Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_563.1066666632980.0
YGL060W (YBP2)64164912771e-168
Scas_686.1966364911591e-150
YBR216C (YBP1)67467711091e-143
Kwal_14.181268468110891e-139
CAGL0K06743g6556668381e-102
KLLA0C05698g7026838291e-101
AAR159C6136537345e-88
CAGL0F06985g6306765819e-66
ABL007W24199665.9
CAGL0I03674g44581667.0
CAGL0I07997g78461667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_563.10
         (666 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_563.10                                                          1274   0.0  
YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...   496   e-168
Scas_686.19                                                           451   e-150
YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...   431   e-143
Kwal_14.1812                                                          424   e-139
CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...   327   e-102
KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...   323   e-101
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   287   5e-88
CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...   228   9e-66
ABL007W [585] [Homologous to ScYGR057C (LST7) - SH] complement(3...    30   5.9  
CAGL0I03674g 313907..315244 highly similar to sp|Q12250 Saccharo...    30   7.0  
CAGL0I07997g 780417..782771 similar to sp|Q12387 Saccharomyces c...    30   7.3  

>Scas_563.10
          Length = 666

 Score = 1274 bits (3298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/666 (94%), Positives = 632/666 (94%)

Query: 1   MSDEESIDTESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSL 60
           MSDEESIDTESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSL
Sbjct: 1   MSDEESIDTESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSL 60

Query: 61  LNDNPHILREISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXX 120
           LNDNPHILREISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPK   
Sbjct: 61  LNDNPHILREISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKECL 120

Query: 121 XXXXXXXXXXTVEPVMXXXXXXXXXXXXXXXXXXXXXPTDLNSSDYIERDLTEFIPSLKV 180
                     TVEPVM                     PTDLNSSDYIERDLTEFIPSLKV
Sbjct: 121 LAACELLSELTVEPVMENETEEEEGGKDNKKTDGDETPTDLNSSDYIERDLTEFIPSLKV 180

Query: 181 YAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDV 240
           YAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDV
Sbjct: 181 YAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDV 240

Query: 241 HAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESL 300
           HAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESL
Sbjct: 241 HAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESL 300

Query: 301 THQKFEESEHYAVIRTQYLGLVNKYKIDIKEEFLQCLQESRQIYESLPSDIDESDEKKKS 360
           THQKFEESEHYAVIRTQYLGLVNKYKIDIKEEFLQCLQESRQIYESLPSDIDESDEKKKS
Sbjct: 301 THQKFEESEHYAVIRTQYLGLVNKYKIDIKEEFLQCLQESRQIYESLPSDIDESDEKKKS 360

Query: 361 ALNQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYL 420
           ALNQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYL
Sbjct: 361 ALNQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYL 420

Query: 421 RCSTISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNN 480
           RCSTISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNN
Sbjct: 421 RCSTISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNN 480

Query: 481 CNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDN 540
           CNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDN
Sbjct: 481 CNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDN 540

Query: 541 QISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNK 600
           QISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNK
Sbjct: 541 QISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNK 600

Query: 601 RTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPELGFIKIANETLSK 660
           RTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPELGFIKIANETLSK
Sbjct: 601 RTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPELGFIKIANETLSK 660

Query: 661 YLTEHK 666
           YLTEHK
Sbjct: 661 YLTEHK 666

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score =  496 bits (1277), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 272/649 (41%), Positives = 388/649 (59%), Gaps = 33/649 (5%)

Query: 36  MYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREISWDLPKGLLEFLSLENIDVHKRLA 95
           MY +++N   SI EK +YL+ L  +L DNP  L+EI WDLPKGLL+F S +NI+V+  L 
Sbjct: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60

Query: 96  DSSIVSNVMKCFNEIAINGNPKXXXXXXXXXXXXXTVEPVMXXXXXXXXXXXXXXXXXXX 155
            S +VS+VM+CFNE+AINGNPK              +                       
Sbjct: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGDSDEENEDLNDSNRNDA 120

