Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_560.6*1181186197e-85
YBR062C1151153551e-44
CAGL0H10274g1141143402e-42
Kwal_27.105461041023322e-41
AGR034W1591203121e-37
KLLA0F18458g1401032762e-32
Scas_625.112741011973e-19
Kwal_56.2311213580962e-05
Sklu_1684.114467962e-05
Kwal_56.2252251334939e-05
Kwal_56.2390058978939e-05
YDL008W (APC11)16593883e-04
KLLA0E17787g16265820.002
Sklu_2432.9147553840.002
Sklu_2317.249346820.003
AER016C14751800.003
ACL019C57536810.004
ABR104W32898800.005
Scas_713.4557048800.006
YDR143C (SAN1)61034800.006
YOL013C (HRD1)55134800.006
KLLA0C05874g55339790.007
Kwal_26.809975024780.009
KLLA0F12166g152864770.016
Scas_705.4142847760.017
KLLA0E03960g70434760.017
CAGL0I04576g14957730.034
Scas_644.651037740.035
KLLA0F23892g51884740.037
CAGL0L01947g75766740.037
AGL079C50645730.041
YPR093C28849730.042
AFR275W75324730.053
YHL010C58549730.054
CAGL0E02299g54528720.063
Kwal_27.12327157453720.074
CAGL0K02563g58645710.084
CAGL0B05049g147060710.084
KLLA0C14344g151850710.095
Kwal_55.2205411128680.10
KLLA0F25674g75724700.11
Sklu_2416.811028680.12
CAGL0E01441g71732690.15
KLLA0E07139g11028670.15
Sklu_2102.175124690.15
KLLA0F25740g51745680.18
ADL181W10828660.20
YKL034W (TUL1)75824680.20
Scas_585.5*10928650.24
YLR247C155661680.26
Scas_718.7712851650.37
Sklu_1785.333138660.37
YOL133W (HRT1)12122640.40
ABL058C154654660.42
Scas_573.9150260650.51
ACR267C46794650.54
Scas_625.476124650.63
AER208C56348640.65
Scas_675.3054276640.68
Sklu_2337.232247630.79
Scas_696.17156435640.88
Kwal_26.803066064631.1
AGL217W41452621.4
Scas_665.139254621.4
Kwal_14.1287151825621.5
AAL030C153965621.6
Kwal_27.1041930031601.9
AAR049C44336612.0
KLLA0E16720g30570602.0
YNL116W52286612.0
YMR247C156231612.1
KLLA0C15697g30430602.4
CAGL0M08690g32824602.5
Sklu_1676.310132582.7
Kwal_55.2120627525593.3
Kwal_14.237553590584.5
KLLA0C08756g42735575.6
Sklu_2238.554860576.7
Scas_615.1333024567.7
Kwal_27.1151895348568.9
Kwal_14.1314111145569.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_560.6*
         (118 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_560.6*                                                           243   7e-85
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...   141   1e-44
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...   135   2e-42
Kwal_27.10546                                                         132   2e-41
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....   124   1e-37
KLLA0F18458g complement(1697871..1698293) some similarities with...   110   2e-32
Scas_625.11                                                            80   3e-19
Kwal_56.23112                                                          42   2e-05
Sklu_1684.1 YDL008W, Contig c1684 226-660                              42   2e-05
Kwal_56.22522                                                          40   9e-05
Kwal_56.23900                                                          40   9e-05
YDL008W (APC11) [849] chr4 (433494..433991) Component of the ana...    39   3e-04
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    36   0.002
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              37   0.002
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            36   0.003
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    35   0.003
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    36   0.004
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    35   0.005
Scas_713.45                                                            35   0.006
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    35   0.006
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    35   0.006
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    35   0.007
Kwal_26.8099                                                           35   0.009
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    34   0.016
Scas_705.41                                                            34   0.017
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    34   0.017
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    33   0.034
Scas_644.6                                                             33   0.035
KLLA0F23892g complement(2229493..2231049) some similarities with...    33   0.037
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    33   0.037
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    33   0.041
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    33   0.042
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    33   0.053
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    33   0.054
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    32   0.063
Kwal_27.12327                                                          32   0.074
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    32   0.084
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    32   0.084
KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces...    32   0.095
Kwal_55.22054                                                          31   0.10 
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    32   0.11 
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          31   0.12 
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    31   0.15 
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    30   0.15 
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          31   0.15 
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    31   0.18 
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    30   0.20 
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    31   0.20 
Scas_585.5*                                                            30   0.24 
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    31   0.26 
Scas_718.77                                                            30   0.37 
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         30   0.37 
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    29   0.40 
ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4...    30   0.42 
Scas_573.9                                                             30   0.51 
ACR267C [1314] [Homologous to ScYNL116W - SH; ScYHR115C - SH] (8...    30   0.54 
Scas_625.4                                                             30   0.63 
AER208C [2710] [Homologous to ScYGR077C (PEX8) - SH] (1021972..1...    29   0.65 
Scas_675.30                                                            29   0.68 
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         29   0.79 
Scas_696.17                                                            29   0.88 
Kwal_26.8030                                                           29   1.1  
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    28   1.4  
Scas_665.1                                                             28   1.4  
Kwal_14.1287                                                           28   1.5  
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    28   1.6  
Kwal_27.10419                                                          28   1.9  
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    28   2.0  
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    28   2.0  
YNL116W (YNL116W) [4478] chr14 (408341..409909) Protein containi...    28   2.0  
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    28   2.1  
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    28   2.4  
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    28   2.5  
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         27   2.7  
Kwal_55.21206                                                          27   3.3  
Kwal_14.2375                                                           27   4.5  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    27   5.6  
Sklu_2238.5 YKR017C, Contig c2238 9398-11044 reverse complement        27   6.7  
Scas_615.13                                                            26   7.7  
Kwal_27.11518                                                          26   8.9  
Kwal_14.1314                                                           26   9.2  

