Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_569.124124111951e-168
YDR041W (RSM10)2031826243e-82
Sklu_2357.42041945949e-78
CAGL0K12056g2351855882e-76
Kwal_27.105452021875774e-75
AGR035C2071895541e-71
KLLA0F18436g2071905175e-66
Scas_550.742157690.72
Scas_699.10105035662.2
Scas_720.63110835617.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_569.1
         (241 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_569.1                                                            464   e-168
YDR041W (RSM10) [894] chr4 (539798..540409) Component of the mit...   244   3e-82
Sklu_2357.4 YDR041W, Contig c2357 5034-5648                           233   9e-78
CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces...   231   2e-76
Kwal_27.10545                                                         226   4e-75
AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH] (773294..7...   218   1e-71
KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomy...   203   5e-66
Scas_550.7                                                             31   0.72 
Scas_699.10                                                            30   2.2  
Scas_720.63                                                            28   7.8  

>Scas_569.1
          Length = 241

 Score =  464 bits (1195), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 227/241 (94%), Positives = 227/241 (94%)

Query: 1   MWRSTVPKLKLTNTCLLKRSIPLQARFIASTSTIPTNDISIDKPPIEKIRNQPVDAPIVP 60
           MWRSTVPKLKLTNTCLLKRSIPLQARFIASTSTIPTNDISIDKPPIEKIRNQPVDAPIVP
Sbjct: 1   MWRSTVPKLKLTNTCLLKRSIPLQARFIASTSTIPTNDISIDKPPIEKIRNQPVDAPIVP 60

Query: 61  INIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPLPT 120
           INIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPLPT
Sbjct: 61  INIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPLPT 120

Query: 121 RRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMKCT 180
           RRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMKCT
Sbjct: 121 RRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMKCT 180

Query: 181 VFQRSPIASKEDATNGXXXXXXXXXXXXXXNQKDDVKLTDNDLVNEKIVELLGREEFKKY 240
           VFQRSPIASKEDATNG              NQKDDVKLTDNDLVNEKIVELLGREEFKKY
Sbjct: 181 VFQRSPIASKEDATNGVSSSDSSSVLKSIVNQKDDVKLTDNDLVNEKIVELLGREEFKKY 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>YDR041W (RSM10) [894] chr4 (539798..540409) Component of the
           mitochondrial ribosomal small subunit [612 bp, 203 aa]
          Length = 203

 Score =  244 bits (624), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 116/182 (63%), Positives = 139/182 (76%), Gaps = 2/182 (1%)

Query: 60  PINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPLP 119
           P+N++AVY+APL+ PIKYGDLVA+IQLRSYDNENLDFYSDF LR G+YLGIPLTGPKPLP
Sbjct: 21  PVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLP 80

Query: 120 TRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMKC 179
           TRRERWTVIKSPFVHAKSKENFERHTHKR+I+ WDTN E+++M I+YITKH+MAGVGMKC
Sbjct: 81  TRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKC 140

Query: 180 TVFQRSPIASKEDATNGXXXXXXXXXXXXXXNQKDDVKLTDNDLVNEKIVELLGREEFKK 239
             FQRS I+    +                  + DD   T    V +K++ELL   +FKK
Sbjct: 141 NFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQT--SAVGQKVLELLDSPDFKK 198

Query: 240 YI 241
           ++
Sbjct: 199 HL 200

>Sklu_2357.4 YDR041W, Contig c2357 5034-5648
          Length = 204

 Score =  233 bits (594), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 140/194 (72%), Gaps = 14/194 (7%)

Query: 50  RNQPVDAP--IVPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFY 107
           R Q   AP    PIN+ AVYHAPL+ PI +GDLVA++QLRSYDNENLDF+SDF LR GFY
Sbjct: 23  RFQSTVAPPNAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFSDFILRAGFY 82

Query: 108 LGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYI 167
           LG+PLTGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKR+I+VWDTN E+IE+W+SY+
Sbjct: 83  LGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVIELWLSYL 142

Query: 168 TKHAMAGVGMKCTVFQRSPIASKEDATNGXXXXXXXXXXXXXXNQKDDVKLTDNDLVNEK 227
           TKH++ GVG+KC V+QR  +   +                   N K     T ++ V E+
Sbjct: 143 TKHSIPGVGIKCNVYQREGVRLSDSIDTS-------VLPELEGNTK-----TLDEAVGER 190

Query: 228 IVELLGREEFKKYI 241
           +VELL   EFKK+I
Sbjct: 191 VVELLNDPEFKKHI 204

>CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces
           cerevisiae YDR041w RSM10, hypothetical start
          Length = 235

 Score =  231 bits (588), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 103/185 (55%), Positives = 141/185 (76%), Gaps = 7/185 (3%)

Query: 57  PIVPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPK 116
           P +P+N++A+Y+APL+NP+ +G LVA++QLR+YDNENLDF+ DF LR G+YLG+P+TGPK
Sbjct: 55  PQLPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPK 114

Query: 117 PLPTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVG 176
           PLPTRRERWTVI+SPFVHAKSKENFERHTHKR+I+VWD+N E+++M + YITK+++AGVG
Sbjct: 115 PLPTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVG 174