Query: 156 XXPTDLNS------SDYIERDLTEFIPSLKVYAIFQLLNSTLGRIITLYPSKFLNMAISA 209
              TD  S        Y+ ++  EFIP+LK+Y +F+ ++  L R+ TLYPSKFL M  SA
Sbjct: 121 SNITDELSVITPEIGHYMAKNTVEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTSA 180

Query: 210 IMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQ 269
           I+K++ TN+  + D  F+LR ++ FC NY    P   L DG   ND  ++K+ DDE  LQ
Sbjct: 181 IIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLTDGISTND--LEKIHDDESALQ 238

Query: 270 NKLIKELFCSALSICLKNQPTTFDVKYFESLTHQKFEESEHYAVIRT---QYLGLVNKYK 326
            KL+  L    +S CLKN P   D  YF++L H+K +E+E  A +     QY   V    
Sbjct: 239 KKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLD 298

Query: 327 IDIKEEFLQCLQESRQIYESLPSDIDESDEKKKSALNQVIYQLSYRYQMQKISNQDTLEI 386
           + +KE   +CL ESR IY SL  +   S  + K  +NQ++Y++SY YQ++K++++  LE+
Sbjct: 299 VHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLEL 358

Query: 387 DFNSIILLSGSYYAETGLHLLPQISIQDAVYLYLRCSTISLYSDTFSNEAVKGVTRYWLW 446
           D   +++LS  +Y++ G HLLPQI IQ A+YLYLRC+T SL+S+ + N+ ++   RYWLW
Sbjct: 359 DQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLW 418

Query: 447 VAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKDGKIRMATFTLLTRILCLMPED 506
           V+ T++  ++I+  L ++P H  T FLQMLL+  CNE +   ++   TLL R+L LMPE 
Sbjct: 419 VSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPES 478

Query: 507 LSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDNQISKPLEEELSTLDISSEKNKG---- 562
            SF FI +TLL CPY +AK +VL IL+D+M++  + +   E    T+ +  ++N G    
Sbjct: 479 TSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDE----TVGLIEQQNPGNTAN 534

Query: 563 -----PTLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNKRTE--LSLLLNYMNFFI 615
                PTLPPRPYI INEDRMAS+HS+A +C S  K      KRT+  L L+L YM FF+
Sbjct: 535 SVPIMPTLPPRPYITINEDRMASIHSIALICFSAAK----QKKRTQGDLLLVLTYMKFFV 590

Query: 616 SLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPELGFIKIANETLSKYLTE 664
           SLR KW++ LL +I+ E+     G   E  PEL FI I+N TL +Y+ E
Sbjct: 591 SLRNKWDLGLLTLINKEISESFQG---EGEPELAFINISNNTLGEYIEE 636

>Scas_686.19
          Length = 663

 Score =  451 bits (1159), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/649 (38%), Positives = 379/649 (58%), Gaps = 27/649 (4%)

Query: 12  IYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREI 71
           I A L  AF+E  +D V+L  I++MY  +IN DG ID+K ++L  L  L+ D+P ++  I
Sbjct: 7   IIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVARI 66

Query: 72  SWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXXXXXXXXXXXXT 131
           SWD PK +L+FL+  N+DV KRL  S I+S VMKCFNEIA +  PK             +
Sbjct: 67  SWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCELLSNLS 126

Query: 132 VEPVMXXXXXXXXXXXXXXXXXXXXXPTDLNSSD----YIERDLTEFIPSLKVYAIFQLL 187
           +E                         T  +S++    + ER   +F  S+K+Y +F+L+
Sbjct: 127 LE------NENIELEMEQGDHTNSKGQTHYSSAEIGKYHAERTPADFFVSVKMYILFELI 180

Query: 188 NSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKL 247
            +TL RI TL PSK+L +A SA+++F+  N + I DV  ++RRI  FC NY    PD  L
Sbjct: 181 GTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNY--VPPDTSL 238

Query: 248 --IDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESLTHQKF 305
             I    L  E++ ++ + E   Q ++++ L    L  CLK      DVKYF  L++ +F
Sbjct: 239 CVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEF 298