>Scas_560.6*
          Length = 118

 Score =  243 bits (619), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%)

Query: 1   MLQLLSQIIPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDK 60
           MLQLLSQIIPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDK
Sbjct: 1   MLQLLSQIIPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDK 60

Query: 61  YPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGMYG 118
           YPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGMYG
Sbjct: 61  YPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGMYG 118

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score =  141 bits (355), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 84/115 (73%), Gaps = 4/115 (3%)

Query: 8   IIPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKH--KNDECPICCCKFSEDKYPLIV 65
           ++PE+LQEEW ++MD+     C + F ASLPR+  K     D C IC   + ED+YPL+V
Sbjct: 1   MLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVV 60

Query: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKL--NIDTSKTEFEEGWGMYG 118
           ELP C+H+FDLEC+SVWLS+S TCPLCRDNV+ H++   IDT++ E EE WGMYG
Sbjct: 61  ELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMYG 115

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score =  135 bits (340), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 4/114 (3%)

Query: 9   IPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKH--KNDECPICCCKFSEDKYPLIVE 66
           +PE+LQE+  + MD  +K+ CS+ FI SLPR+  K    +D CPICC  F  D+YPL+VE
Sbjct: 1   MPEDLQEQLMQSMDSASKQGCSDTFIDSLPRIPQKKLKSDDTCPICCSNFIADEYPLVVE 60

Query: 67  LPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHK--LNIDTSKTEFEEGWGMYG 118
           LP C H+FD EC+S+WL+K+ TCP+CRD+V   K    +DTSK E EE WGMYG
Sbjct: 61  LPHCGHKFDFECVSMWLTKNTTCPMCRDDVTHKKELPELDTSKVELEEDWGMYG 114

>Kwal_27.10546
          Length = 104

 Score =  132 bits (332), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 80/102 (78%), Gaps = 2/102 (1%)

Query: 19  EQMDEKNKKHCSEEFIASLPRV-KSKHKNDE-CPICCCKFSEDKYPLIVELPRCNHRFDL 76
           E++ ++ ++ C + +I SLPRV K K K+ E C ICCC + +DKYPL+VELP CNHRFDL
Sbjct: 3   EELLQEKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDL 62

Query: 77  ECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGMYG 118
           EC++VWLSKS TCPLCRD+VL HK N+D S+ E E+ WGMYG
Sbjct: 63  ECVAVWLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGMYG 104

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score =  124 bits (312), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 79/120 (65%), Gaps = 4/120 (3%)

Query: 1   MLQLLSQIIPENLQEEWFEQMDEKNKKHCSEEFIASLPRVKSKH--KNDECPICCCKFSE 58
           +L ++ +++PE LQ+    Q+  +      + ++ +LPRV  K   + D C ICCC + E
Sbjct: 42  LLNVIVRLMPEELQQHL--QLIGEGDGGVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLE 99

Query: 59  DKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGMYG 118
           D+YPL+VELP C H FDL+C+SVWLS+S TCP+CR +VL  K  ID S  E EE WGMYG
Sbjct: 100 DEYPLVVELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEIDGSAAELEEDWGMYG 159

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score =  110 bits (276), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (70%), Gaps = 4/103 (3%)

Query: 18  FEQMDEKNKKHCSEEFIASLPRV-KSKHK-NDECPICCCKFSEDKYPLIVELPRCNHRFD 75
           F+Q D++  K  SE +I SLPRV  SK K  D C IC C F +D YPL+ ++PRCNH+FD
Sbjct: 40  FDQDDQQ--KGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFD 97

