Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_563.112162168971e-124
YGL061C (DUO1)2472423725e-44
Kwal_14.18092231603227e-37
CAGL0F06963g2122193034e-34
KLLA0C05742g2081562678e-29
AAR161W2091462651e-28
AFR132C25428642.3
KLLA0D08118g161748652.3
Sklu_1487.140850624.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_563.11
         (216 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_563.11                                                           350   e-124
YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein co...   147   5e-44
Kwal_14.1809                                                          128   7e-37
CAGL0F06963g complement(683862..684500) similar to sp|P53168 Sac...   121   4e-34
KLLA0C05742g 511607..512233 some similarities with sp|P53168 Sac...   107   8e-29
AAR161W [349] [Homologous to ScYGL061C (DUO1) - SH] complement(6...   106   1e-28
AFR132C [3324] [Homologous to ScYHR185C (PFS1) - SH] (674319..67...    29   2.3  
KLLA0D08118g complement(691907..696760) weakly similar to sp|P53...    30   2.3  
Sklu_1487.1 YPR108W, Contig c1487 176-1402                             28   4.0  

>Scas_563.11
          Length = 216

 Score =  350 bits (897), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 175/216 (81%)

Query: 1   MSKEQLDDSTINKLIPQIFAQMRSNFXXXXXXXXXXXXNQVHRSNITTQSLLNELESLDK 60
           MSKEQLDDSTINKLIPQIFAQMRSNF            NQVHRSNITTQSLLNELESLDK
Sbjct: 1   MSKEQLDDSTINKLIPQIFAQMRSNFDTATSSSSITDSNQVHRSNITTQSLLNELESLDK 60

Query: 61  IITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKFA 120
           IITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKFA
Sbjct: 61  IITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKFA 120

Query: 121 HEQLVTGDTTTADEYLNLEQEEVEKLKRQLELEQQKKHAQQNVXXXXXXXRGREXXXXXX 180
           HEQLVTGDTTTADEYLNLEQEEVEKLKRQLELEQQKKHAQQNV       RGRE      
Sbjct: 121 HEQLVTGDTTTADEYLNLEQEEVEKLKRQLELEQQKKHAQQNVSNSSSSSRGREKNSINK 180

Query: 181 XXXXXXXXXXXXXXXXGIPTRLARPTASSSRKMFRE 216
                           GIPTRLARPTASSSRKMFRE
Sbjct: 181 SNSNIRRSVPVRSRPSGIPTRLARPTASSSRKMFRE 216

>YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein
           component of Dad1p-Duo1p-Dam1p complex
           (Dad1p-Duo1p-Dam1p-Ask1p-Spc19p-Spc34p-Dad2p), required
           for maintenance of metaphase and anaphase spindle
           integrity [744 bp, 247 aa]
          Length = 247

 Score =  147 bits (372), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 127/242 (52%), Gaps = 31/242 (12%)

Query: 5   QLDDSTINKLIPQIFAQMRSNFXXX-----------XXXXXXXXXNQVHRSN-ITTQSLL 52
           QLDDSTI+KLIPQIF +MRSN                        N +   N ITTQSLL
Sbjct: 6   QLDDSTIDKLIPQIFNEMRSNLNNTTNKFPKSTGGGASDNISANSNSIRSFNSITTQSLL 65

Query: 53  NELESLDKIITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMS 112
            E ESLDKI  M++N+   LKN  P +++++H VC+STN+ILDSWINI SQAGYI++LMS
Sbjct: 66  KESESLDKITAMIKNVTAALKNNLPVYVNQVHEVCKSTNSILDSWINIHSQAGYIHKLMS 125

Query: 113 DPLYLKFAHEQLVTGDTTTADE-------YLNLEQEEVEKLKRQLELEQQKKHA------ 159
           D  YLK  +++L   +  T DE        + L+++E+  L+++LE  + +K A      
Sbjct: 126 DQTYLKLINDRLHNENVNTNDEDGSTLHNVIALKKKEILDLRQKLENRKGEKDAAPAKPP 185