Query: 306 EESEHY---AVIRTQYLGLVNKYKIDIKEEFLQCLQESRQIYESLPSDIDESDEKKKSAL 362
             +  Y   + + +++  L   + IDIK+EFL+C++ S  IY+ LP D     E+ K  +
Sbjct: 299 TLAGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLI 358

Query: 363 NQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYLRC 422
            Q +Y+L+Y Y++Q+I+    +++D   I++LSG YY ET  HL PQI+++DA+YLYLRC
Sbjct: 359 QQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRC 418

Query: 423 STISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCN 482
           +T SL+S  + N +V+ V RYWLWV+IT      + + L ++PS+  T FLQ  L  NC 
Sbjct: 419 TTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCK 478

Query: 483 EKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKD--- 539
           + + +IRM +FTL TRILCL+PE ++F+FIL+TL    Y   KSSVL ILKDLM K    
Sbjct: 479 QPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRRSC 538

Query: 540 -----NQISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCISNLKL 594
                N   + L   L+ L I+S+KN+G  +  + Y+ ++E+RM  +H +A   I++L+ 
Sbjct: 539 QDLCANDNDEALSNSLAKLKINSKKNEGAGVESQVYVEVSEERMNEIHHLALRAINSLE- 597

Query: 595 LDNPNKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDE 643
            +    R  + L+LNY+ FF  L  +W+ +LLQ IHDE++ K+    DE
Sbjct: 598 -EEKTTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDE 645

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score =  431 bits (1109), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/677 (37%), Positives = 389/677 (57%), Gaps = 27/677 (3%)

Query: 10  ESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILR 69
           + I  ++T AF+ QKED + LVT+ID+YG+++N++GS +EK +++E L +LL DNP    
Sbjct: 5   DDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNPSTTG 64

Query: 70  EISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXXXXXXXXXXX 129
           EI WDLPKGLL+FLS +N+DV+ RL  + IV  VMKCF  I+I G PK            
Sbjct: 65  EIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLELLSS 124

Query: 130 XTVEPVMXXXXXXXXXXXXXXXXXXXXXPTDLNSSD------YIE-RDLTEFIPSLKVYA 182
              +                            NSS+      Y E +   EF   LK Y 
Sbjct: 125 LCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKLKSYI 184

Query: 183 IFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHA 242
           +F+ + ++L RI TL+PSK+L  A+S I KF+ ++ +   D  FLLRR++ FC NY    
Sbjct: 185 LFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNYIPPD 244

Query: 243 PDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESLTH 302
           P + +    D   E   K+ ++E +LQ +L++ L    +S  +K   T  DVKY+ +L  
Sbjct: 245 PPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYCALNQ 304

Query: 303 QKFEESEHYAVIRTQYLGLVNKY-------KIDIKEEFLQCLQESRQIYESLPSDIDESD 355
           QKFE S +Y    T+YL L  +Y        +DI+ EF   ++E R IY+S+P +I   +
Sbjct: 305 QKFELSAYY----TEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN 360

Query: 356 EKKKSALNQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDA 415
           ++ K  L +++Y+L+Y +++QK + +  + +D+N +IL SG +Y ET  HL+ +++I DA
Sbjct: 361 DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA 420

Query: 416 VYLYLRCSTISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQM 475
           +YLYLR +T SLYS  + N AV+ V+RYWLW AIT  P++++++ L  +        L +
Sbjct: 421 IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV 480

Query: 476 LLLNNCNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDL 535
           LL  NC + + ++RM TFTLLTR+LCL+PE ++F+FILD L T P   AK+SVL + KDL
Sbjct: 481 LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL 540

Query: 536 -----MLKDNQISKPL-EEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCI 589
                  KDN     L  E+LS L + ++ NK      R YI ++  +M ++H      I
Sbjct: 541 SRRRISTKDNDSETDLIVEKLSKLKV-NDSNKAQQSNIRHYIQLDSSKMKAVHDCCLQTI 599

Query: 590 SNLKLLDNPNKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPELG 649
            +    D   K++++ LLL Y+N FI L+  W+ +LL+I+  ++D+ L  VE +  P+  
Sbjct: 600 QDSFTAD--AKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKYK 657