Query: 76  LECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGMYG 118
           LEC+S+WL  + TCP+CRD++   K+ IDTS+ E EE + MYG
Sbjct: 98  LECLSIWLQNNHTCPMCRDDLRSKKVEIDTSQCELEEDFNMYG 140

>Scas_625.11
          Length = 274

 Score = 80.5 bits (197), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 56/101 (55%), Gaps = 6/101 (5%)

Query: 1   MLQLLSQIIPENLQEEWFEQMDEKNKKHCSEEFIASLPR---VKSKHKNDECPICCCKFS 57
           M ++ S+ IPEN              K C+ EFI  LPR    +  + +DECPIC   +S
Sbjct: 162 MREMASRFIPENFD---IITSQRSAAKPCTNEFIEQLPRTNCAELSNSSDECPICRIAYS 218

Query: 58  EDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVLE 98
           +D    I  LP C+H F  ECI +WL K+  CPLCRDNV+E
Sbjct: 219 DDFETEITCLPNCSHHFHFECIKLWLQKNSLCPLCRDNVME 259

>Kwal_56.23112
          Length = 135

 Score = 41.6 bits (96), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 17 WFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDL 76
          W    D+   K   +E +  + RV     N  CP   C+F  D  PL++    CNH F +
Sbjct: 16 WDIPGDDNADKEIGDEDLCGICRVSY---NGTCP--GCRFPGDNCPLVIG--ECNHNFHV 68

Query: 77 ECISVWLSKSVT---CPLCR 93
           CI  WL  +     CP+CR
Sbjct: 69 HCIQQWLETATAKGLCPMCR 88

>Sklu_1684.1 YDL008W, Contig c1684 226-660
          Length = 144

 Score = 41.6 bits (96), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 10/67 (14%)

Query: 30 SEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT- 88
          +EE +  + RV     N  CP   CK+  D+ PL+V    CNH F + CI  WL  + + 
Sbjct: 31 TEEDVCGICRVS---YNGTCP--SCKYPGDECPLVV--GECNHNFHVHCIVQWLDTATSR 83

Query: 89 --CPLCR 93
            CP+CR
Sbjct: 84 GLCPMCR 90

>Kwal_56.22522
          Length = 513

 Score = 40.4 bits (93), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103
           CNH   L C+  W+ +S TCP+CR  V + K N+
Sbjct: 341 CNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNV 374

>Kwal_56.23900
          Length = 589

 Score = 40.4 bits (93), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 20  QMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECI 79
           ++D++N      E  +S P  +    N+       K +    P  V+LP C+H F  ECI
Sbjct: 180 EVDDQNGPANDGETASSPPEQEQPKDNENSGDDQGKVTYKHSP--VQLP-CSHVFGRECI 236

Query: 80  SVWLSKSVTCPLCRDNVL 97
             W +   TCP+CR N++
Sbjct: 237 RQWTNLHNTCPICRANIV 254

>YDL008W (APC11) [849] chr4 (433494..433991) Component of the
           anaphase-promoting complex (APC), has ubiquitin ligase
           activity and is required for the metaphase-anaphase
           transition [498 bp, 165 aa]
          Length = 165

 Score = 38.5 bits (88), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 15/93 (16%)

Query: 30  SEEFIASLPRVKSKHKNDECPIC---------CCKFSEDKYPLIVELPRCNHRFDLECIS 80
           S+E  A+   + +    D C IC          CKF  D+ PL++ L  C+H F   CI 
Sbjct: 22  SDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIY 79

Query: 81  VWLSKSVT---CPLCRDNV-LEHKLNIDTSKTE 109
            WL    +   CP+CR    L+  L I+ +  +
Sbjct: 80  RWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQ 112

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 13/65 (20%)

Query: 49  CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCRD------NVLEH 99
           CP   C +     P+++ L  CNH F + CI  WLS   +   CPLCR       NVL +
Sbjct: 70  CP--SCDYPGSGCPIVLGL--CNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRPNVLIN 125

Query: 100 KLNID 104
           K++ D
Sbjct: 126 KMHHD 130

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 44   HKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNV 96
            HK  E   C   F+E     +  + +C H F   CI  WL +  TCPLC+ NV
Sbjct: 1157 HKEGEELSCAVCFNE---IFVGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1206

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 36.2 bits (82), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 69  RCNHRFDLECISVWLSKSVTCPLCRDNVLEHK-LNIDTSKTEFEEG 113
           +C HRF   CI  W  +  +CP+CR  ++  + LN D    E  +G
Sbjct: 140 KCGHRFGRMCIYQWTKEHNSCPICRAEIVGREGLNRDLPDEETGDG 185

