Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_569.229329314650.0
KLLA0F18524g357552774e-28
YDR043C (NRG1)231552643e-27
Sklu_2357.7157552574e-27
AGR031W140552494e-26
Scas_718.44266552567e-26
Kwal_27.10925264552559e-26
CAGL0K12078g463602631e-25
YBR066C (NRG2)220532336e-23
CAGL0L07480g314582333e-22
Scas_712.42*290531654e-13
Kwal_47.19045266541621e-12
YGL209W (MIG2)382531622e-12
CAGL0K09372g396581622e-12
KLLA0E10989g474531623e-12
Sklu_2351.6548531623e-12
Kwal_14.2278463531605e-12
Scas_575.3455531605e-12
CAGL0A01628g424531587e-12
YGL035C (MIG1)504531597e-12
KLLA0B00605g239581557e-12
CAGL0C02519g318561551e-11
YER028C394551543e-11
AFR471C389641533e-11
Kwal_26.8351698561439e-10
Scas_687.33288561373e-09
CAGL0M01870g315611363e-09
Scas_697.35839571375e-09
YOR113W (AZF1)914571366e-09
KLLA0F11682g374561356e-09
Scas_709.32822561359e-09
KLLA0F26961g694561303e-08
YER169W (RPH1)796501303e-08
YKL062W (MSN4)630561295e-08
KLLA0C17710g821501295e-08
Scas_681.19864501295e-08
Kwal_56.23453828501279e-08
CAGL0L11880g980501261e-07
AGR117C799501261e-07
ABR089C571561261e-07
YDR096W (GIS1)894501261e-07
Scas_718.36d330611232e-07
Scas_649.28730561252e-07
KLLA0F23782g782571242e-07
Scas_717.18354531222e-07
AGL207W277561213e-07
Scas_717.17d350551204e-07
Kwal_27.10467302561195e-07
YMR037C (MSN2)704561205e-07
Kwal_47.17888786611206e-07
CAGL0M13189g541541206e-07
CAGL0F05995g597561198e-07
Kwal_47.17241403541171e-06
YPL230W391441161e-06
Sklu_2181.1410541161e-06
Scas_721.921152491171e-06
Scas_695.2571591162e-06
KLLA0F13046g1379491162e-06
KLLA0B07909g922521162e-06
CAGL0K02145g317541142e-06
ACR264W769531162e-06
Scas_602.9547541152e-06
ACL057W520541152e-06
YNL027W (CRZ1)678601153e-06
CAGL0L06072g300541133e-06
Kwal_47.166211178501153e-06
CAGL0M06831g645591144e-06
CAGL0L03916g642601134e-06
Sklu_2398.2288581114e-06
YML081W1251501135e-06
Scas_707.31289541116e-06
Sklu_2443.22213491087e-06
Kwal_47.16577881501127e-06
KLLA0E08679g596611117e-06
AER159C1191491118e-06
KLLA0B04477g1332491111e-05
Scas_683.25879521101e-05
Kwal_14.2206254561081e-05
CAGL0H04213g1321541101e-05
Scas_720.33316491081e-05
Scas_717.17525511091e-05
Kwal_27.11460531641082e-05
KLLA0C17072g474541063e-05
KLLA0F20636g285521053e-05
Scas_703.231341501063e-05
Scas_710.9505521054e-05
Kwal_26.8011190531024e-05
YMR182C (RGM1)211441025e-05
ADR308C278571026e-05
ADL198W547641046e-05
AGR172W1057491046e-05
CAGL0E04884g1489491047e-05
AFR580C838521038e-05
AEL077W336511019e-05
YDR216W (ADR1)1323491039e-05
KLLA0B03454g472431001e-04
CAGL0G08107g625621002e-04
Sklu_2244.327153982e-04
AFL136W40944982e-04
Scas_711.5683255992e-04
CAGL0E06116g61347993e-04
YJR127C (ZMS1)138049993e-04
CAGL0M00594g102052983e-04
YGR067C79452983e-04
Sklu_2436.951771973e-04
YER130C44354974e-04
YPR013C31755964e-04
Kwal_14.254371153974e-04
ADL042W28152954e-04
Scas_641.2453271965e-04
CAGL0K04631g101356975e-04
KLLA0C16005g33147947e-04
CAGL0E04312g68871958e-04
KLLA0F10109g62371949e-04
ADL040W33053930.001
YDR463W (STP1)51971940.001
Sklu_2389.276753930.001
YHR006W (STP2)54167920.002
AFR461C54471920.002
Scas_378.120851890.002
KLLA0A04609g42357910.002
Scas_602.4d25651900.002
Scas_656.1*10253850.002
Scas_660.1236767910.002
KLLA0F01463g78153910.002
KLLA0E18645g43166910.002
Scas_713.5262048910.002
CAGL0L00583g38841900.003
CAGL0J01595g34453900.003
YJL056C (ZAP1)88055910.003
KLLA0A10373g20662860.006
CAGL0J05060g71353870.008
AEL174W66151860.009
CAGL0H07557g47659850.011
YPR015C24753840.011
ADL051W17351820.011
Scas_707.4633853830.016
CAGL0M04323g70350840.016
YDR146C (SWI5)70948840.018
CAGL0E01331g68948840.018
KLLA0D16456g85457840.019
Kwal_56.2392574548840.019
Scas_602.426653820.021
Sklu_2289.129159820.023
CAGL0L05786g34856820.026
CAGL0I02816g29149800.034
YMR070W (MOT3)49049810.041
Scas_693.3163551810.042
CAGL0G10021g39443800.044
Kwal_26.802150752800.047
AGR186C28764790.049
YLR131C (ACE2)77048800.052
Kwal_47.1833753667790.064
Scas_719.68135055790.066
YPR022C113358790.072
ADL050W14651750.075
Sklu_2359.572261790.076
Scas_717.60d16750750.095
YGL254W (FZF1)29952770.10
YPR186C (PZF1)42943760.13
YDR253C (MET32)19133740.15
CAGL0K06413g35971750.15
AGL071C39649750.16
YPL038W (MET31)17752720.24
AGL197W84448740.31
Scas_712.232759720.35
ABR240W22780710.38
CAGL0K03003g64749730.39
Kwal_23.540042935720.42
KLLA0F07073g55823720.48
Scas_627.6120765720.53
Sklu_1527.120552700.54
CAGL0I02838g65535710.58
Sklu_2154.319061690.61
AGL246W22752671.2
CAGL0H04873g45127681.3
AFR531W27461661.9
Kwal_27.1016728521662.3
Scas_568.519952642.6
AEL278W47635662.7
Kwal_34.1594627961652.8
Scas_631.743343653.4
CAGL0L06622g113783653.8
KLLA0F13420g133622654.0
Sklu_2206.235821634.6
Sklu_2126.544849634.9
Kwal_26.930030432635.0
Scas_604.458558636.1
AFR588W31921627.3
KLLA0E13519g23061617.5
Scas_636.14d27547617.5
CAGL0K02343g116254628.8
Scas_627.17d27547609.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_569.2
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_569.2                                                            568   0.0  
KLLA0F18524g complement(1701498..1702571) some similarities with...   111   4e-28
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...   106   3e-27
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement       103   4e-27
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...   100   4e-26
Scas_718.44                                                           103   7e-26
Kwal_27.10925                                                         102   9e-26
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...   105   1e-25
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    94   6e-23
CAGL0L07480g complement(822240..823184) some similarities with s...    94   3e-22
Scas_712.42*                                                           68   4e-13
Kwal_47.19045                                                          67   1e-12
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    67   2e-12
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    67   2e-12
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    67   3e-12
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       67   3e-12
Kwal_14.2278                                                           66   5e-12
Scas_575.3                                                             66   5e-12
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    65   7e-12
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    66   7e-12
KLLA0B00605g complement(46736..47455) some similarities with sp|...    64   7e-12
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    64   1e-11
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    64   3e-11
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    64   3e-11
Kwal_26.8351                                                           60   9e-10
Scas_687.33                                                            57   3e-09
CAGL0M01870g complement(219813..220760) some similarities with t...    57   3e-09
Scas_697.35                                                            57   5e-09
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    57   6e-09
KLLA0F11682g complement(1068992..1070116) some similarities with...    57   6e-09
Scas_709.32                                                            57   9e-09
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    55   3e-08
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    55   3e-08
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    54   5e-08
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    54   5e-08
Scas_681.19                                                            54   5e-08
Kwal_56.23453                                                          54   9e-08
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    53   1e-07
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    53   1e-07
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    53   1e-07
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    53   1e-07
Scas_718.36d                                                           52   2e-07
Scas_649.28                                                            53   2e-07
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    52   2e-07
Scas_717.18                                                            52   2e-07
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    51   3e-07
Scas_717.17d                                                           51   4e-07
Kwal_27.10467                                                          50   5e-07
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    51   5e-07
Kwal_47.17888                                                          51   6e-07
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    51   6e-07
CAGL0F05995g complement(598819..600612) some similarities with s...    50   8e-07
Kwal_47.17241                                                          50   1e-06
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    49   1e-06
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            49   1e-06
Scas_721.92                                                            50   1e-06
Scas_695.2                                                             49   2e-06
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    49   2e-06
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    49   2e-06
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    49   2e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    49   2e-06
Scas_602.9                                                             49   2e-06
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    49   2e-06
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    49   3e-06
CAGL0L06072g complement(679924..680826) some similarities with s...    48   3e-06
Kwal_47.16621                                                          49   3e-06
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    49   4e-06
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    48   4e-06
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                47   4e-06
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    48   5e-06
Scas_707.31                                                            47   6e-06
Sklu_2443.22 , Contig c2443 45390-46027                                46   7e-06
Kwal_47.16577                                                          48   7e-06
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    47   7e-06
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    47   8e-06
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    47   1e-05
Scas_683.25                                                            47   1e-05
Kwal_14.2206                                                           46   1e-05
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    47   1e-05
Scas_720.33                                                            46   1e-05
Scas_717.17                                                            47   1e-05
Kwal_27.11460                                                          46   2e-05
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    45   3e-05
KLLA0F20636g complement(1914452..1915309) some similarities with...    45   3e-05
Scas_703.23                                                            45   3e-05
Scas_710.9                                                             45   4e-05
Kwal_26.8011                                                           44   4e-05
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    44   5e-05
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    44   6e-05
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    45   6e-05
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    45   6e-05
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    45   7e-05
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    44   8e-05
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    44   9e-05
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    44   9e-05
KLLA0B03454g complement(314015..315433) some similarities with s...    43   1e-04
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    43   2e-04
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                42   2e-04
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    42   2e-04
Scas_711.56                                                            43   2e-04
CAGL0E06116g complement(604708..606549) some similarities with t...    43   3e-04
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    43   3e-04
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    42   3e-04
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    42   3e-04
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          42   3e-04
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    42   4e-04
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    42   4e-04
Kwal_14.2543                                                           42   4e-04
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    41   4e-04
Scas_641.24                                                            42   5e-04
CAGL0K04631g complement(440721..443762) some similarities with s...    42   5e-04
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    41   7e-04
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    41   8e-04
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    41   9e-04
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    40   0.001
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    41   0.001
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            40   0.001
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    40   0.002
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    40   0.002
Scas_378.1                                                             39   0.002
KLLA0A04609g complement(411494..412765) some similarities with s...    40   0.002
Scas_602.4d                                                            39   0.002
Scas_656.1*                                                            37   0.002
Scas_660.12                                                            40   0.002
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    40   0.002
KLLA0E18645g complement(1648263..1649558) some similarities with...    40   0.002
Scas_713.52                                                            40   0.002
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    39   0.003
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    39   0.003
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    40   0.003
KLLA0A10373g complement(907244..907864) some similarities with c...    38   0.006
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    38   0.008
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    38   0.009
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    37   0.011
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    37   0.011
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    36   0.011
Scas_707.46                                                            37   0.016
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    37   0.016
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    37   0.018
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    37   0.018
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    37   0.019
Kwal_56.23925                                                          37   0.019
Scas_602.4                                                             36   0.021
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          36   0.023
CAGL0L05786g complement(636176..637222) some similarities with t...    36   0.026
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    35   0.034
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    36   0.041
Scas_693.31                                                            36   0.042
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    35   0.044
Kwal_26.8021                                                           35   0.047
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    35   0.049
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    35   0.052
Kwal_47.18337                                                          35   0.064
Scas_719.68                                                            35   0.066
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    35   0.072
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    33   0.075
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          35   0.076
Scas_717.60d                                                           33   0.095
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    34   0.10 
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    34   0.13 
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    33   0.15 
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    33   0.15 
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    33   0.16 
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    32   0.24 
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    33   0.31 
Scas_712.2                                                             32   0.35 
ABR240W [834] [Homologous to ScYLR079W (SIC1) - SH] complement(8...    32   0.38 
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    33   0.39 
Kwal_23.5400                                                           32   0.42 
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    32   0.48 
Scas_627.6                                                             32   0.53 
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             32   0.54 
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    32   0.58 
Sklu_2154.3 , Contig c2154 4677-5249 reverse complement                31   0.61 
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    30   1.2  
CAGL0H04873g complement(465069..466424) some similarities with t...    31   1.3  
AFR531W [3723] [Homologous to ScAFR531W] complement(1389487..139...    30   1.9  
Kwal_27.10167                                                          30   2.3  
Scas_568.5                                                             29   2.6  
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    30   2.7  
Kwal_34.15946                                                          30   2.8  
Scas_631.7                                                             30   3.4  
CAGL0L06622g complement(743602..747015) similar to sp|P17442 Sac...    30   3.8  
KLLA0F13420g 1240135..1244145 gi|3002789|gb|AAC39438.1 Kluyverom...    30   4.0  
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            29   4.6  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            29   4.9  
Kwal_26.9300                                                           29   5.0  
Scas_604.4                                                             29   6.1  
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    28   7.3  
KLLA0E13519g complement(1190615..1191307) some similarities with...    28   7.5  
Scas_636.14d                                                           28   7.5  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    28   8.8  
Scas_627.17d                                                           28   9.9  