Query: 650 FIKIANETLSKYLTEHK 666
            I   NE+L+ Y T  K
Sbjct: 658 EIVDKNESLNDYFTGIK 674

>Kwal_14.1812
          Length = 684

 Score =  424 bits (1089), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 246/681 (36%), Positives = 385/681 (56%), Gaps = 28/681 (4%)

Query: 9   TESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHIL 68
           + S+  KL  AF+E KEDP++L+TIID+Y  E+N+    +EK ++LE L   + D+ H++
Sbjct: 4   SSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLI 63

Query: 69  REISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXXXXXXXXXX 128
           +++ WDLPK L+ F++  N+D++ RL  + +V+  +KCFNEIA++GN K           
Sbjct: 64  QQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKECFLTGCELLG 123

Query: 129 XXTVEP---VMXXXXXXXXXXXXXXXXXXXXXPTDLNSSDY------------IERDLTE 173
              + P   V                      P + N                + RD  E
Sbjct: 124 ELELHPSEKVQEEHEEDATEAVEVEAQAIKSTPEEANGPKMNAQTSSRTVVRPLSRDPEE 183

Query: 174 FIPSLKVYAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHE 233
            +  +K++ + +L+NSTL RI T YPS+FL MA+S+I  F+ +N  DI D TF+LRR++ 
Sbjct: 184 LVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRRVYT 243

Query: 234 FCNNYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFD 293
           F  N+    P        D++ EEI K+ DDE  LQ KL++ L   ++   ++ +     
Sbjct: 244 FARNF--IPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVLNIA 301

Query: 294 VKYFESLTHQ-----KFEESEHYAVIRTQYLGLVNKYKIDIKEEFL-QCLQESRQIYESL 347
            +YF  L ++     ++E   +   I ++Y  L   + ID+KEEFL QC+++S  IY+SL
Sbjct: 302 TEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAIYQSL 361

Query: 348 PSDIDESDEKKKSALNQVIYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLL 407
           P+D +  ++  ++ + Q++YQLSY Y +Q+  N+  L +D   +++L+  +Y ETG  L 
Sbjct: 362 PNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETGQILD 421

Query: 408 PQISIQDAVYLYLRCSTISLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSH 467
             I    A+Y+YLR  T  +Y+    N        +WLWVA+T+S  K+ ++ L  IPS+
Sbjct: 422 STIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQNIPSY 481

Query: 468 FNTVFLQMLLLNNCNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSS 527
            +  FLQ+LLL + NE     RM +FTLLTR+LCLMPE+ +F+F  DTLL+CP+   K  
Sbjct: 482 LSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFIDLKCC 541

Query: 528 VLAILKDLMLKDNQISKPLEEELSTLDISSEK--NKGPTLPPRPYILINEDRMASLHSVA 585
           +L ILKDLML        L  ELS L +S ++  +  P LP RP+I+INEDRMA++HS+A
Sbjct: 542 MLGILKDLMLNSKIPVSNLATELSELKLSEDEKSHSKPPLPSRPFIMINEDRMATIHSLA 601

Query: 586 SMCISNLKLLDNPNKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAA 645
            +   +   ++N +K   L L L Y+NFF+ LR KW+ +LL  +       +  V  + +
Sbjct: 602 LLSFED--TIENADK-GNLRLSLTYINFFVGLRLKWDKHLLAEVEGAASKIVNSVTKDNS 658

Query: 646 PELGFIKIANETLSKYLTEHK 666
            ELGFI+IA + L  +L   K
Sbjct: 659 TELGFIEIALDNLKAFLPRFK 679

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score =  327 bits (838), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 215/666 (32%), Positives = 355/666 (53%), Gaps = 27/666 (4%)

Query: 10  ESIYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILR 69
           E +   L  +F + KED +TLVT+ID   +E++E   + EK ++LE L +LL  +  ++ 
Sbjct: 6   EEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKEKEQFLELLLNLLEADTELVS 65