Query: 160 QQNVXXXXXXXRGREXXXXXXXXXXXXXXXX---XXXXXXGIP---TRLARPTASSSRKM 213
            Q +        GR                          GIP    R  +PTASSSRKM
Sbjct: 186 NQGLNPRYGVQSGRRPVPSAGISNNGRVRKTHVPASKRPSGIPRVTNRWTKPTASSSRKM 245

Query: 214 FR 215
           FR
Sbjct: 246 FR 247

>Kwal_14.1809
          Length = 223

 Score =  128 bits (322), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (62%), Gaps = 10/160 (6%)

Query: 1   MSKEQLDDSTINKLIPQIFAQMRSNFXXXXXXXXXXX-XNQVHRSNITTQSLLNELESLD 59
           M+ E LD S INKLIP+IF QMRSN              +Q   S+ITTQSLL E +SLD
Sbjct: 1   MNDETLDRSNINKLIPEIFDQMRSNLSIAPSTKGARPFLSQKATSSITTQSLLEESKSLD 60

Query: 60  KIITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKF 119
           KII ++Q L+++L  + P+H+ RI   C+S+N ILD+WI IQSQAGY   LMSD  YL++
Sbjct: 61  KIIPVIQKLERSLSTSGPQHLRRIKKTCESSNKILDTWIKIQSQAGYAYELMSDESYLEY 120

Query: 120 AHEQLVTG----DTTTADEYLNLEQEEVEKLKRQLELEQQ 155
                VT     ++ T + ++  +Q  V+ L++ LE EQ+
Sbjct: 121 -----VTAAQKDESLTPEAFIRRKQAHVDDLRQSLEKEQR 155

>CAGL0F06963g complement(683862..684500) similar to sp|P53168
           Saccharomyces cerevisiae YGL061c DUO1 essential mitotic
           spindle protein, hypothetical start
          Length = 212

 Score =  121 bits (303), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 113/219 (51%), Gaps = 16/219 (7%)

Query: 4   EQLDDSTINKLIPQIFAQMRSNFXXXXXXXXXXXXNQVHRSNITTQSLLNELESLDKIIT 63
           E LD+S IN+LIP+IF QMR N              +    +ITTQSLL ELE+LDK+I 
Sbjct: 3   ESLDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVE-ESGSITTQSLLRELETLDKVIA 61

Query: 64  MVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKFAHEQ 123
            ++++D  +K A P H+++IHHVC+STN +LD+WINIQSQAGY + +M      K     
Sbjct: 62  TIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQAGYAHHIMDSRTGSK----- 116

Query: 124 LVTGDTTTADEYLNLEQEEVEKLKRQLELEQQKKHAQQ----NVXXXXXXXRGREXXXXX 179
             TG  +  +E +   ++E+ +L++ +++E+ K    Q              G       
Sbjct: 117 --TGSNSN-EEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPTGQRLYGNSYRQPT 173

Query: 180 XXXXXXXXXXXXXXXXXGIP---TRLARPTASSSRKMFR 215
                            GIP   +RL RPTASS+ K  R
Sbjct: 174 GRVTKATALRNARNRPSGIPQISSRLTRPTASSNLKRQR 212

>KLLA0C05742g 511607..512233 some similarities with sp|P53168
           Saccharomyces cerevisiae YGL061c DUO1 essential mitotic
           spindle protein singleton, hypothetical start
          Length = 208

 Score =  107 bits (267), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 97/156 (62%), Gaps = 24/156 (15%)

Query: 1   MSKEQLDDSTINKLIPQIFAQMR-----SNFXXXXXXXXXXXXNQVHRSNITTQSLLNEL 55
           M + +LD STI+K+IPQIF QMR      NF                 ++I+TQSLL E 
Sbjct: 1   MVEHKLDASTISKMIPQIFDQMRRQTGSKNFASTP-------------ASISTQSLLKEQ 47