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
          (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 35.4 bits (80), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 46 NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCR 93
          N  CP C  K   +  PLIV    C+H F + CI  WL+ S +   CP+CR
Sbjct: 46 NGTCPNC--KLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 35.8 bits (81), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 67  LPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLN 102
           LP C H     C+  W+ +S TCP+CR +V  +  N
Sbjct: 343 LP-CGHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 35.4 bits (80), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 19/98 (19%)

Query: 27  KHCSEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWL--- 83
           KH S       P+       DEC IC     E     +  L  C H + L CI  W    
Sbjct: 3   KHISSHIAMGCPQ-------DECSICW----ESMPSGVGRLMPCGHEYHLACIRKWFHLH 51

Query: 84  SKSVTCPLCRDNV-----LEHKLNIDTSKTEFEEGWGM 116
           S + +CP+CR         +H++ ID S  +  + +G+
Sbjct: 52  SGNRSCPVCRTEASVLVDTDHEVKIDLSVGQLLDFYGL 89

>Scas_713.45
          Length = 570

 Score = 35.4 bits (80), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEG 113
           +LP C H F  EC+  W     TCPLCR  + E    +DT++ + ++ 
Sbjct: 232 KLP-CGHIFGRECLYRWCKLENTCPLCRHVIAE----VDTTQHQAQDA 274

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 35.4 bits (80), Expect = 0.006,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 65  VELPRCNHRFDLECISVWLSKSVTCPLCRDNVLE 98
           ++LP C H F  ECI  W     +CPLCR  + E
Sbjct: 253 IKLP-CGHIFGRECIYKWSRLENSCPLCRQKISE 285

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 35.4 bits (80), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103
           C H   L C+  W+ +S TCP+CR  V + K N+
Sbjct: 377 CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 410

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 35.0 bits (79), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 65  VELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103
           V++  C H   L C+  W+++S TCP+CR  + +   N+
Sbjct: 373 VKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNV 411

>Kwal_26.8099
          Length = 750

 Score = 34.7 bits (78), Expect = 0.009,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           C+H F  +C+  W+S  + CP+CR
Sbjct: 721 CSHIFHTQCLESWMSYKLQCPVCR 744

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 34.3 bits (77), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 33   FIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLC 92
            ++ +L ++K+   N E   C   +S+     I+   +C H F  +C++ W  K+ +CP+C
Sbjct: 1189 YLDTLGQLKTAIANGENISCAVCYSDIYTGSIL---KCGHFFCKDCVTHWFKKNTSCPMC 1245

Query: 93   RDNV 96
            ++ +
Sbjct: 1246 KNRM 1249

>Scas_705.41
          Length = 428

 Score = 33.9 bits (76), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 49 CPICCCKFSEDKYPLIVELPRCNHRFDLECISVW--LSKSVTCPLCR 93
          CPIC    + D   L  +L  CNH++  +CI  W   S +  CPLCR
Sbjct: 12 CPICFDDLN-DTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 33.9 bits (76), Expect = 0.017,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 67  LPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHK 100
           LP C H F  EC+  W ++  +CP+CR  +L  +
Sbjct: 217 LP-CGHVFGRECLYKWTTEHNSCPICRAPILSEE 249

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
          cerevisiae YDL008w APC11 subunit of the anaphase
          promoting complex, start by similarity
          Length = 149

 Score = 32.7 bits (73), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 10/57 (17%)

Query: 47 DECPICCCKFSED----KYP---LIVELPRCNHRFDLECISVWLSKSVT---CPLCR 93
          D C IC   +       +YP     + L RC H F + CIS W+    +   CP+CR
Sbjct: 35 DVCGICRASYHAPCPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>Scas_644.6
          Length = 510

 Score = 33.1 bits (74), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTS 106
           C H   L C+  W+ +S TCP+CR  V +   N+  S
Sbjct: 375 CGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKES 411

>KLLA0F23892g complement(2229493..2231049) some similarities with
           sp|P38823 Saccharomyces cerevisiae YHR115c, hypothetical
           start
          Length = 518

 Score = 33.1 bits (74), Expect = 0.037,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 13  LQEEWFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNH 72
           L + W  + +  NK+   +  + +L ++ S  + ++C IC  K    +   I     C+H
Sbjct: 358 LNKSWRRKANAFNKEAIQK--MKALQKMTSGTELEDCSICLSKIKACQAVFIAP---CSH 412

Query: 73  RFDLECISVWLSKS---VTCPLCR 93
            +  +CI   +SK+     CP CR
Sbjct: 413 SWHFKCIRQLVSKTYPQFVCPNCR 436

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 33.1 bits (74), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 19/66 (28%)

