Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_548.5*98998937110.0
CAGL0H06215g10951115011e-51
YOL051W (GAL11)10811104522e-45
KLLA0F07579g10343454281e-42
CAGL0F00803g8381094125e-41
ACR285C13232443951e-38
Kwal_26.713610833013655e-35
Scas_643.236531102072e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_548.5*
         (989 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_548.5*                                                          1434   0.0  
CAGL0H06215g 609128..612415 similar to sp|P19659 Saccharomyces c...   197   1e-51
YOL051W (GAL11) [4769] chr15 (234938..238183) Component of RNA p...   178   2e-45
KLLA0F07579g complement(713403..716507) gi|1169834|sp|P32257|GAL...   169   1e-42
CAGL0F00803g 88454..90970 similar to sp|P19659 Saccharomyces cer...   163   5e-41
ACR285C [1332] [Homologous to ScYOL051W (GAL11) - SH] (873065..8...   156   1e-38
Kwal_26.7136                                                          145   5e-35
Scas_643.23                                                            84   2e-16

>Scas_548.5*
          Length = 989

 Score = 1434 bits (3711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/989 (75%), Positives = 750/989 (75%)

Query: 1   MSSSSKDSVTMEDRSKHVSELLKVLMDINVMNGGNTDTAEKMKLHAKNFESALYAKSSSK 60
           MSSSSKDSVTMEDRSKHVSELLKVLMDINVMNGGNTDTAEKMKLHAKNFESALYAKSSSK
Sbjct: 1   MSSSSKDSVTMEDRSKHVSELLKVLMDINVMNGGNTDTAEKMKLHAKNFESALYAKSSSK 60

Query: 61  KEYLDSMQEKVSAMRNTRDARQKAIDQRTDQMNMQRSXXXXXXXASNNYIPPAKFXXXXX 120
           KEYLDSMQEKVSAMRNTRDARQKAIDQRTDQMNMQRS       ASNNYIPPAKF     
Sbjct: 61  KEYLDSMQEKVSAMRNTRDARQKAIDQRTDQMNMQRSQQQQQQQASNNYIPPAKFNNNGN 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKIAP 180
                                                                  MKIAP
Sbjct: 121 NNPNGNINPQAFMNQQAQARQQAALQLKNRQAVQQQQQQQQRAQLSPQQQQLINQMKIAP 180

Query: 181 IPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIHXXXXXXXXXXXXXX 240
           IPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIH              
Sbjct: 181 IPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIHQQLLLKSKLQQQQQ 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNVPVNSNGNQQRPQNQSRELPNVLGQI 300
                                           RNVPVNSNGNQQRPQNQSRELPNVLGQI
Sbjct: 241 QRTNGNNNDNGLVPNNQMQQQQQQQQQQQQQQRNVPVNSNGNQQRPQNQSRELPNVLGQI 300

Query: 301 NQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIRKYINQKALKKIQTIRMX 360
           NQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIRKYINQKALKKIQTIRM 
Sbjct: 301 NQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIRKYINQKALKKIQTIRMA 360

Query: 361 XXXXXXXXNGNIPKSQSNQPVPSQRNNGQQPTPSINGFNGNANMNQVPNPQINNMPPTSN 420
                   NGNIPKSQSNQPVPSQRNNGQQPTPSINGFNGNANMNQVPNPQINNMPPTSN
Sbjct: 361 QQSAAAAANGNIPKSQSNQPVPSQRNNGQQPTPSINGFNGNANMNQVPNPQINNMPPTSN 420

Query: 421 GAPMQNXXXXXXXXXXXXXXXXXXXXXXXPQDIETVRKISSDASRTPLRLSDITNSLSPQ 480
           GAPMQN                       PQDIETVRKISSDASRTPLRLSDITNSLSPQ
Sbjct: 421 GAPMQNQHQLTPQQRAAQQQRVMQMLQPTPQDIETVRKISSDASRTPLRLSDITNSLSPQ 480