>Scas_569.2
          Length = 293

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/293 (94%), Positives = 276/293 (94%)

Query: 1   MMMMNPTIQPVLSAPDYMQRTLPQIEPTAAINLKLCTLLPRFSDTQLVENDLKFKLTRHL 60
           MMMMNPTIQPVLSAPDYMQRTLPQIEPTAAINLKLCTLLPRFSDTQLVENDLKFKLTRHL
Sbjct: 1   MMMMNPTIQPVLSAPDYMQRTLPQIEPTAAINLKLCTLLPRFSDTQLVENDLKFKLTRHL 60

Query: 61  SLWHPSNNFTTGPIENNNRSRDNSIPEMNYPNSSQNPSPILTNNTYSTQNSNDISSANTP 120
           SLWHPSNNFTTGPIENNNRSRDNSIPEMNYPNSSQNPSPILTNNTYSTQNSNDISSANTP
Sbjct: 61  SLWHPSNNFTTGPIENNNRSRDNSIPEMNYPNSSQNPSPILTNNTYSTQNSNDISSANTP 120

Query: 121 PSNVQLPTIWSTVPRRIPLEPTTLSKVGSMSSLMLPNPNVNTNLQPTGTSPTPQYYSDSG 180
           PSNVQLPTIWSTVPRRIPLEPTTLSKVGSMSSLMLPNPNVNTNLQPTGTSPTPQYYSDSG
Sbjct: 121 PSNVQLPTIWSTVPRRIPLEPTTLSKVGSMSSLMLPNPNVNTNLQPTGTSPTPQYYSDSG 180

Query: 181 VIPTEMGYYYPSEDGSKKHRISKRQRAIMVXXXXXXXXXXXXXXXXXYICKVCSKGFTTS 240
           VIPTEMGYYYPSEDGSKKHRISKRQRAIMV                 YICKVCSKGFTTS
Sbjct: 181 VIPTEMGYYYPSEDGSKKHRISKRQRAIMVKDLKKRKHEEELEKRRKYICKVCSKGFTTS 240