Query: 42  SKHKNDECPICCCKFSEDKYPLIVE-LPR-------------CNHRFDLECISVWLSKSV 87
           S++   +C IC  +F     P+ VE LP              C+H F   C+  W+S  +
Sbjct: 691 SENHTVDCAICMAEF-----PVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKL 745

Query: 88  TCPLCR 93
            CP+CR
Sbjct: 746 QCPVCR 751

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 32.7 bits (73), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 49  CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCR 93
           CP+C  +   D   LI     C H F  +C+  W  K   CP+CR
Sbjct: 212 CPVCLERMDSDTTGLITTA--CQHTFHCQCLDKW--KDGRCPVCR 252

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
          containing a C3HC4 type (RING) zinc finger, which may
          mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 32.7 bits (73), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 47 DECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT--CPLCR 93
          +ECPIC     E +    + +  C H+F L CI  W   S+   CP+CR
Sbjct: 2  EECPICLADDQEGEQFGCLNV--CGHKFHLNCIREWHKYSINLKCPICR 48

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 32.7 bits (73), Expect = 0.053,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           C+H F   C+  W+S  + CP+CR
Sbjct: 724 CSHLFHTGCLENWMSYKLQCPVCR 747

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 32.7 bits (73), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 49  CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVL 97
           CP+C  +   +   L+  +P C H F  +C++ W  K+  CP+CR + L
Sbjct: 240 CPVCLERMDSETTGLVT-IP-CQHTFHCQCLNKW--KNSRCPVCRHSSL 284

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 32.3 bits (72), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 66  ELPRCNHRFDLECISVWLSKSVTCPLCR 93
           +LP C H   L C+  W+ +S TCP+CR
Sbjct: 374 KLP-CGHVLHLSCLKNWMERSQTCPICR 400

>Kwal_27.12327
          Length = 1574

 Score = 32.3 bits (72), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 47   DECPICCCKFSEDKYPLIVEL-PRCNHRFDLECISVWL--SKSVTCPLCRDNV 96
            +EC IC          L  ++ P CN+RF   C+  W   S + TCPLCR  +
Sbjct: 1518 EECAICYSILHAVDRKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCRSEI 1570

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 32.0 bits (71), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 49  CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCR 93
           CP+C  +   +   LI  +P C H F  +C+  W  K+  CP+CR
Sbjct: 247 CPVCLERMDSETTGLIT-IP-CQHTFHCQCLDKW--KNSKCPVCR 287

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 32.0 bits (71), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 6/60 (10%)

Query: 34   IASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCR 93
            +++L     K+   EC IC    +         +  C H F   CI  WL    TCPLC+
Sbjct: 1149 LSTLTYEAQKNTTMECSICLQPITNGA------MVNCGHLFCTSCIFSWLKNRKTCPLCK 1202

>KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c singleton, start by similarity
          Length = 1518

 Score = 32.0 bits (71), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 47   DECPICCCKFSEDKYPLIVEL-PRCNHRFDLECISVWLSKSV--TCPLCR 93
            +EC IC          L  ++ P CN+RF   C+  W   S   TCPLCR
Sbjct: 1462 EECAICYYVLHAIDRKLPTKVCPTCNNRFHGACLYKWFKSSGNNTCPLCR 1511

>Kwal_55.22054
          Length = 111

 Score = 30.8 bits (68), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 14/28 (50%)

Query: 64 IVELPRCNHRFDLECISVWLSKSVTCPL 91
          +     CNH F L CI+ WL     CPL
Sbjct: 72 VAAWGTCNHAFHLHCINKWLQTRNACPL 99

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 31.6 bits (70), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           C+H F  EC+  W+S  + CP+CR
Sbjct: 728 CSHIFHTECLENWMSYKLQCPVCR 751

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 30.8 bits (68), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 14/28 (50%)

Query: 64 IVELPRCNHRFDLECISVWLSKSVTCPL 91
          +     CNH F L CI+ WL     CPL
Sbjct: 71 VAAWGTCNHAFHLHCINKWLQTRNACPL 98

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 31.2 bits (69), Expect = 0.15,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 65  VELPRCNHRFDLECISVWLSKSVTCPLCRDNV 96
           V++P C H F   C+  W     +CPLCR  +
Sbjct: 291 VKIP-CGHIFGRSCLYEWTRLENSCPLCRKKI 321

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
          cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 30.4 bits (67), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 64 IVELPRCNHRFDLECISVWLSKSVTCPL 91
          +     CNH F L CI+ W+     CPL
Sbjct: 71 VAAWGECNHAFHLHCITQWIKSRNVCPL 98

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 31.2 bits (69), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           C H F  +C+  W+S  + CP+CR
Sbjct: 722 CGHIFHTQCLESWMSYKLQCPVCR 745