Query: 481 EKEEIKRKLQMNQQLFAQVSNYAPQVYVFTKSEGFLKEVLQLRIFVKEILEKCAEGIFVV 540
           EKEEIKRKLQMNQQLFAQVSNYAPQVYVFTKSEGFLKEVLQLRIFVKEILEKCAEGIFVV
Sbjct: 481 EKEEIKRKLQMNQQLFAQVSNYAPQVYVFTKSEGFLKEVLQLRIFVKEILEKCAEGIFVV 540

Query: 541 KLDTVDKLVMKYQKYWESMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPISXX 600
           KLDTVDKLVMKYQKYWESMK                                  PPIS  
Sbjct: 541 KLDTVDKLVMKYQKYWESMKLQLLRRQQLIQEQQAQNNQTQGQNNNNNVNGVANPPISQQ 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXTPHLNNNTGTTTPVVSAVPSKSNIPASNYQQMVSSNIG 660
                                 TPHLNNNTGTTTPVVSAVPSKSNIPASNYQQMVSSNIG
Sbjct: 601 QQRVQGSMQQIQQQMQQKQWQQTPHLNNNTGTTTPVVSAVPSKSNIPASNYQQMVSSNIG 660

Query: 661 PVMSNKTASATPALSERISPKKEASVKGNRGKSVSKKNSPATATATSGTINQATPSNIVG 720
           PVMSNKTASATPALSERISPKKEASVKGNRGKSVSKKNSPATATATSGTINQATPSNIVG
Sbjct: 661 PVMSNKTASATPALSERISPKKEASVKGNRGKSVSKKNSPATATATSGTINQATPSNIVG 720

Query: 721 SKSNTPMVGNFASPLVPNKTSTQQPQNSPSPLTVPVAXXXXXXXXXXXPYRGEEEKLADL 780
           SKSNTPMVGNFASPLVPNKTSTQQPQNSPSPLTVPVA           PYRGEEEKLADL
Sbjct: 721 SKSNTPMVGNFASPLVPNKTSTQQPQNSPSPLTVPVANIANNNNNKMNPYRGEEEKLADL 780

Query: 781 NIKKSEIMSRFKHRREVYGESQIDLFLLTLGDCLGCKDGNMEPIYEIPQIMIDHTNGTGK 840
           NIKKSEIMSRFKHRREVYGESQIDLFLLTLGDCLGCKDGNMEPIYEIPQIMIDHTNGTGK
Sbjct: 781 NIKKSEIMSRFKHRREVYGESQIDLFLLTLGDCLGCKDGNMEPIYEIPQIMIDHTNGTGK 840

Query: 841 KKVTKAVQRIXXXXXXXXXXXXXKLIMQSKSKPEDRSYTIDIRDVASVFKNASGLCNLTD 900
           KKVTKAVQRI             KLIMQSKSKPEDRSYTIDIRDVASVFKNASGLCNLTD
Sbjct: 841 KKVTKAVQRIRDRDVVNVNVRDNKLIMQSKSKPEDRSYTIDIRDVASVFKNASGLCNLTD 900

Query: 901 MSISPNIKFSEGTNKKKRKLQDVDIXXXXXXXXXXXXLMSESKRIKIDSPDDMFMGKTSV 960
           MSISPNIKFSEGTNKKKRKLQDVDI            LMSESKRIKIDSPDDMFMGKTSV
Sbjct: 901 MSISPNIKFSEGTNKKKRKLQDVDISPVGSNTSPSSSLMSESKRIKIDSPDDMFMGKTSV 960

Query: 961 NEDTADMDKTNLNVAQNIWDWNYWETVKQ 989
           NEDTADMDKTNLNVAQNIWDWNYWETVKQ
Sbjct: 961 NEDTADMDKTNLNVAQNIWDWNYWETVKQ 989

>CAGL0H06215g 609128..612415 similar to sp|P19659 Saccharomyces
           cerevisiae YOL051w GAL11, hypothetical start
          Length = 1095

 Score =  197 bits (501), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 107/111 (96%)

Query: 450 PQDIETVRKISSDASRTPLRLSDITNSLSPQEKEEIKRKLQMNQQLFAQVSNYAPQVYVF 509
           P+D+E VR+IS++A++T LRL+D+TNSL+PQE++EIK++LQ NQQLFAQVS+YAPQVY+F
Sbjct: 509 PEDVEVVRRISAEAAKTQLRLTDLTNSLTPQERDEIKKRLQKNQQLFAQVSSYAPQVYLF 568