Query: 177 MKCTVFQRSPIASKEDATNGXXXXXXXXXXXXXXNQKDDVKLTDNDLVNEKIVELLGREE 236
           +KCT +QR+ +    DA +G                  +  L +N+ +  K+VELL    
Sbjct: 175 LKCTTYQRTTV----DAKSG---KISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPT 227

Query: 237 FKKYI 241
           FKKY+
Sbjct: 228 FKKYL 232

>Kwal_27.10545
          Length = 202

 Score =  226 bits (577), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 104/187 (55%), Positives = 138/187 (73%), Gaps = 12/187 (6%)

Query: 53  PVDAPIVPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPL 112
           P  A  +PIN++AVY+APLR PI +GDL+A++QLRSYD+ENLDF++DF LR GFYLG+PL
Sbjct: 26  PNVAKKLPINVEAVYYAPLRIPITHGDLIADLQLRSYDHENLDFFADFILRAGFYLGMPL 85

Query: 113 TGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAM 172
           TGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKR+I+VWDTN E++E+W+SYI+KH++
Sbjct: 86  TGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVVELWLSYISKHSI 145

Query: 173 AGVGMKCTVFQRSPIASKEDATNGXXXXXXXXXXXXXXNQKDDVKLTDNDLVNEKIVELL 232
            GVG+KC +FQ+  +   ++                   Q      + ++ V E+++ELL
Sbjct: 146 PGVGIKCNLFQKEGLQLSQNLEQNSLL------------QSPGKSNSLDEAVGERVLELL 193

Query: 233 GREEFKK 239
             E FKK
Sbjct: 194 NSENFKK 200

>AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH]
           (773294..773917) [624 bp, 207 aa]
          Length = 207

 Score =  218 bits (554), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 138/189 (73%), Gaps = 26/189 (13%)

Query: 59  VPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPL 118
           +P ++ A+Y  PL+ P+K+ DLVA++QLR++DN++LDF+++FALRVG+YLGIP+TGPKPL
Sbjct: 39  LPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPL 98

Query: 119 PTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMK 178
           PTRRERWTVI++PF HAKSKENFERHTHKR++++WD N E++EM++SYITKH+MAGVGMK
Sbjct: 99  PTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMK 158

Query: 179 CTVFQRSPIASKEDATNGXXXXXXXXXXXXXXNQKDDVKL------TDNDLVNEKIVELL 232
           C +FQR  +   ++                      DV L      T +++V  K+ EL+
Sbjct: 159 CNMFQRESVQLAQELA--------------------DVPLAPGAPQTADEVVGAKVAELM 198

Query: 233 GREEFKKYI 241
              EFKK++
Sbjct: 199 QSPEFKKHL 207

>KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomyces
           cerevisiae YDR041w RSM10 component of the mitochondrial
           ribosomal small subunit, hypothetical start
          Length = 207

 Score =  203 bits (517), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 136/190 (71%), Gaps = 24/190 (12%)

Query: 59  VPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPL 118
           +P  ++AVYHAPL+    + DL+A+IQLRSYDNENLDF+S F LR G+YLGIP+ GPKPL
Sbjct: 34  IPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPL 93

Query: 119 PTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMK 178
           PT+R+RWTVI++PFV AKSKENFERHTH R+I+++D N+EL+E  +SYI+KH ++GVG+K
Sbjct: 94  PTKRKRWTVIRAPFVMAKSKENFERHTHARLIRLYDCNTELVETLLSYISKHGISGVGIK 153

Query: 179 CTVFQRSPI--ASKEDATNGXXXXXXXXXXXXXXNQKDDVKLTD-----NDLVNEKIVEL 231
           C ++QR PI   SK+D                   + +++ ++      +D+V  K+VEL
Sbjct: 154 CNLYQREPIDLDSKKDGP-----------------ELENIDISSQLQGLDDVVGAKVVEL 196

Query: 232 LGREEFKKYI 241
           L   EFKK++
Sbjct: 197 LNNPEFKKHL 206

>Scas_550.7
          Length = 421

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 8/57 (14%)

Query: 58  IVPIN--IKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPL 112
           IV IN  ++ + +AP +    Y      I   SYD+ +L+ YSD A  VG +LGIPL
Sbjct: 163 IVIINSVLQMILYAPYQIFFSY-----VITGTSYDH-HLNIYSDVAKSVGVFLGIPL 213

>Scas_699.10
          Length = 1050

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 63  IKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFY 97
           +KA+Y  P   P  Y +LV+E   R Y+++  + Y
Sbjct: 132 MKALYKYPFAKPFPYEELVSENSRRGYNDKEFEIY 166

>Scas_720.63
          Length = 1108

 Score = 28.1 bits (61), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 63  IKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFY 97
           +KA+Y  P   P  Y  LV E   R Y+++  + Y
Sbjct: 132 MKALYKYPFTQPFPYEQLVEENAKRGYEDKEFEVY 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,051,851
Number of extensions: 343994
Number of successful extensions: 802
Number of sequences better than 10.0: 10
Number of HSP's gapped: 796
Number of HSP's successfully gapped: 10
Length of query: 241
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 142
Effective length of database: 13,168,927
Effective search space: 1869987634
Effective search space used: 1869987634
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)