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 30.8 bits (68), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 49  CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCR 93
           CP+C  K   +   L+     C H F  +C+  W  K+  CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVT--TPCQHTFHCKCLDQW--KNGNCPVCR 255

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
          complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 30.0 bits (66), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 14/28 (50%)

Query: 64 IVELPRCNHRFDLECISVWLSKSVTCPL 91
          +     CNH F L CI+ WL     CPL
Sbjct: 69 VAAWGTCNHAFHLHCINKWLLTRNACPL 96

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 30.8 bits (68), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           CNH F   C+  W++  + CP+CR
Sbjct: 729 CNHVFHTSCLENWMNYKLQCPVCR 752

>Scas_585.5*
          Length = 109

 Score = 29.6 bits (65), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 64 IVELPRCNHRFDLECISVWLSKSVTCPL 91
          +     CNH F L CI+ W+     CPL
Sbjct: 70 VAAWGTCNHAFHLHCINKWIKTRDACPL 97

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 30.8 bits (68), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 33   FIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLC 92
            ++ +L R+K    +++   C     E +   I+   +C H F   CI  WL     CP+C
Sbjct: 1220 YLKNLSRLKDTLNDNQILSCSICLGEVEIGAII---KCGHYFCKSCILTWLRAHSKCPIC 1276

Query: 93   R 93
            +
Sbjct: 1277 K 1277

>Scas_718.77
          Length = 128

 Score = 29.6 bits (65), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 7/51 (13%)

Query: 46  NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSV---TCPLCR 93
           N  CP C    S       V +  C H F + C+  WL+ +     CP+CR
Sbjct: 54  NAVCPSC----SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCR 100

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 30.0 bits (66), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 63 LIVELPRCNHRFDLECISVWLSKS----VTCPLCRDNV 96
          L+  +  C H +  +CIS WL+ +    +TCP CR +V
Sbjct: 2  LVPVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 29.3 bits (64), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 13/22 (59%)

Query: 70  CNHRFDLECISVWLSKSVTCPL 91
           CNH F L CI+ W+     CPL
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4641
            bp, 1546 aa]
          Length = 1546

 Score = 30.0 bits (66), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 47   DECPIC--CCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSV--TCPLCRDNV 96
            +EC IC       + K P  V  P C++RF   C+  W   S   TCPLCR  +
Sbjct: 1490 EECAICYSILHVVDRKLPSKV-CPTCSNRFHGACLYKWFKSSGNNTCPLCRGEI 1542

>Scas_573.9
          Length = 1502

 Score = 29.6 bits (65), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 6/60 (10%)

Query: 34   IASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCR 93
            + SL      +K+ +C IC    S      +  + +C H F   CI+ WL     CP+C+
Sbjct: 1176 LQSLRESIENNKSFKCSICLQDIS------LGSMLKCGHFFCKRCITSWLKNKKNCPMCK 1229

>ACR267C [1314] [Homologous to ScYNL116W - SH; ScYHR115C - SH]
           (841323..842726) [1404 bp, 467 aa]
          Length = 467

 Score = 29.6 bits (65), Expect = 0.54,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 9/94 (9%)

Query: 13  LQEEWFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNH 72
           L + W  + +  NK+  +   + +L ++ +  + ++C IC CK    +   I     C+H
Sbjct: 334 LNKSWKRRANAFNKEALAR--LRNLQKLTAGLEEEDCSICLCKIKPCQAIFISP---CSH 388

Query: 73  RFDLECISVWLSK---SVTCPLCRDNV-LEHKLN 102
            +  +CI   +        CP CR +  LE  L+
Sbjct: 389 SWHYQCIRRLVMTQYPQFICPNCRSSCDLEASLD 422

>Scas_625.4
          Length = 761

 Score = 29.6 bits (65), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 15/24 (62%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           C+H F  +C+  W+   + CP+CR
Sbjct: 732 CDHIFHTDCLENWMGYKLQCPVCR 755

>AER208C [2710] [Homologous to ScYGR077C (PEX8) - SH]
           (1021972..1023663) [1692 bp, 563 aa]
          Length = 563

 Score = 29.3 bits (64), Expect = 0.65,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 9/48 (18%)

Query: 34  IASLPRVKSKHKNDECPICCCKFSEDKY---------PLIVELPRCNH 72
           I   P++ +K    EC I  C+F +DKY          LI E+P+  H
Sbjct: 484 ILQFPKIPTKAVLCECLILQCQFVKDKYLSGWLDNCLELIAEIPQPQH 531