Query: 510 TKSEGFLKEVLQLRIFVKEILEKCAEGIFVVKLDTVDKLVMKYQKYWESMK 560
           TKSE FLKEVLQLRIF+KEILEKC++GI+VVKLDTVDKLV+KYQKYWESMK
Sbjct: 569 TKSESFLKEVLQLRIFIKEILEKCSKGIYVVKLDTVDKLVIKYQKYWESMK 619

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 173/357 (48%), Gaps = 40/357 (11%)

Query: 663  MSNKTASATPALSERISPKKEASVKGNRGKSV-SKKNSPATATATSGTINQATPSNIVGS 721
            + N TAS++   S +   K  A V G +  +  + +  PAT  +T+      TP+  + +
Sbjct: 748  LKNDTASSSRRGSTKPRGKSTAPVTGKKTSNAPTPQVVPATVPSTTNLSAAGTPN--IRN 805

Query: 722  KSNTPMVGNFA--SPLVPNKTSTQQPQNSPSPLTVPVAXXXXXXXXXXXPYRGEEEKLAD 779
            KS TP+    +  S +  N  +      +PSP+TV +             ++ EEE L+ 
Sbjct: 806  KSATPLTAGLSPKSTIRSNSNTALASAKTPSPMTVSIPQPGNSSV-----FKKEEEYLSK 860

Query: 780  LNIKKSEIMSRFKHRREVYGESQIDLFLLTLGDCLGCKDGNMEPIYEIPQIMIDHTNGTG 839
            L ++K EI  R K R ++   S +DLFL T+ DCLG  D  +E I +IP+   D+ N TG
Sbjct: 861  LQLRKEEIRFRQKQRLDILSSSPVDLFLTTVADCLGINDEEIELINKIPETTADNINNTG 920

Query: 840  KKKVTKAVQRIXXXX---XXXXXXXXXKLIMQSKSKPEDRSYTIDIRDVASVFKNASGLC 896
            KKK+TKA Q++                KLIM SK+  +   Y+I    +A+VFKN S   
Sbjct: 921  KKKLTKAAQKLRDKEILNVSIQVGEKDKLIMSSKAPDKVMDYSISAMSLAAVFKNLSSTG 980

Query: 897  NLTDMSIS-PNIKFSEG-------TNKKKRKLQDVDIXXXXXXXXXXXXLMSESKRIKID 948
            +L ++++S  N   S+        T   KRK  +V+I            +MSESK+IKID
Sbjct: 981  SLNNIALSGSNATTSKDIGNIYSHTGGVKRKFDEVEI-SPNSNGSPSASIMSESKKIKID 1039

Query: 949  SPDDMFM------GKTSVNEDTADMDK-----------TNLNVAQNIWDWNYWETVK 988
            SP+DMF+       K + N    D  K           T +N   +IWDWN+W +++
Sbjct: 1040 SPEDMFVTHSSEAAKGTNNSSLMDSGKEGSCKSMAGSATEVN-DTSIWDWNFWTSIE 1095

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%)

Query: 4  SSKDSVTMEDRSKHVSELLKVLMDINVMNGGNTDTAEKMKLHAKNFESALYAKSSSKKEY 63
          SSK+++ M  RS++V+ELL VLMDIN +NGG++ TAEKMK+HAK+FE+AL+ KSSSK+EY
Sbjct: 2  SSKETIPMHQRSQNVAELLTVLMDINKINGGDSTTAEKMKVHAKSFEAALFEKSSSKEEY 61

Query: 64 LDSMQEKVSAMRNTRDARQK 83
            +M+ K+ AMR+TRD R++
Sbjct: 62 QKTMKSKIDAMRSTRDKRKR 81

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 38/51 (74%), Positives = 46/51 (90%)