Query: 70  EISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXXXXXXXXXXX 129
            + WDLP+ LL F + +NI    RL    +V+  M  FN +A++  P+            
Sbjct: 66  AVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTLELLSE 125

Query: 130 XTVEPVMXXXXXXXXXXXXXXXXXXXXXPTDLNSSDYI-ERDLTEFIPSLKVYAIFQLLN 188
              + ++                       +    DY+ +RD  E I  +K YA+F+L  
Sbjct: 126 LNFKNIVEECHQLSEDGSDNNTAEEDNDAVE----DYMKDRDQPEIIFGVKSYALFELAG 181

Query: 189 STLGRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKLI 248
           S + R+ TL+PSK+L  A++AI K++  N   + DV F+LRR+  FC  Y    P R+LI
Sbjct: 182 SLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQLI 241

Query: 249 DGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESLTHQKFEES 308
               +N EE  ++ + E +LQ +L++ L   +++ C+K      +V YF  L ++  +  
Sbjct: 242 VDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLINKDLQLP 301

Query: 309 EHYAVIR---TQYLGLVNKYKIDIKEEFLQCLQESRQIYESLPSDIDESDEKKKSALNQV 365
           E Y  +    ++Y  +   + ID+ +EF   L+E+R IYE +   I+E++   K+A + +
Sbjct: 302 EFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDKNAKSDI 361

Query: 366 IYQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYLRCSTI 425
           + +  Y Y++QK + +  +  D   IILLSG  Y E G HL+  I I DA+YLYLR ++ 
Sbjct: 362 LLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHLI-DIDIADALYLYLRFASE 420

Query: 426 SLYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKD 485
           SL+S T  N  ++GV RYW+W A+T +    +++ L ++        L +LL+ NC++ +
Sbjct: 421 SLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAELSPLVLHSVLNLLLVKNCHQVN 480

Query: 486 GKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLK------- 538
            +IRM TFTL+TRILCL+PE+ S++F++D L  C     KS VL IL+DL++K       
Sbjct: 481 EEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSS 540

Query: 539 DNQISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNP 598
           +N  ++ L E ++ L I++EK    T     +I ++  R   +  +A   I  LK     
Sbjct: 541 NNTDTEDLSESMAQLKINNEKRAKKT-----FITLDPKRAGEIEDLA---IKTLKETKKS 592

Query: 599 NKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAPELGFIKIANETL 658
            K+  + L+LNY+ FF +  +KWN + L      V    +  + +  PE+  I  ANE L
Sbjct: 593 MKKDYILLVLNYIKFFSTFAHKWNKSKLNEFTTLVATNFS--DSKMLPEINAIIDANEKL 650

Query: 659 SKYLTE 664
            + LTE
Sbjct: 651 -RSLTE 655

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score =  323 bits (829), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 229/683 (33%), Positives = 350/683 (51%), Gaps = 76/683 (11%)

Query: 12  IYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREI 71
           I  KL  AF E+K D +TLVTI+D+Y +E+N  GS+++K +YL  + SLL  N  ++ EI
Sbjct: 11  IEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEI 70

Query: 72  SWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXXXXXXXXXXXXT 131
            WDLPK L++F+   N +          ++ +MKCFNE+A+ GNPK              
Sbjct: 71  GWDLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLR 130

Query: 132 V------------EPVMXXXXXXXXXXXXXXXXXXXXXPTDLNSSDYIE----------- 168
           +            EPVM                       D  SSD  E           
Sbjct: 131 INDESLVRFIVEEEPVMDPENEDSGDETYTE---------DEGSSDKTEEEEEKNAVKDS 181

Query: 169 ---RDLTEFIPSLK------------------VYAIFQLLNSTLGRIITLYPSKFLNMAI 207
              +   E IP LK                   Y+I +L+ STL RI+TL+PSKFL+ A+
Sbjct: 182 PTPKSANESIPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAV 241

Query: 208 SAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKLIDGSDLNDEEIKKLTDDEFD 267
            A  +F   N  D+ D  F+LRR++ F   Y   +P         ++ EE++++   E  
Sbjct: 242 EAFSRFNLQNNEDVDDCLFILRRLYSFIRGYIPPSPPPDA--DKQVSAEELEEIKVSEEV 299