Query: 241 GHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPYYYGRPE 293
           GHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPYYYGRPE
Sbjct: 241 GHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPYYYGRPE 293

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score =  111 bits (277), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (90%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           YICK+CS+GFTTSGHLARHNRIHTGEK+H C +PGC  +FSRHDN +QHYRTHFK
Sbjct: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score =  106 bits (264), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           YICK+C++GFTTSGHLARHNRIHTGEK H C Y GC  +FSRHDNC+QHYRTH K
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228

 Score = 28.5 bits (62), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 10 PVLSAPDYMQ-RTLPQIEPTAAINLKLCTLLPRFSDTQLVENDLKFKLTR 58
          P +SA D MQ     +I P      K  TLLP  +++ +VEN+LK KL +
Sbjct: 19 PGISAFDGMQDEENVEISPER----KYQTLLPVLTNSHVVENELKHKLNK 64

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score =  103 bits (257), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           Y+CK+CS+GFTTSGHLARHNRIHTGEK H C + GC  +FSRHDNCVQHYRTH K
Sbjct: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score =  100 bits (249), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 47/55 (85%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           ++C+ C KGFTTSGHLARHNRIHTGEK H C +PGC  +FSRHDNC+QHYRTH K
Sbjct: 80  HLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134

>Scas_718.44
          Length = 266

 Score =  103 bits (256), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 47/55 (85%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           ++CK+CS GFTTSGHL+RHNRIHTGEK H C + GC  KFSRHDNC+QHYRTH K
Sbjct: 210 HVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLK 264

 Score = 31.2 bits (69), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 34 KLCTLLPRFSDTQLVENDLKFKLTRHLSL 62
          K  TLLP    T  ++NDLK+KLT+  S 
Sbjct: 52 KFQTLLPIVDTTSRIDNDLKWKLTKKFSF 80

>Kwal_27.10925
          Length = 264

 Score =  102 bits (255), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 47/55 (85%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           Y+CK+C KGFTTSGHLARHNRIHTGEK H C + GC  +FSRHDNCVQHY+TH +
Sbjct: 201 YVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLR 255

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score =  105 bits (263), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 43/60 (71%), Positives = 50/60 (83%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           Y+CKVC KGFTTSGHLARHNRIHTGEK+H C Y GC  +F+RHDNC+QHY+TH K  + Y
Sbjct: 402 YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLKRLKEY 461

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 94.4 bits (233), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 39/53 (73%), Positives = 44/53 (83%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + CK+CS GFTTSGHL+RHNRIHTGEK H C + GC  +FSRHDNC QHYRTH
Sbjct: 153 HFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTH 205

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 25/118 (21%)

Query: 37  TLLPRFSDTQLVENDLKFKLTRHLSLWHPSNNFTTGPIENNNRSRDNSIPEMNYPNSSQN 96
           TL+P    + L+++DLK KL +       + +F +G  +  NR+ D +I  +    +S  
Sbjct: 50  TLIPLMKTSHLIDDDLKDKLNK------CAFDFFSG--KQANRTSDGTISRL---TASGK 98

Query: 97  PSPILTNNTYSTQNSNDISSANT------PPSNVQLPTIWSTVPRRIPLEPTTLSKVG 148
            SPIL       QN N + + NT      P S++++     TV   I L+ T  +  G
Sbjct: 99  TSPIL-----PLQNINIVKAENTGNGKSDPYSSIKISKPTKTV---IKLKSTKTNTAG 148

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 94.4 bits (233), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 38/58 (65%), Positives = 46/58 (79%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           +IC++C  GFTTSGHL+RH +IHTGEK H C + GC   FSRHDNC+QHYRTH K +E
Sbjct: 252 HICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309

>Scas_712.42*
          Length = 290

 Score = 68.2 bits (165), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 34/53 (64%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C+ C++GF    H  RH R HTGEK HHC++PGC   FSR D   +H RTH
Sbjct: 18  FRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>Kwal_47.19045
          Length = 266

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHF 281
           + C +C KGF    H  RH R HTGEK H C++PGC  +FSR D   +H RTH 
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHM 67

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 32/53 (60%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C +GF    H  RH R HTGEK HHC++PGC   FSR D   +H RTH
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKK 255
           C K F+ S  L RH R HTG+ +
Sbjct: 52  CGKSFSRSDELKRHMRTHTGQSQ 74

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           + C+ CS+GF    H  RH R HTGEK H CS+PGC   FSR D   +H RTH  V +
Sbjct: 17  FKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTHTGVSQ 74

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y+C +C +GF    H  RH R HTGE+ H C +PGC  +FSR D   +H R H
Sbjct: 26  YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 233 CSKGFTTSGHLARHNRIHTGE 253
           CSK F+ S  L RH RIH  +
Sbjct: 61  CSKRFSRSDELTRHRRIHDSD 81

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y+C +CS+ F    H  RH R HTGEK H C +PGC  +FSR D   +H R H
Sbjct: 34  YVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>Kwal_14.2278
          Length = 463

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 31/53 (58%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           YIC +CS+ F    H  RH R HTGEK H C + GC  +FSR D   +H R H
Sbjct: 23  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>Scas_575.3
          Length = 455

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           ++C +C + F    H  RH R HTGEK H C +PGC  KFSR D   +H R H
Sbjct: 68  HVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH 120

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           ++C +C + F    H  RH R HTGEK H C +PGC  +FSR D   +H R H
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 65.9 bits (159), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C +C + F    H  RH RIHTGEK H C +PGC  +FSR D   +H R H
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           Y+C++C   F    H  RH R HTGEK   C+ PGC  +FSR+D   +H +THFK R+
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRK 69

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (58%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKV 283
           + C++CS+GF    H  RH R HTGEK H C +P C   FSR D   +H RTH  V
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTHMSV 75

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C++CS+GF    H  RH R HTGEK H C+  GC   FSR D   +H RTH K
Sbjct: 17  FRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTK 71

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           Y+C +C++ F    H  RH R HTGEK H C + GC  +FSR D   +H R H   R   
Sbjct: 22  YVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHESDRPKG 81

Query: 288 YYGR 291
             GR
Sbjct: 82  KRGR 85

>Kwal_26.8351
          Length = 698

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C+ C+K F  S HL RH R +H+ E+  HCSY  C  KFSR DN  QH +TH K
Sbjct: 641 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>Scas_687.33
          Length = 288

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKV 283
           + C +CS+GF    H  RH R HTGEK H C++  C   FSR D   +H R H  +
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHLGL 72

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           +ICKVC K F     L+ H  IHTGEK + C +  C   F+   N ++HY+ HFK+    
Sbjct: 173 FICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFKLSNGA 232

Query: 288 Y 288
           Y
Sbjct: 233 Y 233

>Scas_697.35
          Length = 839

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           Y C  C K FT  G+L  H R+HTGEK + C    C  KFSR  N   H  TH KV+
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQKVK 597

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 22/49 (44%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y C++C K F+  G+LA H   H   K   C    C   F++  N   H
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 241 GHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPYYYG 290
           G + +   +H G K+H C Y  C+  F++  +   H R+H   + PY  G
Sbjct: 500 GGVEKPKTLHEGSKQHKCPY--CHRLFAQSTHLEVHIRSHLGYK-PYQCG 546

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           ++C  C K FT  G+L  H R+HTGEK + C    C  KFSR  N   H  TH K++
Sbjct: 621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLK 675

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C  C + F+ + HL  H R H G K   C Y  C  +F++  N   H R H
Sbjct: 595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 21/49 (42%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y C +C K F+  G+LA H   H   K   C    C   F++  N   H
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKV 283
           Y C  C K F     L+ H  IHTG+K + C YP CY +F+   N ++HY+ H K 
Sbjct: 304 YRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKT 359

>Scas_709.32
          Length = 822

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C+ C K F  S HL RH R +H+ E+   C  P C  KFSR DN  QH +TH K
Sbjct: 765 FKCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKK 818

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C  C+K F  S HL RH R +H+ E+  HC +  C  KFSR DN  QH +TH K
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKK 674