Query: 176 MKIAPIPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIH 226
           M++APIP+ELLQ+IPN+P GVTTW+QVT LAQQ RLS QDM IAK++YKIH
Sbjct: 205 MRVAPIPKELLQRIPNLPPGVTTWEQVTALAQQNRLSAQDMSIAKDIYKIH 255

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 4/84 (4%)

Query: 295 NVLGQINQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIRKYINQKALKKI 354
           NVL QINQ+F+ +EQRALLQEAMEACKN+Q+  FG   + D  +Q FI+K+IN KALKK+
Sbjct: 327 NVLSQINQMFTADEQRALLQEAMEACKNFQKTHFG-GQMSDANKQAFIKKFINSKALKKL 385

Query: 355 QTIRMXXXXXXXXXNGNIPKSQSN 378
           + +RM         N N+ K Q++
Sbjct: 386 EAMRM---AQGGNNNANLNKGQAD 406

>YOL051W (GAL11) [4769] chr15 (234938..238183) Component of RNA
           polymerase II holoenzyme and Kornberg's mediator complex
           with positive and negative effects on transcription of
           individual genes [3246 bp, 1081 aa]
          Length = 1081

 Score =  178 bits (452), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/110 (71%), Positives = 99/110 (90%)

Query: 451 QDIETVRKISSDASRTPLRLSDITNSLSPQEKEEIKRKLQMNQQLFAQVSNYAPQVYVFT 510
           +D+E ++++S DAS+T LRL+D+TNSLS +EKE+IK KL+  Q+LF QVSN+APQVY+ T
Sbjct: 509 KDVEVIKQLSLDASKTNLRLTDVTNSLSNEEKEKIKMKLKQGQKLFVQVSNFAPQVYIIT 568

Query: 511 KSEGFLKEVLQLRIFVKEILEKCAEGIFVVKLDTVDKLVMKYQKYWESMK 560
           K+E FLKEV QLRIFVKEILEKCAEGIFVVKLDTVD+L++KYQKYWESM+
Sbjct: 569 KNENFLKEVFQLRIFVKEILEKCAEGIFVVKLDTVDRLIIKYQKYWESMR 618

 Score =  160 bits (406), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 118/361 (32%), Positives = 171/361 (47%), Gaps = 23/361 (6%)

Query: 645  NIPASNYQQMVSSNIGPVMSNK-----TASATPALSERISPKKEASVKGNRGKSVSKKNS 699
            NIP  N++   S +    M N      +A+ATP+L++ I+ K     K N     S  ++
Sbjct: 719  NIPYMNHKNTSSMDFLNSMENTPKVPVSAAATPSLNKTINGKVNGRTKSNTIPVTSIPST 778

Query: 700  PATATATSGTINQATPSNIVGSKSNTPMVGNFASPL-VPNKTSTQQPQNSPSPLTVPVAX 758
                + ++    Q TP +   +  +TP      SPL    K  T  P N  +  +   A 
Sbjct: 779  NKKLSISNAASQQPTPRSASNTAKSTPNTN--PSPLKTQTKNGTPNPNNMKTVQSPMGAQ 836

Query: 759  XXXXXXXXXXPYRGEEEKLADLNIKKSEIMSRFKHRREVYGESQIDLFLLTLGDCLGCKD 818
                       +R EE  L DL I+K EI SRFKHR+E++ +S +DLF+ TLGDCLG KD
Sbjct: 837  PSYNSAIIENAFRKEELLLKDLEIRKLEISSRFKHRQEIFKDSPMDLFMSTLGDCLGIKD 896

Query: 819  GNMEPIYEIPQIMIDHTNGTGKKKVTKAVQRIXXXXXXXXXXXXXKLIMQSKSKPEDRSY 878
              M     IP+ ++DH NG+GK+K TKA QR              KL+M+SK    +RSY
Sbjct: 897  EEMLTSCTIPKAVVDHINGSGKRKPTKAAQRARDQDSIDISIKDNKLVMKSKFNKSNRSY 956

Query: 879  TIDIRDVASVFKNASG----LCNLTDMSISPNIKFSEGTNKKKRKLQDVDIX---XXXXX 931
            +I + +VA++FK   G    L  L   S        +  N +KRK   ++I         
Sbjct: 957  SIALSNVAAIFKGIGGNFKDLSTLVHSSSPSTSSNMDVGNPRKRKASVLEISPQDSIASV 1016