Query: 268 LQNKLIKELFCSALSICLKNQPTTFDVKYFESLTH-QKFEESEHY----AVIRTQYLGLV 322
           LQ KL+  +  SAL   LK +     + Y   L        S  Y      I ++Y  L 
Sbjct: 300 LQRKLLCNILTSALHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLA 359

Query: 323 NKYKIDIKEEFLQ-CLQESRQIYESLPSDID-ESDEKKKSALNQVIYQLSYRYQMQKISN 380
             + ID+  EF + C+ ES +IY SLP D + +SDE+ K   N  +YQL+Y Y+++KI+N
Sbjct: 360 TSFDIDVSAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITN-FVYQLAYTYEVEKIAN 418

Query: 381 QDTLEIDFNSIILLSGSYYAETGLHLLP----QISIQDAVYLYLRCSTISLYSDTFSNEA 436
              + +D   I++L  S+  E     LP    +I++Q+A+Y+YLR  T S++S  F N +
Sbjct: 419 VKEILLDPAGILILR-SFSNE---DFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRS 474

Query: 437 VKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKDGKIRMATFTLL 496
              + R W+  A+T +   ++  +L  +PS+  TV+LQ  L+  C + +  +R   F++L
Sbjct: 475 SHDLARTWILFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSIL 534

Query: 497 TRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDNQISKPLEEELSTLDIS 556
           TRILCL+PED +F FI DTLL+CPY  AK   LAILKD+M  + ++ +  +E+    D+ 
Sbjct: 535 TRILCLLPEDFAFNFIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDME 594

Query: 557 SE--KNKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNKRTELSLLLNYMNFF 614
               KN  P LP R Y+L+N+DR+A+LHS+  + I +     +P  + ++  LL Y+NF 
Sbjct: 595 KLKIKNSPPPLPSRAYMLLNDDRIATLHSITLLAIDSCAA--DPESK-KVKTLLTYLNFL 651

Query: 615 ISLRYKWNVNLLQIIHDEVDAKL 637
            +   KW+   L+ I D V+ KL
Sbjct: 652 NAFLTKWDSVFLKEICDAVNDKL 674

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  287 bits (734), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 192/653 (29%), Positives = 330/653 (50%), Gaps = 70/653 (10%)

Query: 20  FEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREISWDLPKGL 79
           F EQ  D ++L   I++  ++    G+      +LE L   L ++P ++ ++ WD+PK L
Sbjct: 16  FAEQAGDVISLAAGIELCAEQALASGNAGRVASFLEALWEQLREHPALVGDLGWDIPKVL 75

Query: 80  LEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXXXXXXXXXXXXTVEPVMXXX 139
           +  +  +N ++++ L D  +   ++ CF E+   GN +             +V       
Sbjct: 76  VRCIRADNFNLNEGLGDDMVWRLLVGCFREVGREGNARECFLTGCQQLAELSV------- 128

Query: 140 XXXXXXXXXXXXXXXXXXPTDLNSSDYIERDLTEFIPSLKVYAIFQLLNSTLGRIITLYP 199
                                  + +  + DL E + +LK + + + + +TLGR  T YP
Sbjct: 129 ----------------------AAEEEEDADLREEMFALKFHMLMEFVTTTLGRTTTAYP 166

Query: 200 SKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKLIDGSDLNDEEIK 259
           S+FL   I  ++K +  N +++ DV  LLRR++ FC +Y   AP       S   DEE++
Sbjct: 167 SRFLGEIIGVLVKLVERNADELCDVHLLLRRLYTFCRDYT--APV------SSSEDEELR 218

Query: 260 KLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESLTHQKFEESEHYAVIR---T 316
              D    LQ  L +     AL+  L+ Q   +  +YF      +F+  + +  +R    
Sbjct: 219 AQEDY---LQRTLFRSFLAYALAQLLRRQSVRWAPEYFAKSHGLEFKLHDDHVELRETLG 275