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           YICK C + F++  HL RH + +H+GEK H C  P C  +F R D+ +QH
Sbjct: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + CK C K F  S HL RH R +H+ E+   C +  C  KFSR DN  QH +TH K
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y+C+ C++ F++  HL RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802

>Scas_681.19
          Length = 864

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y+C  C + FT+  HL RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812

>Kwal_56.23453
          Length = 828

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y+C+ C + F++  HL RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y+C+ C + F++  HL RH + +H+GEK H C  P C  +F R D+ +QH
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y+C+ C + F++  HL RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C+ C+K F  S HL RH R +H+ ++   C+Y  C  KFSR DN  QH +TH K
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRK 557

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           YIC+ C++ F++  HL RH + +H+GEK H C  P C  +F R D+ +QH
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875

>Scas_718.36d
          Length = 330

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           Y C VC KGF     L  H+ I +G + + C Y  C   F+   N ++HY+ HF++    
Sbjct: 239 YFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFRLTSGA 298

Query: 288 Y 288
           Y
Sbjct: 299 Y 299

>Scas_649.28
          Length = 730

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C  C K F  S HL RH R +H+ E+   C +  C  KFSR DN  QH +TH K
Sbjct: 673 FKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 726

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           + C+ C K FT  G+L  H R+HTGEK + C    C  KFSR  N   H  TH  ++
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYECER--CGRKFSRKGNLAAHKLTHDNLK 605

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C K FT S HL  H R H G K   C +  C  +F++  N   H R H
Sbjct: 523 FQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 34.7 bits (78), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 1/57 (1%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHY-RTHFKV 283
           Y C+ C + F+  G+LA H   H   K   C    C   F++  N   H  R H + 
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQT 635

>Scas_717.18
          Length = 354

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C +C K  T S  L  H  IHTGEK + C++P C    S   N  +HY++H K
Sbjct: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKV 283
           Y+C  C KGF  +  L  H  IHTG++   C +  C   F+   N ++H++ HF+ 
Sbjct: 183 YVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFRT 238

>Scas_717.17d
          Length = 350

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           +IC VC K  T S  L  H  IHTG +   CS+P C    S   N  +H+++H K
Sbjct: 285 HICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLK 339

>Kwal_27.10467
          Length = 302

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKV 283
           Y C  C K F     LA HN  HTG+K + C +  C  +F+   N  +HY+ HFK 
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFKT 253

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C +C K F  S HL RH R +H+ E+   C    C  KFSR DN  QH +TH K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>Kwal_47.17888
          Length = 786

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           + C+ C K FT  G+L  H R+HTGEK + C    C  +FSR  N   H  TH  ++ P+
Sbjct: 531 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEK--CGRRFSRKGNLAAHRLTHENLK-PF 587

Query: 288 Y 288
           +
Sbjct: 588 H 588

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C  C K FT S HL  H R H G K   C Y  C  +F++  N   H R H
Sbjct: 505 CPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHY-RTHFKV 283
           Y C+ C + F+  G+LA H   H   K  HC   GC   F++  N   H  R H + 
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQT 615

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C K F  S HL RH R +H+ E+   C +  C  KFSR DN  QH +TH
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTH 535

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C +CSK F  S HL RH R +H+ ++   C    C  KFSR DN  QH +TH K
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>Kwal_47.17241
          Length = 403

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C + F    HL RH R +H GEK   C    C  KFSR DN  QH +TH
Sbjct: 346 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           C+  FT + HLARH R HTGEK   C  P C   FSR DN  QH
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQC--PACLKFFSRVDNLKQH 90

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C+ C + F    HL RH R +H GEK + C    C  KFSR DN  QH +TH
Sbjct: 354 FGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQHIKTH 405

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKK 255
           Y C++C K F+ S +L +H + H G+ K
Sbjct: 383 YGCEICGKKFSRSDNLNQHIKTHGGDYK 410

>Scas_721.92
          Length = 1152

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C VCS+ F    HL RH R HT EK + C    C  KF+R D  ++H
Sbjct: 78  FVCDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>Scas_695.2
          Length = 571

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYP-------GCYLKFSRHDNCVQHYRT 279
           ++C +C K F       RH  +HTG+K++ C          GC+ KF+R D   +H++T
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFKT 538

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++CKVC++ F    HL RH R HT EK + C    C  +F+R D  ++H
Sbjct: 125 FVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           YIC  C+K F+ S H ARH R HTG K   CS   C   F R D   +H RT
Sbjct: 8   YICSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRT 57

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C+ C + F    HL RH R +H GEK + C    C  KFSR DN  QH +TH
Sbjct: 264 FGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKTH 315

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C+ C K FT  G+L  H R+HTGE+ + C    C  +FSR  N   H  TH
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDK--CGKRFSRKGNLAAHMLTH 565

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           + C  C K FT S HL  H R H G K   C Y  C  +F++  N   H R H   R PY
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLHTGER-PY 543

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 1/57 (1%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHY-RTHFKV 283
           Y C  C K F+  G+LA H   H   K   C    C   F++  N   H  R H + 
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQT 599

>Scas_602.9
          Length = 547

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C + F    HL RH R +H GEK + C    C   FSR DN  QH +TH
Sbjct: 495 FACDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C+ C + F    HL RH R +H GEK + C    C  KFSR DN  QH +TH
Sbjct: 460 FGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTH 511

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYP-------GCYLKFSRHDNCVQHYRTH 280
           +IC +C K F       RH  +HTG+K++ C          GC  KF+R D   +H++T 
Sbjct: 597 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTE 656

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C VC K FT   +L  H R HT E+   CS   C   F+R  +  +H   H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLH 619

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARH-NRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C +C + F    HL RH + +H GE+ + C    C   FSR DN  QH RTH
Sbjct: 218 FKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKRTH 269

>Kwal_47.16621
          Length = 1178

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG-CYLKFSRHDNCVQH 276
           ++C +C++GF    HL RH R HT EK   C++ G C   F+R D  ++H
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRC---FARRDLVLRH 124

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHC-------SYPGCYLKFSRHDNCVQHYRT 279
           Y C +C K F       RH  +HTG+K++ C       ++ GC  KF+R D   +H++T
Sbjct: 549 YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKT 607

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y+C+VC K F+   +L  H R HT EK + CS   C   F+R  +  +H   H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLH 571

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           + C+ C K FT +G+L  H R+HTGE+   C    C   F+R  N   H  TH  ++ PY
Sbjct: 508 FECEFCGKRFTQAGNLRTHRRLHTGERPFKCD--KCDKTFARRGNLTAHEFTHESIK-PY 564

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           Y C  CSK F+ S HL  H + H G K   C +  C  +F++  N   H R H   R
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLHTGER 534

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           ++C  C K F     L  H+ IH G   + C++ GC  +F+   N ++HYR H K +E
Sbjct: 218 HLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKKE 275

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG-CYLKFSRHDNCVQH 276
           ++C +C++GF    HL RH R HT EK   C + G C   F+R D  ++H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRC---FARRDLVLRH 107

>Scas_707.31
          Length = 289

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y C +C K F    HL RH R IH   +   CS   C+ +FSR+DN  QH R H
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSV--CHKRFSRNDNLNQHVRIH 274

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C +C++GF    HL RH R HT EK   C++  C   F+R D  ++H
Sbjct: 48  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>Kwal_47.16577
          Length = 881

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           CSK F+ S HL RH   H+ E K+ C +P C  +FSR D   +H+  H +
Sbjct: 20  CSKSFSRSDHLGRHKANHSSE-KYKCEWPACGREFSRLDVKKKHFGRHLR 68

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYP-------GCYLKFSRHDNCVQHYRTH 280
           Y+C VC K F       RH  +HTG++++ C          GC  KF+R D   +H++T 
Sbjct: 497 YVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKTE 556

Query: 281 F 281
            
Sbjct: 557 L 557

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           Y C +C K FT   +L  H R HT E+ + CS   C   F+R  +  +H   H   R
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGKR 523

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C VC++GF    HL RH R HT EK   C++  C   F+R D  ++H
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C +C++GF    HL RH R HT EK   C++  C   F+R D  ++H
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>Scas_683.25
          Length = 879