Query: 932  XXXXXXLMSESKRIKIDSPDDMFMGKTS--------VNEDTADMDKTNLNVAQNIWDWNY 983
                  +MS+SK+IK+DSPDD FM K+         V  +   +     +   N+WDWN 
Sbjct: 1017 LSPDSNIMSDSKKIKVDSPDDPFMTKSGATTSEKQEVTNEAPFLTSGTSSEQFNVWDWNN 1076

Query: 984  W 984
            W
Sbjct: 1077 W 1077

 Score =  151 bits (381), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 107/185 (57%), Gaps = 6/185 (3%)

Query: 176 MKIAPIPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIHXXXXXXXXX 235
           MK+APIP++LLQ+IPNIP  + TWQQVT LAQQK L+PQDM+ AKE+YKIH         
Sbjct: 173 MKVAPIPKQLLQRIPNIPPNINTWQQVTALAQQKLLTPQDMEAAKEVYKIHQQLLFKARL 232

Query: 236 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNVPVNSNGNQQRPQNQSRE--L 293
                                                     NS+ N    Q QS +  +
Sbjct: 233 QQQQAQAQAQANNNNNGLPQNGNINNNINIPQQQQMQP---PNSSANNNPLQQQSSQNTV 289

Query: 294 PNVLGQINQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIRKYINQKALKK 353
           PNVL QINQIFS EEQR+LLQEA+E CKN+++ Q G + + +  +Q FIRKYINQKAL+K
Sbjct: 290 PNVLNQINQIFSPEEQRSLLQEAIETCKNFEKTQLG-STMTEPVKQSFIRKYINQKALRK 348

Query: 354 IQTIR 358
           IQ +R
Sbjct: 349 IQALR 353

 Score =  108 bits (271), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 69/77 (89%)

Query: 6  KDSVTMEDRSKHVSELLKVLMDINVMNGGNTDTAEKMKLHAKNFESALYAKSSSKKEYLD 65
          KD+++  +R+K+V+ LL+VLMDIN +NGG++DTA+K+++HAKNFE+AL+AKSSSKKEY+D
Sbjct: 9  KDTLSNAERAKNVNGLLQVLMDINTLNGGSSDTADKIRIHAKNFEAALFAKSSSKKEYMD 68

Query: 66 SMQEKVSAMRNTRDARQ 82
          SM EKV+ MRNT + R+
Sbjct: 69 SMNEKVAVMRNTYNTRK 85

>KLLA0F07579g complement(713403..716507)
            gi|1169834|sp|P32257|GALY_KLULA Kluyveromyces lactis
            TRANSCRIPTION REGULATORY PROTEIN GAL11, start by
            similarity
          Length = 1034

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 109/345 (31%), Positives = 170/345 (49%), Gaps = 47/345 (13%)

Query: 668  ASATPALSERISPKKEASVKGNRGKSVSKKNSPATATATSGTINQATPSNIVGSKSNTPM 727
            ++ +PA+      KK  + +  +GK  S+   P +   ++        +++V S++ TP 
Sbjct: 712  SAISPAVPSPNKDKKNPATRAVKGKKNSQSGIPTSNPQSNSN------ASVVNSRTATPT 765

Query: 728  VGNFASPLVPNKTSTQQPQNSPSPLTVPVAXXXXXXXXXXXPYRGEEEKLADLNIKKSEI 787
            V   +SP+  NK+     QNSPSP T+              PY+ +E  L  + I+ +E+
Sbjct: 766  VIPGSSPMFNNKSLASGQQNSPSPKTM-----INSPPQQDNPYKNDELALKKMAIRTAEL 820

Query: 788  MSRFKHRREVYGESQIDLFLLTLGDCLGCKDGNMEPIYEIPQIMIDHTNGTGKKKVTKAV 847
            MSR+KHR+EV+  S IDLFL T  DCL  KD  ++ +++ PQ ++D  NGTGKKK++KA 
Sbjct: 821  MSRYKHRKEVFVMSSIDLFLSTFADCLDIKDDAVDLVHKTPQPILDQINGTGKKKLSKAA 880