>Scas_675.30
          Length = 542

 Score = 29.3 bits (64), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 11  ENLQEEWFEQMDE--KNKKHCSEEFIASLPRVKSKHKND-ECPICCCKFSEDKYPLIVEL 67
           E L E W E+MDE  +     S E   S      KH+ND  C ICC + + D + L    
Sbjct: 128 ERLLEAWTEKMDELLQQIGLKSAEVNGSSDVRGIKHRNDFMCIICCEEKNTDTFSL---- 183

Query: 68  PRCNHRFDLECISVWL 83
             C H + L+C   ++
Sbjct: 184 -ECGHEYCLDCYRHYI 198

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 28.9 bits (63), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 6/47 (12%)

Query: 49 CPICCCKFSEDKYPLIVELPRCNHRFDLECISVW--LSKSVTCPLCR 93
          C IC     ++    I  L  C H + LECI  W   S+   CP CR
Sbjct: 6  CSICLEALGQN----IGRLVTCQHEYHLECIREWHNHSQDFKCPTCR 48

>Scas_696.17
          Length = 1564

 Score = 29.3 bits (64), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 68   PRCNHRFDLECISVWL--SKSVTCPLCRDNVLEHK 100
            P C ++F   C+  W   S + TCPLCR  +  H+
Sbjct: 1530 PTCKNKFHGACLYKWFRSSGNNTCPLCRSEIPLHR 1564

>Kwal_26.8030
          Length = 660

 Score = 28.9 bits (63), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 24/64 (37%), Gaps = 1/64 (1%)

Query: 49  CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSKT 108
           CPIC         P++   P C H     C   +   S  CP C+ +VL  +        
Sbjct: 386 CPICGDFMFTSVKPVVYMSP-CGHAIHQHCFDEYTKHSYKCPSCQVSVLNMEAQFRVLDK 444

Query: 109 EFEE 112
           E EE
Sbjct: 445 EIEE 448

>AGL217W [4095] [Homologous to ScYOL054W - SH]
          complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 28.5 bits (62), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 10/52 (19%)

Query: 49 CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWL----SKSVTCPLCRDNV 96
          C IC        Y  +  +  C H +   CIS WL    S  + CP CR ++
Sbjct: 38 CTIC------HDYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSI 83

>Scas_665.1
          Length = 392

 Score = 28.5 bits (62), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 10/54 (18%)

Query: 49 CPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLS----KSVTCPLCRDNVLE 98
          C IC       +Y  +  +  C H +   C+  W+S    K + CP CR ++ +
Sbjct: 30 CTICS------EYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITD 77

>Kwal_14.1287
          Length = 1518

 Score = 28.5 bits (62), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 69   RCNHRFDLECISVWLSKSVTCPLCR 93
            +C H F  +CI  WL    +CPLC+
Sbjct: 1203 KCGHFFCQDCICSWLKNHSSCPLCK 1227

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 28.5 bits (62), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 9/65 (13%)

Query: 32   EFIASLPRVKSKHKND---ECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT 88
            +++ +L +++   K++    C IC C   +        +    H +  ECIS WL    +
Sbjct: 1199 KYLQNLTKLEQALKDNMRFNCTICLCDICDGA------IIGRGHFYCQECISSWLETKQS 1252

Query: 89   CPLCR 93
            CPLC+
Sbjct: 1253 CPLCK 1257

>Kwal_27.10419
          Length = 300

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 4/31 (12%)

Query: 67 LPRCNHRFDLECISVWL----SKSVTCPLCR 93
          +  C H +  +CIS WL    +  +TCP CR
Sbjct: 6  MTTCGHNYCYDCISNWLVSNNANELTCPQCR 36

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
          (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 28.1 bits (61), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 4/36 (11%)

Query: 67 LPRCNHRFDLECISVWLSKSVTCPLC----RDNVLE 98
          L +C H F   CI  +L+K   CPLC    R N+L+
Sbjct: 44 LTQCGHTFCSLCIREYLNKESRCPLCLAELRQNMLQ 79

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 27.7 bits (60), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 10/70 (14%)

Query: 26  KKHCSEEF--IASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWL 83
           KKH S++   +  LP +K   +  +C +C        Y L      C H F  +CI  W 
Sbjct: 232 KKHTSKDLSDLEVLPFIKEDSR--KCVLCL------NYMLDPSATPCGHLFCWDCIMEWT 283

Query: 84  SKSVTCPLCR 93
            +   CPLCR
Sbjct: 284 LERQECPLCR 293

>YNL116W (YNL116W) [4478] chr14 (408341..409909) Protein containing
           a forkhead associated (FHA) domain, which bind
           phosphopeptides, and a C3HC4 type (RING) zinc finger,
           which may mediate protein-protein interactions, has a
           region of moderate similarity to S. pombe Dma1p, which
           acts in spindle checkpoint [1569 bp, 522 aa]
          Length = 522