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           +IC  C+KGF+ + H  RH R HTG K + C    C   F R D  ++H +T
Sbjct: 15  FICSFCAKGFSRAEHKIRHERSHTGLKPYKCKV--CTHCFVRSDLALRHIKT 64

>Kwal_14.2206
          Length = 254

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           C++C K F+    L+ H  IHTG + + C  P C  +F+   N ++H + H K R+
Sbjct: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH-YRTH 280
           ++C +C++GF    HL RH R HT EK   C +  C   F+R D  ++H Y+ H
Sbjct: 33  HLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQYKLH 84

>Scas_720.33
          Length = 316

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 231 KVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           K C   FT   HLARH R HTGEK   C    C+  FSR DN  QH  T
Sbjct: 21  KDCHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLKQHRDT 67

>Scas_717.17
          Length = 525

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278
           YIC +CSK F     L RH   H+ E+ + C  P C  +  R DN +QH +
Sbjct: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436

>Kwal_27.11460
          Length = 531

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHC-------SYPGCYLKFSRHDNCVQHYRTH 280
           + C +C K F       RH  +HTG+K++ C       +  GC  KF+R D   +H++T 
Sbjct: 441 FSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTE 500

Query: 281 FKVR 284
              R
Sbjct: 501 GGKR 504

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH---------YR 278
           Y C++C K FT   +L  H R HT E+   C+   C   F+R  +  +H         Y 
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLHTGQKRYT 470

Query: 279 THFKVREPYYYG 290
            H K+++   +G
Sbjct: 471 CHGKLKDGTEWG 482

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C+ C + F    HL RH R +H  EK + C    C  KFSR DN  QH +TH
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKK 255
           Y C +C K F+ S +L++H + HT E K
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHTHEDK 474

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 229 ICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           IC  C K FT    L  H  +H+G+K   C++ GC  KF+   N ++H + H
Sbjct: 233 ICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>Scas_703.23
          Length = 1341

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG-CYLKFSRHDNCVQH 276
           ++C  C++GF    HL RH R HT EK   C + G C   F+R D  ++H
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRC---FARRDLVLRH 118

>Scas_710.9
          Length = 505

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHF 281
           CK+C K  T +  L  H  IHTG +   C++PGC   F+   N  +H + H 
Sbjct: 449 CKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHL 500

>Kwal_26.8011
          Length = 190

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y C++C K F+ S  L  H   HTG +   C +  C   F+   N V+H +TH
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           C+  F  + HLARH R HTGEK   C+   C   FSR DN  QH
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFSRIDNLRQH 68

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 229 ICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           +CKVC +       L  H   HTG++   C +PGC   F+   N ++H R H +  E
Sbjct: 205 VCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSRGSE 261

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 7/64 (10%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYP-------GCYLKFSRHDNCVQHYRTH 280
           + C VC K F       RH  +H+G+K++ C          GC  KF+R D   +H++T 
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTE 513

Query: 281 FKVR 284
              R
Sbjct: 514 SGRR 517

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C  C++ F    HL RH R HT EK + C    C  +FSR D  ++H
Sbjct: 49  FVCHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRH 95

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C+ C++ F    HL RH R HT EK + C    C  +F+R D  ++H
Sbjct: 30  FVCQTCTRAFARQEHLTRHERSHTKEKPYCCGI--CDRRFTRRDLLLRH 76

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           YIC  C++ F+ S H  RH R HTG K   C    C   F R D   +H RT
Sbjct: 8   YICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV--CNHSFVRRDLLQRHIRT 57

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C VC K       L  H  IHTG +   C +PGC  +F+   N V+HYR H
Sbjct: 276 CPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLH 326

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C+VC++ F    HL RH R HT EK + C    C   F+R D  ++H
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRH 270
           + C +C KG TT   L RH   HT  K  HCSY GC   F +H
Sbjct: 165 FTCSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESFYKH 205

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 228 YICKVCSKGFTTSGHLARH-NRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREP 286
           + C++C   F +S HL RH N +H+ EK ++C  P C   F R D+  QH +     R+ 
Sbjct: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLKKKTPCRQK 619

Query: 287 YY 288
           +Y
Sbjct: 620 HY 621

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y C  C K F     L  H  IH G     C +P C  KF+   N ++HYR+H
Sbjct: 216 YCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSH 268

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           C + FT + HLARH R  TGEK   C    C   FSR DN  QH
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQCEV--CNRFFSRIDNLKQH 69

>Scas_711.56
          Length = 832

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + C +C K F  S  L  H R HTGEK  HC    C   F+   N  +H +TH K
Sbjct: 754 FKCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLK 806

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C K F+    L RH R+H+G K   CS   C   FS  +   QH RTH
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 748

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C +C K F+    L +H R H+GEK   C    C  +F+   +   H RTH
Sbjct: 726 FQCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTH 776

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 233 CSKGFTTSGHLARH-NRIH--TGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           CS  F+++  L  H   +H   G+ ++ C +  C+  FS+    V+H R H
Sbjct: 670 CSGSFSSAQELNIHMENMHLLKGQSQYECHWANCHKIFSQRQRLVRHMRVH 720

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           C   F+ + HLARH R HTGEK   C    C   FSR DN  QH  T
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDT 77

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 253 EKKHHCS-YPGCYLKFSRHDNCVQHYRTH 280
           EK   C+ YPGC + FSR ++  +H R H
Sbjct: 22  EKNFKCTGYPGCEMSFSRAEHLARHIRRH 50

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           ++C  C++GF    HL RH   HT EK + C +  C   F+R D  ++H
Sbjct: 151 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG-CYLKFSRHDNCVQHYR 278
           ++C +CS+GF    HL RH   HT EK   C   G C   F+R D  ++H +
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKC---FARKDLVLRHLQ 75

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           YIC  C K F+ S H  RH R H G K   C    C   F R D   +H RT
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQV--CKHSFVRRDLLQRHIRT 57

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 251 TGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
            G+KK+ CS+  C   FSR ++ ++H R+H  V+
Sbjct: 3   AGQKKYICSF--CLKPFSRSEHKIRHERSHAGVK 34

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 14/71 (19%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYL----------KFSRHDNCVQHY 277
           Y+C  C   F   G+L RH + H  EK +HC +    L           FSR D     Y
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDT----Y 217

Query: 278 RTHFKVREPYY 288
           +TH K R   Y
Sbjct: 218 KTHLKSRHFIY 228

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 228 YICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C+ C + F    HL RH R +H  EK   C    C   FSR DN  QH +TH
Sbjct: 389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           C VC K  +    L  H  IHTG+    C++ GC   F+   N ++H ++H + R
Sbjct: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310

>Kwal_14.2543
          Length = 711

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y C  C KGF TS  L  H R HTGEK   C    C  +F+   N  +H RTH
Sbjct: 634 YKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTH 684

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C  C K F+T   L +H R H+GEK + CS+  C   F+   +   H RTH
Sbjct: 608 CVHCLKTFSTQDILQQHMRTHSGEKPYKCSH--CGKGFATSSSLRIHIRTH 656

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 228 YIC--KVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y+C  + C +  T    L RH R+HT  K   C +  C   FS  D   QH RTH
Sbjct: 576 YVCGWENCGRVITQRQKLLRHLRVHTRYKPCKCVH--CLKTFSTQDILQQHMRTH 628

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHC 258
           CKVC K F  S +L++H R H  E+K+ C
Sbjct: 664 CKVCGKRFNESSNLSKHMRTH--ERKYKC 690

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 229 ICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           +C++C K F     L  H  +H  +K ++C + GC  +F+   N ++H R H
Sbjct: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>Scas_641.24
          Length = 532

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 14/71 (19%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYL----------KFSRHDNCVQHY 277
           +IC  C   F   G+L RH + H  EK +HC +    +           FSR D     Y
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDT----Y 238

Query: 278 RTHFKVREPYY 288
           +TH K R   Y
Sbjct: 239 KTHLKARHFVY 249

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKV 283
           + C  C+K F+ S H  RH R H G K   C    C   F R D   +H RT  ++
Sbjct: 12  HFCSFCNKAFSRSEHKTRHERSHAGVKPFECQV--CSHSFVRRDLLQRHIRTVHRI 65