Query: 848  QRIXXXXXXXXXXXXXKLIMQSKSKPEDRSYTIDIRDVASVFKNASGLCNLTDMSISPNI 907
            Q+              KL+M SKS+   RS+ I I D+ + FK  +    L        +
Sbjct: 881  QKARDQDPVEISVRNNKLLMPSKSEKTLRSFKIPIADITACFKPFADPKQLI-------L 933

Query: 908  KFSEGTNKKKRKLQDVDIXXXXXXXXXXXXLMSESKRIKIDSPDDMFMGKTSVNEDTADM 967
              +   ++KKRK  D++I            LMSESK++K DSPDDMF+   S  ++T  +
Sbjct: 934  NSTPKHDEKKRKFDDLEI----SPTDSSSELMSESKKVKFDSPDDMFLNDPSSVQETKPL 989

Query: 968  DKTNLNV-------------------------AQNIWDWNYWETV 987
              + L +                           NIWDWNYWE++
Sbjct: 990  VPSELGMYSINSKPSIPSSAGNMPAPNESTDSGMNIWDWNYWESL 1034

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 83/110 (75%)

Query: 451 QDIETVRKISSDASRTPLRLSDITNSLSPQEKEEIKRKLQMNQQLFAQVSNYAPQVYVFT 510
           QD+  ++K++++ ++ P++L+DITN L+  +K++I+ KL  NQQLF+ V ++ P +Y+ T
Sbjct: 501 QDMLALKKLNAEVTKNPVKLNDITNRLTNDQKQQIRSKLHANQQLFSSVESFIPTLYMLT 560

Query: 511 KSEGFLKEVLQLRIFVKEILEKCAEGIFVVKLDTVDKLVMKYQKYWESMK 560
           ++E  ++++LQ+R+  +EI+EK   G+F+V+ + VDK++ +YQKY+E  K
Sbjct: 561 RNEEHIRQLLQIRMLTREIMEKAVRGVFLVEPNVVDKVIFRYQKYYEYTK 610

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 39/51 (76%)

Query: 176 MKIAPIPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIH 226
           +K+  IPRELLQKIPN+P G+TTW Q+T  AQ+ R S  D+ I K++Y++H
Sbjct: 193 LKVTEIPRELLQKIPNLPPGITTWPQITFWAQKNRPSQNDLIITKKVYQLH 243

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 59/83 (71%), Gaps = 5/83 (6%)

Query: 6  KDSVTMEDRSKHVSELLKVLMDINVMNGGNTDT--AEKMKLHAKNFESALYAKSSSKKEY 63
          + +++ ++RS+ V+EL ++L D++ +NGG       EK+K  A+ FES+LYA  +SK  Y
Sbjct: 5  RSTISTQERSQFVTELAQILADMSRINGGEKANFNLEKLKKSAEQFESSLYASCNSKDLY 64

Query: 64 LDSMQEKVSAMRNTRDARQKAID 86
          LD+M+++++AM +   A++K+I+
Sbjct: 65 LDAMRKRIAAMDS---AKRKSIE 84

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 292 ELPNVLGQINQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIRKYINQKAL 351
           E P VLG++NQ+F+  EQ+ L +   +  +N QR+     N+  Q + L+I+KY+NQ  L
Sbjct: 314 EPPAVLGRLNQVFTQAEQKMLYEAGKKMIENLQRSGKLPPNLDSQQQLLYIKKYMNQMVL 373

Query: 352 KKIQTI 357
           KK+Q +
Sbjct: 374 KKMQQL 379

>CAGL0F00803g 88454..90970 similar to sp|P19659 Saccharomyces
           cerevisiae YOL051w GAL11 DNA-directed RNA polymerase II,
           hypothetical start
          Length = 838

 Score =  163 bits (412), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 94/109 (86%)

