLP  A 
Sbjct: 258 PIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSLPVTAC 317

Query: 307 WLYNHHPAPGSREAKLLEVTTNPREWA 333
           W Y+HHP PGSRE KLL+V  +P EW 
Sbjct: 318 WFYDHHPEPGSREEKLLKVLESPVEWV 344

>Sklu_2357.8 YDR044W, Contig c2357 11533-12558
          Length = 341

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/329 (75%), Positives = 274/329 (83%)

Query: 5   SIMPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVI 64
           + MPAPQD  HLPIRQQME LI RKQ EITKGLE+LDTVKF ADSWTRGNDGGGGTSMV+
Sbjct: 13  TAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVL 72

Query: 65  ANGSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSM 124
            NG+TFEKGGVN SVVYG L+P A+ AM+ DHKNL LP DP+TG P  DGV FFACGLSM
Sbjct: 73  QNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSM 132

Query: 125 VIHPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKAL 184
           VIHP NPHAPTTHLNYRYFETWNPDG+PQ+WWFGGGADLTP YLYEEDA  FH+LHK+AL
Sbjct: 133 VIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEAL 192

Query: 185 DKHDKTLYPKYKKWCDEYFYIAHRKETXXXXXXXXXXXXXXXPQEILKICEDCFDAFLPS 244
           DKHD  LYP++KKWCDEYF+I HR ET               PQEILK+ EDCFDAFLPS
Sbjct: 193 DKHDTDLYPRFKKWCDEYFFINHRGETRGIGGIFFDDLDDRDPQEILKLVEDCFDAFLPS 252

Query: 245 YLPIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEH 304
           YL I+ +RKDMPYTEEEKQWQ +RRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  
Sbjct: 253 YLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVT 312

Query: 305 ASWLYNHHPAPGSREAKLLEVTTNPREWA 333
           ASWLY+HHP  GSRE +LLEV  +P+EW 
Sbjct: 313 ASWLYDHHPDAGSREDQLLEVLKHPKEWV 341

>KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1
           Kluyveromyces lactis putative coproporphyrinogen
           oxidase, start by similarity
          Length = 375

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/320 (75%), Positives = 265/320 (82%)

Query: 14  THLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIANGSTFEKG 73
           + +PIR++MEAL+RRKQ EITKGLE+LDTVKF ADSW RGN+GGGG SMV+ NG+TFEKG
Sbjct: 56  SQVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKG 115

Query: 74  GVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVIHPKNPHA 133
           GVNVSVV+GNL+P A+ AMK DHKNL LP DP TG P   GVKFFACGLSMVIHP NPHA
Sbjct: 116 GVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHA 175

Query: 134 PTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDKHDKTLYP 193
           PTTHLNYRYFETWN DGTPQ+WWFGGGADLTP YLYEEDAK FH+LHK ALDK D  LYP
Sbjct: 176 PTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYP 235

Query: 194 KYKKWCDEYFYIAHRKETXXXXXXXXXXXXXXXPQEILKICEDCFDAFLPSYLPIIEKRK 253
           KYKKWCDEYFYI HR+ET               P EIL++ E+CFDAFLPSYL II++RK
Sbjct: 236 KYKKWCDEYFYIKHREETRGIGGIFFDDVDDRDPNEILQMVENCFDAFLPSYLEIIKRRK 295

Query: 254 DMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHP 313
           DMPYTEEE+QWQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  ASWLY+HHP
Sbjct: 296 DMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHP 355

Query: 314 APGSREAKLLEVTTNPREWA 333
              SRE KLL+V  NP EW 
Sbjct: 356 EVDSREDKLLQVLKNPVEWV 375

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score =  436 bits (1120), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 245/320 (76%), Gaps = 3/320 (0%)

Query: 14  THLP-IRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIANGSTFEK 72
            H P +R++ME L+RRKQ EIT   E++DTVKF ADSW R  +GGGGTS V+ +G+TFEK
Sbjct: 4   AHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEK 62

Query: 73  GGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVIHPKNPH 132
            GVNVSVV+G L+P AV AM+ +HKNL LP DP TG P   GV+FFACG+S+V+HP NPH
Sbjct: 63  AGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPH 121

Query: 133 APTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDKHDKTLY 192
           APT HLNYRYFETW+  G PQ+WWFGGG+DLTP YLYEEDA+ FH  HK ALD+ D  LY
Sbjct: 122 APTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALY 181

Query: 193 PKYKKWCDEYFYIAHRKETXXXXXXXXXXXXXXXPQEILKICEDCFDAFLPSYLPIIEKR 252
           P++KKWCDEYF+I HR E+               P+ +L++ EDC DAF+P+Y  I+ +R
Sbjct: 182 PRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRR 241

Query: 253 KDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHH 312
           KDMPYT  E +WQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  A W Y+HH
Sbjct: 242 KDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHH 301

Query: 313 PAPGSREAKLLEVTTNPREW 332
           PA G+REA LLEV  +PREW
Sbjct: 302 PAEGTREAALLEVLRHPREW 321

>Sklu_2284.4 YOR051C, Contig c2284 4372-5730
          Length = 452

 Score = 32.0 bits (71), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 141 RYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKA---LDKHDKTLYPKYKK 197
           +YFE  N    PQ+W     A +    LY+  +    E ++KA   L+K ++  + KYK 
Sbjct: 381 KYFEKANDRNDPQTWVDVAEAAIDLGNLYDYQSAQQEESYQKAEELLNKANRATHGKYKD 440

Query: 198 WCDEYFYIAHRKET 211
             D   ++A++ E 
Sbjct: 441 ILDN--FLANKNEA 452

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,085,603
Number of extensions: 542692
Number of successful extensions: 1207
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1220
Number of HSP's successfully gapped: 11
Length of query: 333
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 231
Effective length of database: 13,065,073
Effective search space: 3018031863
Effective search space used: 3018031863
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)