Query: 317 QYLGLVNKYKIDIKEEFL-QCLQESRQIYESLPSDIDESDEKKKSALNQVIYQLSYRYQM 375
           +Y  L + + IDI+  F  QC+ ESR +Y  + +D D++D        +VIYQL+Y Y++
Sbjct: 276 RYFQLAHSFDIDIEGAFQKQCILESRDVYACVSADADKADGA------EVIYQLAYTYEL 329

Query: 376 QKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYLRCSTISLYSDTFSNE 435
           +KI+   ++ ID   I +L+  ++ ETG  +   + + DA+Y++LR +T  +YS +F N 
Sbjct: 330 KKIAELQSMPIDARGIFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNTPEIYSKSFGNI 389

Query: 436 AVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKDGKIRMATFTL 495
           AV   + Y++ +A+  +  +E  + + + P     VF+Q+LLLN C     +I   T ++
Sbjct: 390 AVTDASLYFVLLALEGNSHEENHKLVREFPQTVFAVFIQVLLLNMCRLPSREIGRMTHSI 449

Query: 496 LTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDNQISKPLEEELSTLDI 555
           L R+L L  E  +F F++DTLL CPY +AK  +L I K +M+ D          + T D+
Sbjct: 450 LARVLFLASETTAFDFVIDTLLQCPYETAKQIILEIAKIMMVSDQYT-------ICTRDV 502

Query: 556 SSEK---NKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNKRTELSLLLNYMN 612
            S      K P LPPRP+I +N+DRMA+ H++A M        ++P    +L+ LL+Y+N
Sbjct: 503 PSHTRTDTKAPPLPPRPFIKLNDDRMAAFHTLAMMSAKFCTETEDPK---QLTTLLSYLN 559

Query: 613 FFISLRYKWNVNLLQIIHDEVDAKLAGV---EDEAAPELGFIKIANETLSKYL 662
               LR KW+    Q++  E+   ++       E  PE+GFIKIAN+ L ++L
Sbjct: 560 LITVLRKKWD----QVLLRELTVAVSNCIEPRKEDIPEIGFIKIANDGLKEFL 608

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score =  228 bits (581), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 198/676 (29%), Positives = 328/676 (48%), Gaps = 71/676 (10%)

Query: 7   IDTESIYAKLTRAFEEQKE--DPVTLVTIID--MYGQEINEDGSI--DEKNKYLEHLCSL 60
           + TE+I      A E +KE  D +T + +++  + G   +ED ++  DE    L+   + 
Sbjct: 1   MSTEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTP 60

Query: 61  LNDNPHILREISWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKXXX 120
           LND      E+ W LPK L++ +S +N++      D ++V  +  C   +A  G      
Sbjct: 61  LND------ELLWGLPKALIKNISSKNVE------DKALVKAICNCMKLVARVGTDDYNF 108

Query: 121 XXXXXXXXXXTVEPVMXXXXXXXXXXXXXXXXXXXXXPTDLNSSDYIERDLTEFI-PSLK 179
                       E                                 +E  L EFI P+LK
Sbjct: 109 LFGTELLRECRAEDTNIYDDSNDTYILEAFKVR-------------VELLLEEFILPALK 155

Query: 180 VYAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMATNIN---DIADVTFLLRRIHEFCN 236
                     TLG+     PSKFL++ +SA+++ ++ N+    +I     LL  I  F +
Sbjct: 156 ----------TLGQT---NPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYD 202

Query: 237 NYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKY 296
           +Y++ +      DG+  N         DE D+  K+++  +  ++  C+KNQ    +   
Sbjct: 203 SYELPSAKVTTPDGAMANK--------DEEDIVQKILESFWSFSIGRCIKNQSCFPEYIL 254

Query: 297 FESLTHQKFEESE-----HYAVIRTQYLGLVN-KYKIDIKEEFLQCLQESRQIYESLPSD 350
              +    F + E      + +     + + N K ++D+++    C +E+R+IYE LP +
Sbjct: 255 LSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEACFEETRKIYELLPPN 314