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           C   FT   HLARH R HTGE+   C    C   FSR DN  QH  +
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHL--CLRFFSRLDNLKQHVES 72

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 32/71 (45%), Gaps = 14/71 (19%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHC-SYPG-------CY--LKFSRHDNCVQHY 277
           ++C  C   F   G+L RH + H  EK +HC  Y G       C+    FSR D     Y
Sbjct: 198 FVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRDT----Y 253

Query: 278 RTHFKVREPYY 288
           +TH K R   Y
Sbjct: 254 KTHMKARHLIY 264

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 14/71 (19%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYL----------KFSRHDNCVQHY 277
           ++C  C   F   G+L RH + H  EK +HC +    L           FSR D+    Y
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDS----Y 297

Query: 278 RTHFKVREPYY 288
           +TH + R   Y
Sbjct: 298 KTHLRSRHFIY 308

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C VC +  T    L  H  IHTGE    CS+PGC  +F+   N  +H  +H +
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKR 312

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 31/71 (43%), Gaps = 14/71 (19%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG--------CY--LKFSRHDNCVQHY 277
           +IC  C   F   G+L RH + H  EK +HC +          C+    FSR D     Y
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDT----Y 215

Query: 278 RTHFKVREPYY 288
           +TH K R   Y
Sbjct: 216 KTHLKARHVLY 226

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 232 VCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
            CSK FT    L RH ++H+G K   C  P C  KFS  D   QH RTH   R
Sbjct: 634 TCSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDILQQHIRTHSGER 684

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C+K F TS  L  H R HTGEK   C    C  +F+   N  +H +TH
Sbjct: 686 FKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTH 736

 Score = 34.7 bits (78), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C+K F+T   L +H R H+GE+   C+Y  C  +F+   +   H RTH
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHC 258
           CK+C K F  S +L++H + H  E+K+ C
Sbjct: 716 CKICGKRFNESSNLSKHMKTH--ERKYKC 742

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 29/67 (43%), Gaps = 14/67 (20%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG--------CYLK--FSRHDNCVQHY 277
           YIC  C   F   G+L RH + H   K +HC +          C+    FSR D     Y
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDT----Y 259

Query: 278 RTHFKVR 284
           +TH K R
Sbjct: 260 KTHLKSR 266

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 14/71 (19%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYL----------KFSRHDNCVQHY 277
           ++C  C   F   G+L RH + H  EK +HC +   ++           FSR D     Y
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDT----Y 207

Query: 278 RTHFKVREPYY 288
           +TH + R   Y
Sbjct: 208 KTHLRSRHFIY 218

>Scas_378.1
          Length = 208

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278
           Y C +C K F     L RH   H+ ++ + C  P C  K  R DN +QH +
Sbjct: 84  YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSC--PKCVSKHKRKDNLLQHLK 132

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 6/57 (10%)

Query: 228 YIC-KVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH-FK 282
           +IC ++CS+  T   HL+    IHTG+K + C    C+ +F+   N ++HY+ H FK
Sbjct: 344 HICGRICSRPSTLQTHLS----IHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEFK 396

>Scas_602.4d
          Length = 256

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C VC K  +    L  H  IHTG+    C+Y GC   F+   N  +H + H
Sbjct: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247

>Scas_656.1*
          Length = 102

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C +C K  T S  L  H  +HTG++   C +  C   F+   N  +HY+ H K
Sbjct: 42  CPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>Scas_660.12
          Length = 367

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG--------CY--LKFSRHDNCVQHY 277
           Y+C  C   F   G+L RH + H  EK +HC +          C+    FSR D     Y
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDT----Y 151

Query: 278 RTHFKVR 284
           +TH K R
Sbjct: 152 KTHLKAR 158

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C +C K ++TS  L  H R HTGEK   C  P C  +F+   N  +H RTH
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRTHTGEKPLSC--PICNKRFNESSNLAKHIRTH 770

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR---THFKVR 284
           Y C +C K F     L RH   H+  KK HC  P C     R DN +QH +   T + + 
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLKLKHTQYLLH 363

Query: 285 EPYYYG 290
           E   +G
Sbjct: 364 EFTLFG 369

>Scas_713.52
          Length = 620

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C K F    ++  H + H  +K + C +PGC   F R+ + V+H ++H
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSH 534

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 236 GFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
            FT + H ARH R HTGEK   C    C   FSR DN  QH
Sbjct: 2   AFTRAEHHARHIRKHTGEKPFQCDI--CMKFFSRIDNLKQH 40

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C VC K  +    L  H  IHTG+    C++  C   F+   N ++H ++H K
Sbjct: 286 CPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEK 338

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           Y C +C+K F  S  L  H R HTGEK   C    C  +F+   N  +H +TH K
Sbjct: 796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQK 848

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y CK C + F++   L +H R H+GEK + C    C  KF+   +   H RTH
Sbjct: 768 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCS 259
           CK+C K F  S +L++H  I T +KK+ CS
Sbjct: 826 CKICGKRFNESSNLSKH--IKTHQKKYKCS 853

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           Y+C +  C K ++    L +H R HT EK  HC  PGC   F R  +   H  +H KV+ 
Sbjct: 8   YVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSKVK- 66

Query: 286 PY 287
           PY
Sbjct: 67  PY 68

 Score = 35.0 bits (79), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 4/40 (10%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKK----HHCSYPGC 263
           Y C VC KGF T     RH + HT  +     + C Y GC
Sbjct: 68  YNCSVCGKGFATKQQFQRHQQTHTQNQDDTSTYQCGYYGC 107

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y C  C K F+T   L +H R+H+GEK + C    C+ +F+  ++   H RTH
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTH 647

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           Y C +C K F  S  L  H R HTGEK   C    C   F+   N  +H +TH K
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMK 677

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           Y C+   C+K F+    L RH ++H+  K + C  P C   FS  D   QH R H
Sbjct: 567 YTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVH 619

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 228 YICKV--CSKGFTTSGHLARH-NRIH--TGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + CK   C++ F ++G L  H   +H   G+ ++ C + GC   FS+    V+H + H K
Sbjct: 534 FCCKWAGCNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

Query: 283 VREPY 287
            + PY
Sbjct: 594 YK-PY 597

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C  C K F+T   LA+H R H+GE+  HC Y  C  +FS   +   H RTH
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           + C  C K F+TS  L  H R HTGEK   C+   C  +F+   N  +H + H
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIH 622

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           Y+C++  C + F+    LA+H   HT E+ + C  P C  +F R  +   H  TH +V+
Sbjct: 57  YVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPCHLRVHKWTHAQVK 115

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C +C K  +    L  H  IHTG+    C++  C   F+   N ++H RTH K
Sbjct: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 36.2 bits (82), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C +C K FT    L  H  IHT  K + C Y  C   F+   N  +H R H
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIH 168

>Scas_707.46
          Length = 338

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C VC K  +    L  H  IHTG+    C +  C   F+   N ++H ++H K
Sbjct: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C K F    ++  H + H  +K + C + GC   F R+ +  +H +TH K
Sbjct: 530 CGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C+K F    ++  H + H  ++ + C +PGC   F R+ + ++H ++H
Sbjct: 557 CTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSH 604

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%)

Query: 253 EKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPYYYGRP 292
           +K   C +PGC   F R  N   H +TH + R PY    P
Sbjct: 547 DKTFECLFPGCTKTFKRRYNIRSHIQTHLEDR-PYSCDHP 585

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C K F    ++  H + H  ++ + C Y GC   F R+ + V+H +TH
Sbjct: 563 CGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTH 610

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 253 EKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           ++ + C YP C   F R  N   H +TH + R PY
Sbjct: 553 DRMYECLYPQCGKTFKRRYNIRSHIQTHLEDR-PY 586

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           + CK   C K F    +   H + H  ++ + C +PGC   F R+ + ++H ++H +
Sbjct: 693 FQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLE 749

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 249 IHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           +  G K+  C +  C  +F+R  N   H +TH   R PY
Sbjct: 686 LEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDR-PY 723