Query: 452 DIETVRKISSDASRTPLRLSDITNSLSPQEKEEIKRKLQMNQQLFAQVSNYAPQVYVFTK 511
           DIE +R IS  A++  L+L+D+TN+L+ +EK+ I+ +L+ NQ+LF QVSN+APQVY+ TK
Sbjct: 443 DIEEIRNISMKAAKLQLQLTDLTNTLTNEEKDAIRSRLKTNQKLFVQVSNFAPQVYMMTK 502

Query: 512 SEGFLKEVLQLRIFVKEILEKCAEGIFVVKLDTVDKLVMKYQKYWESMK 560
           S+ FLKEV QLRIFVKEILEKCA GIFVVKL+TVDKL+MKYQ+YW+SM+
Sbjct: 503 SKNFLKEVFQLRIFVKEILEKCANGIFVVKLETVDKLIMKYQRYWDSMR 551

 Score =  106 bits (264), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 108/212 (50%), Gaps = 30/212 (14%)

Query: 687 KGNRGKSVSKKNSPATATATSGTINQATPSNIVGSKSNTPMVGNFASPLVPNKTSTQQPQ 746
           K +R  SVS  N+    T TSG     + SN   S+SN+  +   +S       ST+QPQ
Sbjct: 638 KESRKPSVSASNASTPGT-TSGKAKPKSRSNRQNSRSNS--INEVSSD------STKQPQ 688

Query: 747 NSPSPLTVPVAXXXXXXXXXXXPYRGEEEKLADLNIKKSEIMSRFKHRREVYGESQIDLF 806
            + +                    + E  K+ + N++KSEI+SRFKHR++++  S  DLF
Sbjct: 689 TTEAV------------------SKEEAAKIHEANVRKSEILSRFKHRQKLFITSPADLF 730

Query: 807 LLTLGDCLGCKDGNMEPIYEIPQIMIDHTNGTGKKKVTKAVQRIXXXXXXXXXXXXXKLI 866
           L TLGDCLG K   +E  Y+IP+ M D  NG    K++K  QRI             KL+
Sbjct: 731 LSTLGDCLGLKCEEIETSYKIPKNMADFINGV---KISKTEQRIRTQDTVVTSVVDNKLL 787

Query: 867 MQSKSKPEDRSYTIDIRDVASVFKNASGLCNL 898
           MQSK+  + R+Y ID   +++VFK   G  N+
Sbjct: 788 MQSKTGGDKRTYGIDPAALSAVFKGVQGTTNM 819

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 58/69 (84%)

Query: 9  VTMEDRSKHVSELLKVLMDINVMNGGNTDTAEKMKLHAKNFESALYAKSSSKKEYLDSMQ 68
          V++ +R++++++L+++LMDIN +NGG++   EK++L A+NFESA+Y KSS+K+EY+ SM+
Sbjct: 5  VSVRERTRNMNQLMRILMDINHLNGGDSGVLEKLRLSARNFESAIYEKSSTKQEYMASMR 64

Query: 69 EKVSAMRNT 77
          EK+  M+ T
Sbjct: 65 EKIEGMQQT 73

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%)

Query: 179 APIPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIH 226
           A IP++LL KIPN+P GV+TW+ VTELA +  L  + M+I + +YK+H
Sbjct: 121 AVIPQQLLSKIPNLPAGVSTWKDVTELASKNMLDQRTMEIVRGVYKVH 168

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 39/59 (66%), Gaps = 3/59 (5%)

Query: 299 QINQIFSTEEQRALLQEAMEACKNY--QRNQFGNANVPDQARQLFIRKYINQKALKKIQ 355
           Q++++F  EE + ++Q+A+E  K Y  QR Q G+  + ++ R +F +K++N   LKK++
Sbjct: 246 QLSKLFKMEEIKHIIQQAIEVGKKYATQRYQLGHM-LTNEERVVFFKKFLNHVILKKME 303

>ACR285C [1332] [Homologous to ScYOL051W (GAL11) - SH]
            (873065..877036) [3972 bp, 1323 aa]
          Length = 1323

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 131/244 (53%), Gaps = 17/244 (6%)

Query: 714  TPSNIVGSKSNTPMVGN--FASPLVPNKTSTQQPQNSPSPLTVPVAXXXXXXXXXXXPYR 771
             P  IV S   +P+ G    A+ +VP    +            P             PY+
Sbjct: 1053 VPPGIVNSSGPSPVAGKQILAATMVPQHKLS------------PTKSDFAQAPTADNPYQ 1100