Query: 56  ESLDKIITMVQNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPL 115
           E LDKII ++QNL++ +K+     ++RI   C + NTILD +I+IQSQA Y+N +M++  
Sbjct: 48  EQLDKIIPVIQNLNERIKDCKEGDMERIKETCHAMNTILDKFISIQSQASYVNSMMNNEE 107

Query: 116 YLKFAHEQLVTGDTTTADEYLNLEQEEVEKLKRQLE 151
           YL +    + +G   + +EY++ +Q EVE+L+++++
Sbjct: 108 YLDY----VASGK--SEEEYISAKQREVEELEKRVK 137

>AAR161W [349] [Homologous to ScYGL061C (DUO1) - SH]
           complement(633395..634024) [630 bp, 209 aa]
          Length = 209

 Score =  106 bits (265), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 89/146 (60%), Gaps = 8/146 (5%)

Query: 6   LDDSTINKLIPQIFAQMRSNFXXXXXXXXXXXXNQVHRSNITTQSLLNELESLDKIITMV 65
           +D + +++LIPQIF QMR+N                  + ++T +LL E+E LD+II ++
Sbjct: 26  VDSAALDELIPQIFDQMRTNQLDGSGAAAWGT------AAVSTATLLKEMEQLDQIIPVL 79

Query: 66  QNLDKTLKNATPKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLMSDPLYLKFAHEQLV 125
           Q L+++L+ +T +++ RI   C++ N +LD+WI IQSQAGY+  LM D  YL +  +   
Sbjct: 80  QQLNESLRRSTGENLSRIRRTCEAVNRVLDTWIKIQSQAGYVGELMDDSEYLSYMEK--T 137

Query: 126 TGDTTTADEYLNLEQEEVEKLKRQLE 151
            GD      Y+   +++VE+L+R+++
Sbjct: 138 RGDEGQQQAYMESLRKQVEELRRKVD 163

>AFR132C [3324] [Homologous to ScYHR185C (PFS1) - SH]
           (674319..675083) [765 bp, 254 aa]
          Length = 254

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 117 LKFAHEQLVTGDTTTADEYLNLEQEEVE 144
           +   HE+ +T D  + DEY+N E++E +
Sbjct: 175 IHIVHEEYLTHDCYSIDEYMNWEEDEFD 202

>KLLA0D08118g complement(691907..696760) weakly similar to sp|P53886
            Saccharomyces cerevisiae YNL172w APC1 subunit of
            anaphase-promoting complex (cyclosome) singleton, start
            by similarity
          Length = 1617

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 66   QNLDKTLKNAT--PKHIDRIHHVCQSTNTILDSWINIQSQAGYINRLM 111
            ++ D + K+ T  PK I+++ ++  S N + + W+ + SQ G +  LM
Sbjct: 1121 RSFDFSFKSGTMDPKIIEKLVNIVVSVNDVGEDWMPVNSQLGALIALM 1168

>Sklu_1487.1 YPR108W, Contig c1487 176-1402
          Length = 408

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 116 YLKFAHEQLVTGDTTTADEYL-----NLEQEEVEKLKRQLELEQQKKHAQ 160
           Y KF +E+ +   T T D+ L     N  QEE+ +LK+QL+  ++K   +
Sbjct: 56  YYKFLYEEYLPKGTITWDDALYKSSLNQNQEEIAELKKQLQQIEEKDEGE 105

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.128    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,324,570
Number of extensions: 187670
Number of successful extensions: 1473
Number of sequences better than 10.0: 53
Number of HSP's gapped: 1464
Number of HSP's successfully gapped: 54
Length of query: 216
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 119
Effective length of database: 13,238,163
Effective search space: 1575341397
Effective search space used: 1575341397
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)