>Kwal_56.23925
          Length = 745

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C K F    ++  H + H  ++ + C + GC+  F R+ + ++H +TH
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTH 639

>Scas_602.4
          Length = 266

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 24/53 (45%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           C  C K  +    L  H  IHTG+    C++  C   F+   N ++H + H K
Sbjct: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           Y+C V  C K ++    L +H R HT E+   C  PGC   F R  +   H  +H +V+
Sbjct: 8   YLCSVDGCGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQVK 66

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 230 CKVCSKGFTTSGHLARHNRIH 250
           C VCSKGFTT+  L+RH + H
Sbjct: 70  CPVCSKGFTTNQQLSRHKKTH 90

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 4/61 (6%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           ++C+   C KGF  + HL  H   H+  K   C  P C   F+ +    +H +TH  +  
Sbjct: 38  FVCEEPGCGKGFLRASHLKVHKWSHSQVKPLAC--PVCSKGFTTNQQLSRHKKTHKDLPS 95

Query: 286 P 286
           P
Sbjct: 96  P 96

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVRE 285
           C VC K  +    L  H  IHTG+    C +  C   F+   N ++H + H + ++
Sbjct: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQ 342

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 35.4 bits (80), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 21/49 (42%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y C +C K F+  G+LA H   H   +   C    C   FS+  N   H
Sbjct: 11  YECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 251 TGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           TGEK + C    C  +FSR  N   H  TH K+R
Sbjct: 6   TGEKPYECDI--CKKRFSRKGNLAAHKMTHGKIR 37

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278
           C+ C K F     L RH   H+ ++   C  P C  +  R DN +QH +
Sbjct: 348 CQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK 394

>Scas_693.31
          Length = 635

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           Y C    C K F  +  L RH ++H+ EK + C    C  KF+R D  + H
Sbjct: 519 YACDFPNCDKAFVRNHDLVRHKKVHS-EKSYACP---CGKKFNREDALIVH 565

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 23/48 (47%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C K F    +   H + H  ++ + C +P C   F R+ + V+H + H
Sbjct: 496 CGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVH 543

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 253 EKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           +K   C YP C   F R  N   H +TH + R PY
Sbjct: 486 DKTFECLYPNCGKHFKRRYNTRSHIQTHLEDR-PY 519

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRH 270
           + C  C KG  T   L RH   HT  K  +C Y GC   F +H
Sbjct: 95  FYCSFCGKGLITRQQLKRHEVTHT--KSFNCEYEGCNESFYKH 135

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG 262
           + C  C   FT   HL RH   HT E+  +CS+ G
Sbjct: 67  WKCNQCESSFTKKIHLERHLYTHTDERPFYCSFCG 101

>Kwal_26.8021
          Length = 507

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           Y C +C K F       RH   H+  K + C  P C  +  R DN  QH +T
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 229 ICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPYY 288
           IC +C K FT    L  H  IHT  K   CS+  C  +F+   N  +H R H +   P  
Sbjct: 168 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQKASPPL 225

Query: 289 YGRP 292
             +P
Sbjct: 226 ATKP 229

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C+K F    ++  H + H  ++ + C +PGC   F R+ + ++H  +H
Sbjct: 610 CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISH 657

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 253 EKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVREPY 287
           +K   C YP C   F R  N   H +TH + R PY
Sbjct: 600 DKLFECLYPNCNKVFKRRYNIRSHIQTHLQDR-PY 633

>Kwal_47.18337
          Length = 536

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 14/67 (20%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSY--------PGCYL--KFSRHDNCVQHY 277
           ++C  C+  F   G+L RH + H  EK ++C +          C+    FSR D     Y
Sbjct: 157 FVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDT----Y 212

Query: 278 RTHFKVR 284
           +TH + R
Sbjct: 213 KTHLRSR 219

>Scas_719.68
          Length = 1350

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG-CYLKFSRHDNCVQHYRTHF 281
           ++C +C++    + HL RH R HT EK   C + G C   F+R D  V  Y+T  
Sbjct: 41  FLCPICTR----TEHLKRHQRSHTREKPFVCVFCGRC---FARRD-LVLRYQTKL 87

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 35.0 bits (79), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSY------PGCYLKFSRHDNCVQHYRTHFKVR 284
           C+K F+   HL+RH   H  ++ + CSY        C   F R D  ++H + H KV+
Sbjct: 38  CNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSKVK 95

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 33.5 bits (75), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 22/51 (43%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C VC K FT    L  H  IH   + + C Y  C   F+   N  +H R H
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

 Score = 30.8 bits (68), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHH 257
           Y+C    C+K F    +L RH RIH G + HH
Sbjct: 104 YLCDYANCNKSFNVKSNLNRHLRIHRGHELHH 135

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 35.0 bits (79), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 228 YICK--VCSKGFTTSGHLARHNRIHTGEKKHHCSY------PGCYLKFSRHDNCVQHYRT 279
           Y+C    CSK FT   HL+RH   H  ++   C Y        C   F R D  V+H + 
Sbjct: 16  YVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKR 75

Query: 280 H 280
           H
Sbjct: 76  H 76

>Scas_717.60d
          Length = 167

 Score = 33.5 bits (75), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 1/50 (2%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHY 277
           + CK CSK F TS  L +H +    ++   C Y  C   F R D    HY
Sbjct: 99  FNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEY-NCGKAFKRKDQRKSHY 147

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           C K +     L +H   HT +K +HC  PGC  KF R  +   H  TH +++
Sbjct: 19  CEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIK 70

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRH 270
           + C  C KG TT   L RH   HT  K   C   GC L+F +H
Sbjct: 108 FQCSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKH 148

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG 262
           + C  C+K F    HL RH   H+  K   CSY G
Sbjct: 80  FQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCG 114

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 33.1 bits (74), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 251 TGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKV 283
           TGEK+  C+   C L+FSR  +  +H +THF +
Sbjct: 93  TGEKRFKCAK--CSLEFSRSSDLRRHEKTHFAI 123

 Score = 31.2 bits (69), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           + C  CS  F+ S  L RH + H     + C  P C   F+R D   +HY T
Sbjct: 98  FKCAKCSLEFSRSSDLRRHEKTHFAILPNIC--PQCGKGFARKDALKRHYDT 147

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 14/71 (19%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG--------CY--LKFSRHDNCVQHY 277
           ++C  C   F   G+L RH + H  +K ++C Y          C+    FSR D     Y
Sbjct: 41  FVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDT----Y 96

Query: 278 RTHFKVREPYY 288
           + H K R   Y
Sbjct: 97  KAHMKTRHIMY 107

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278
           C  C K F     L RH   H+  K + C  P C+ +  R DN  QH +
Sbjct: 187 CHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLK 233

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 32.3 bits (72), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           Y C  C   F+ S  L RH ++H+    H CS   C   F+R D   +H  T
Sbjct: 95  YSCAKCQLKFSRSSDLRRHEKVHSLVLPHICS--NCGKGFARKDALKRHSNT 144

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280
           C K F    ++  H + H  ++   C + GC   F R+ + ++H +TH
Sbjct: 681 CGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTH 728

>Scas_712.2
          Length = 327

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           Y C+   C + FT    L +H   HT E+ + C   GC  +F R  +   H  TH KV+
Sbjct: 13  YKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHSKVK 71

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 228 YICKV--CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282
           YIC V  C K F    HL  H   H+  K   C++  C   F  +    +H  TH K
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAK 97

>ABR240W [834] [Homologous to ScYLR079W (SIC1) - SH]
           complement(847499..848182) [684 bp, 227 aa]
          Length = 227

 Score = 32.0 bits (71), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 3/80 (3%)

Query: 77  NNRSRDNSIPEMNYPNSSQNPSPILTNNTYSTQNSNDISSANTPPSNVQLPTIWSTVPRR 136
            +RSR     EM  P  +     +LT  T   +    ++   TP   V+ P      PRR
Sbjct: 8   RSRSRRADQDEMATPRRAVTGGGLLTPGTVGCKGEAGVARPRTPEGEVRSP---EQTPRR 64