 Score = 28.1 bits (61), Expect = 2.0,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 13  LQEEWFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFSEDKYPLIVELPRCNH 72
           L   W  + +  NK+  + + + +L ++ +  + ++C IC CK    +   I     C H
Sbjct: 399 LNRSWKLKANSFNKE--ALQRLQNLQKLTTGIEEEDCSICLCKIKPCQAIFISP---CAH 453

Query: 73  RFDLECIS--VWLS-KSVTCPLCRDN 95
            +   C+   V LS     CP CR +
Sbjct: 454 SWHFRCVRRLVMLSYPQFVCPNCRSS 479

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 28.1 bits (61), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 2/31 (6%)

Query: 68   PRCNHRFDLECISVWL--SKSVTCPLCRDNV 96
            P C ++F   C+  W   S + TCPLCR  +
Sbjct: 1528 PTCKNKFHGACLYKWFRSSGNNTCPLCRSEI 1558

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
          Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 27.7 bits (60), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 66 ELPRCNHRFDLECISVW--LSKSVTCPLCR 93
          EL  C HR+ + CI  W   S    CP CR
Sbjct: 19 ELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 27.7 bits (60), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           C H F  +CI+ W  ++  CPLCR
Sbjct: 292 CGHVFCWDCITDWTKENPECPLCR 315

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 26.9 bits (58), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 15/32 (46%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKL 101
           C H F   CI  W  +   CPLCR   L+  +
Sbjct: 66  CGHIFCWNCIINWCKERSECPLCRQKCLKQSI 97

>Kwal_55.21206
          Length = 275

 Score = 27.3 bits (59), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%)

Query: 70  CNHRFDLECISVWLSK-SVTCPLCR 93
           CNH F   CI  W+ + S  CPLC+
Sbjct: 138 CNHVFHTYCIDQWICRNSACCPLCK 162

>Kwal_14.2375
          Length = 535

 Score = 26.9 bits (58), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 14/90 (15%)

Query: 11  ENLQEEWFEQMDEKNKKHCSEEFIAS--LPRVKSKHKNDECPICCCKFSEDKYPLIVELP 68
           E L E+W +  D K    C  +  ++   PR   +H N  C ICC    +  + L     
Sbjct: 127 ERLLEDWTDDRD-KVVASCGLKLSSAPKGPRGIQEHTNYLCHICCEASKKKTFAL----- 180

Query: 69  RCNHRFDLECISVWL------SKSVTCPLC 92
            C H + LEC   ++       K +TC  C
Sbjct: 181 ECGHEYCLECYKHYIKDKLLEGKIITCMSC 210

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 26.6 bits (57), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%)

Query: 67  LPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKL 101
           L  C H F   CI  +L K   CPLC  ++ E  L
Sbjct: 44  LTPCGHSFCSICIRKYLQKESKCPLCLSDLTESML 78

>Sklu_2238.5 YKR017C, Contig c2238 9398-11044 reverse complement
          Length = 548

 Score = 26.6 bits (57), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 11/60 (18%)

Query: 39  RVKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWL------SKSVTCPLC 92
           R    HKN  C ICC    E+ + L      C H + LEC   ++       K +TC  C
Sbjct: 169 RGIQHHKNFMCYICCESDKEETFAL-----ECGHEYCLECYKHYIQDKLADGKIITCMSC 223

>Scas_615.13
          Length = 330

 Score = 26.2 bits (56), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 13/24 (54%)

Query: 70  CNHRFDLECISVWLSKSVTCPLCR 93
           C H F  ECI  W  +   CPLCR
Sbjct: 295 CGHIFCWECILDWCKERPECPLCR 318

>Kwal_27.11518
          Length = 953

 Score = 26.2 bits (56), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 18/48 (37%)

Query: 40 VKSKHKNDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSV 87
          VK   K D  P   C    D    +   P C   FD ECI  W  KS 
Sbjct: 50 VKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKST 97

>Kwal_14.1314
          Length = 1111

 Score = 26.2 bits (56), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 13  LQEEWFEQMDEKNKKHCSEEFIASLPRVKSKHKNDECPICCCKFS 57
           LQE   E+ D  ++   +EE +A+L R+K   K+ E      K S
Sbjct: 315 LQEPSSEESDSNDQSMTAEETMAALKRMKESKKSKEASGTKMKQS 359

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,215,510
Number of extensions: 173143
Number of successful extensions: 636
Number of sequences better than 10.0: 107
Number of HSP's gapped: 625
Number of HSP's successfully gapped: 107
Length of query: 118
Length of database: 16,596,109
Length adjustment: 88
Effective length of query: 30
Effective length of database: 13,549,725
Effective search space: 406491750
Effective search space used: 406491750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)