Query: 351 IDESDEKKKSALNQVIYQLSYRYQMQKISNQ-DTLEIDFNSIILLSGSYYAETGLHLLPQ 409
               D    + L + IYQ+SY   +  +  Q   L +D   ++ LSG YY      L  +
Sbjct: 315 PTVQD---GNDLTEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVK 371

Query: 410 ISIQDAVYLYLRCSTISLYSDTFSNEAVKGVTRYWLW-VAITQSPIKE-IEQNLLKIPSH 467
           I++ DAV LYLR S+ SLYS  F N  V+G+ R+WLW   + ++  K  ++  L+ +P +
Sbjct: 372 INLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDY 431

Query: 468 FNTVFLQMLLLNNCNEKDGKIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSS 527
              VF Q+LLL  CNE     +   F LLT++L     +++F FI+DT+L+CPY  AK +
Sbjct: 432 VLKVFFQLLLLKTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIA 491

Query: 528 VLAILKDLMLKDNQISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASM 587
           +  ILKDLM K +     L+E     +  +  N  P LP RP I ++E R+AS+HS+  +
Sbjct: 492 IAGILKDLMAKKSD-DIHLKEARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKL 550

Query: 588 CISN-LKLLDNPNKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDEAAP 646
           CI + LK L+N   +  L LL  Y+N  I+L  +W+  LL+ I+DE+    +  +++  P
Sbjct: 551 CIEDCLKPLNN-KTQGNLILLQYYINILITLYKQWDGFLLKEINDEIKKLFSQRQEQEFP 609

Query: 647 ELGFIKIANETLSKYL 662
           EL FI++AN+TLS  L
Sbjct: 610 ELEFIRLANDTLSTQL 625

>ABL007W [585] [Homologous to ScYGR057C (LST7) - SH]
           complement(384276..385001) [726 bp, 241 aa]
          Length = 241

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 13/99 (13%)

Query: 227 LLRRIHEFCNNYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLK 286
           LL  +  FC   D H P   ++     + EE +KL      L      + +C +  I   
Sbjct: 4   LLVSLTHFC---DKHGPKLLVVTQCAKSAEECEKL------LLPNYPSDSYCDSCHISF- 53

Query: 287 NQPTTFDVKYFESLTHQKFEESEHYAVIRTQYL-GLVNK 324
             PT  + K   S   +++  S HY+ +R QYL  LV K
Sbjct: 54  --PTDQESKSIRSTIGERYYVSTHYSAVRYQYLTALVKK 90

>CAGL0I03674g 313907..315244 highly similar to sp|Q12250
           Saccharomyces cerevisiae YDL147w RPN5, start by
           similarity
          Length = 445

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 8/81 (9%)

Query: 287 NQPTTFDVKYFESLTHQKFEESEHYAVIRTQYLGLVNKYKIDIKEEFLQCLQESRQIYES 346
           +Q T F  K       +K  ++E Y  ++ QY  L+ K  +  K ++L+  Q  ++IYE+
Sbjct: 194 SQATVFSRKIL-----KKTFKNEKYESLKLQYYELLIKIGLH-KNDYLEVAQYFQEIYET 247

Query: 347 LPSDIDESDEKKKSALNQVIY 367
               + E +EK K AL++++Y
Sbjct: 248 --KSVKEDEEKWKPALSRMVY 266

>CAGL0I07997g 780417..782771 similar to sp|Q12387 Saccharomyces
           cerevisiae YOL076w DEC1, start by similarity
          Length = 784

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 14  AKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREISW 73
           +KLTR   E++   +T + ++    Q INE G  D ++K L H    L   P +LR++  
Sbjct: 544 SKLTRLNNEKRNSGMTELLVLWESLQHINEPGLSDNRDKSLFHPYLDLRSCPAVLRQLHI 603

Query: 74  D 74
           D
Sbjct: 604 D 604

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,599,113
Number of extensions: 987251
Number of successful extensions: 3800
Number of sequences better than 10.0: 44
Number of HSP's gapped: 3893
Number of HSP's successfully gapped: 52
Length of query: 666
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 558
Effective length of database: 12,857,365
Effective search space: 7174409670
Effective search space used: 7174409670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)