Query: 137 IPLEPTTLSKVGSMSSLMLP 156
                  L ++G+ + ++ P
Sbjct: 65  AGRRAGALDELGTTARVLFP 84

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278
           C +C K F     L RH   H+ ++   C  P C  +  R DN +QH +
Sbjct: 536 CHLCPKLFKRKSWLKRHLLSHSQQRHFLC--PWCNSRHKRRDNLLQHMK 582

>Kwal_23.5400
          Length = 429

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG 262
           + C VC++ F+   HL RH   H+ +K   CSY G
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCG 115

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRH 270
           + C  C KG TT   L RH   HT  +   C + GC   F +H
Sbjct: 109 FKCSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESFYKH 149

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 228 YICKVCSKGFTTSGHLARHNRIH 250
           + C+VCS+GF  S  L RH ++H
Sbjct: 411 FKCEVCSRGFARSNDLIRHKKLH 433

>Scas_627.6
          Length = 1207

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 8/65 (12%)

Query: 228 YICK--VCSKGFTTSGHLARHNRIHTGEKKHHCSY------PGCYLKFSRHDNCVQHYRT 279
           YIC    C+K FT   HL+RH   H  ++   C +        C   F R D  ++H + 
Sbjct: 42  YICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQKR 101

Query: 280 HFKVR 284
           H K +
Sbjct: 102 HTKSK 106

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           Y C  C   F  S  L RH R H     + CS   C   F+R D   +HY T
Sbjct: 125 YQCDKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHYDT 174

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG 262
           + C+ C + F    HL  H R H G+K + C Y G
Sbjct: 614 FECQYCHRCFAQVTHLDVHIRSHLGKKPYQCEYCG 648

>Sklu_2154.3 , Contig c2154 4677-5249 reverse complement
          Length = 190

 Score = 31.2 bits (69), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 10/61 (16%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSY--PGCYL----KFSRHDNCVQHYRTHF 281
           + C  C   F   G+L RH + H   K +HC Y  P C      +FSR D     ++TH 
Sbjct: 78  FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHL 133

Query: 282 K 282
           K
Sbjct: 134 K 134

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           + C  C   F  SG L RH ++H     + CS   C   F+R D   +H+ T
Sbjct: 147 FHCTKCELVFRRSGDLRRHEKVHLPILPNICSL--CGKGFARKDALKRHFGT 196

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEK 254
           ++C VC +GF     + RH ++H  +K
Sbjct: 291 FVCSVCQRGFVRQNDVMRHEKMHWKDK 317

>AFR531W [3723] [Homologous to ScAFR531W]
           complement(1389487..1390311) [825 bp, 274 aa]
          Length = 274

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 10/61 (16%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSY--PGCYL----KFSRHDNCVQHYRTHF 281
           Y C  C   F   G+L RH + H   K   C Y    C      +FSR D     +RTH 
Sbjct: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211

Query: 282 K 282
           K
Sbjct: 212 K 212

>Kwal_27.10167
          Length = 285

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 14/21 (66%)

Query: 230 CKVCSKGFTTSGHLARHNRIH 250
           C+ CSKGFTT   L+RH   H
Sbjct: 97  CEECSKGFTTKQQLSRHLATH 117

>Scas_568.5
          Length = 199

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 2/52 (3%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRT 279
           Y C  C   F  S  L RH + H     H CS   C   F+R D   +H+ T
Sbjct: 118 YPCSKCELIFLRSSDLRRHEKAHLLVLPHICSQ--CGKGFARKDALKRHFNT 167

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG 262
           Y C+ C +GFT   HL RH   H+  K   C+  G
Sbjct: 150 YQCEQCGRGFTKKSHLERHLFSHSETKPFSCTVCG 184

>Kwal_34.15946
          Length = 279

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 10/61 (16%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPG----CYL--KFSRHDNCVQHYRTHF 281
           + C  C   F   G+L RH + H   K   C +      C+   +FSR D     Y+TH 
Sbjct: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228

Query: 282 K 282
           K
Sbjct: 229 K 229

>Scas_631.7
          Length = 433

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 2/43 (4%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRH 270
           + C  C KG TT   L RH   HT   K  C Y  C   + +H
Sbjct: 116 FCCLHCGKGVTTRQQLKRHEVTHTKSFK--CPYENCDEAYYKH 156

>CAGL0L06622g complement(743602..747015) similar to sp|P17442
           Saccharomyces cerevisiae YGR233c PHO81 cyclin-dependent
           kinase inhibitor, start by similarity
          Length = 1137

 Score = 29.6 bits (65), Expect = 3.8,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

Query: 90  YPNSSQNPSPILTNNTYSTQNSNDISSANTPPSNVQLPTIWSTVPRRIPLEPTTLSKVGS 149
           YP++ +N S  +  + + T  +  I+   TPPS +   ++  T   +IPL    LS +G+
Sbjct: 741 YPDTLENFS--IQFDVFPTTGNRLIARTVTPPSFLLSSSMNGTNSLKIPLVDLKLSVIGT 798

Query: 150 MS-SLMLPNPNVNTNLQPTGTSP 171
           +S    +  P   T+L+ T   P
Sbjct: 799 LSVEYQVIQPFSGTSLKVTECEP 821

>KLLA0F13420g 1240135..1244145 gi|3002789|gb|AAC39438.1
           Kluyveromyces lactis silent information regulator 4,
           start by similarity
          Length = 1336

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 58  RHLSLWHPSNNFTTGPIENNNR 79
           R+L L  PSNNF + P+  NNR
Sbjct: 647 RYLELESPSNNFISKPLRANNR 668

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 230 CKVCSKGFTTSGHLARHNRIH 250
           C VCS+GF  S  L RH + H
Sbjct: 190 CSVCSRGFARSNDLLRHKKRH 210

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHF 281
           C+       H+  H R+H   K   CS   C  KF R  +  +H R H 
Sbjct: 95  CNTKTVKRDHITSHLRVHVPLKPFGCST--CGKKFKRPQDLKKHLRVHL 141

>Kwal_26.9300
          Length = 304

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCS 259
           + C VC +GFT    L RH + H  ++ + CS
Sbjct: 173 HKCPVCGRGFTRHNDLLRHRKRHWKDEDNSCS 204

>Scas_604.4
          Length = 585

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 6/58 (10%)

Query: 233 CSKGFTTSGHLARH-NRIHTGEKKH-----HCSYPGCYLKFSRHDNCVQHYRTHFKVR 284
           C K FT    L  H  + H G K       +C +  C+ K  + D+   H R H  ++
Sbjct: 188 CDKAFTMPELLYHHLCQDHVGRKSEKNLQLNCHWGSCFTKTVKRDHITSHLRVHVPLK 245

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 13/21 (61%)

Query: 230 CKVCSKGFTTSGHLARHNRIH 250
           C +CS+GF  S  L RH + H
Sbjct: 156 CDICSRGFARSNDLQRHKKRH 176

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 28.1 bits (61), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 228 YICK--VCSKGFTTSGHLARHNRIHTGEKKHHCSY----PG--CYLKFSRHDNCVQHYRT 279
           Y+C    C K F+   HL RH   H  ++   C Y     G  C   F R D  V+H R 
Sbjct: 18  YVCPHPDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQRR 77

Query: 280 H 280
           H
Sbjct: 78  H 78

>Scas_636.14d
          Length = 275

 Score = 28.1 bits (61), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           C  C K + T     +H +    E+KH C +  C   F R D+ ++H
Sbjct: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 6/54 (11%)

Query: 233 CSKGFTTSGHLARHNRIHTGEKKHHCSYPG------CYLKFSRHDNCVQHYRTH 280
           C K F+   HL+RH   H  ++   C Y        C   F R D   +H + H
Sbjct: 52  CDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEKRH 105

>Scas_627.17d
          Length = 275

 Score = 27.7 bits (60), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276
           C  C K + T     +H +    E+KH C +  C   F R D+ ++H
Sbjct: 217 CPHCQKTYLTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,926,122
Number of extensions: 519037
Number of successful extensions: 3969
Number of sequences better than 10.0: 410
Number of HSP's gapped: 3632
Number of HSP's successfully gapped: 542
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)