Query: 772  GEEEKLADLNIKKSEIMSRFKHRREVYGESQIDLFLLTLGDCLGCKDGNMEPIYEIPQIM 831
             +E +L +L I+K+EIMSRFKHR+E++  S +DLFL TL DC+G KDG+ E +  IP +M
Sbjct: 1101 VDELRLKNLAIRKAEIMSRFKHRQEIFEHSPVDLFLCTLADCMGIKDGSYELLAPIPALM 1160

Query: 832  IDHTNGTGKKKVTKAVQRIXXXXXXXXXXXXXKLIMQSKSKPEDRSYTIDIRDVASVFKN 891
            ++  NGTGKKK TKA QR+             KL+M SK   ++RSY+I  RD++S F +
Sbjct: 1161 VEQINGTGKKKFTKAQQRVREQDSIECYVKDNKLMMSSKFSADERSYSIHDRDISSCFLD 1220

Query: 892  ASGLCNLTDMSISPNIKFSEGTNKKKRKLQDVDIXXXXXXXXXXXXLMSESKRIKIDSPD 951
              GL + T +S   +   +E   ++  K++  D             L+++SK++K+DSPD
Sbjct: 1221 LYGLSDCTSLSF--DSSSAEPPTEQVNKIRSHD-SLEISPAESDSSLLNDSKKLKVDSPD 1277

Query: 952  DMFM 955
            D+FM
Sbjct: 1278 DLFM 1281

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 86/110 (78%)

Query: 451 QDIETVRKISSDASRTPLRLSDITNSLSPQEKEEIKRKLQMNQQLFAQVSNYAPQVYVFT 510
           QD+  +++I+S+ +++PLRLS+ITN L+P++K+ IK KLQ NQQL + V N+ P +Y+ T
Sbjct: 791 QDMMILKRINSEVAKSPLRLSNITNQLTPEQKQMIKNKLQANQQLLSNVDNFIPTLYLIT 850

Query: 511 KSEGFLKEVLQLRIFVKEILEKCAEGIFVVKLDTVDKLVMKYQKYWESMK 560
           ++E  ++++LQ+R+  KEI+E  ++G+F+V  D VDK++ +YQKY+E +K
Sbjct: 851 RNEENVRQLLQIRMLAKEIMEHASKGVFIVPPDVVDKVIFRYQKYYEFIK 900

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 47/51 (92%)

Query: 176 MKIAPIPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIH 226
           MK+A IPRELLQ+IPNIP GVTTWQQVTELAQQKRL+  D+QIAK++Y++H
Sbjct: 175 MKVAEIPRELLQRIPNIPPGVTTWQQVTELAQQKRLTQSDLQIAKQVYQMH 225

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 64/91 (70%), Gaps = 9/91 (9%)

Query: 6  KDSVTMEDRSKHVSELLKVLMDINVMNGG---NTDTAEKMKLHAKNFESALYAKSSSKKE 62
          + +++ ++RSK+++EL ++L DI+ +NGG   N D  EK+K  A+ FE++LYA SSSK+ 
Sbjct: 6  RSTLSNQERSKYITELAQILADISQINGGARANFDL-EKLKKTAEQFETSLYASSSSKEL 64

Query: 63 YLDSMQEKVSAM-----RNTRDARQKAIDQR 88
          YLD+M+++++AM     +   + +QKA  QR
Sbjct: 65 YLDAMRKRIAAMDAAKKKTLANQKQKAAAQR 95

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (66%), Gaps = 1/72 (1%)

Query: 289 QSRELPNVLGQINQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIRKYINQ 348
           Q+RE+PNVL ++NQ+FS  EQ+AL +   +  ++ Q      A++  Q + L+I+KYINQ
Sbjct: 397 QAREVPNVLNKLNQVFSPAEQKALYENGKKLVQDLQLAGKLPASLTQQQQILYIKKYINQ 456

Query: 349 KALKKI-QTIRM 359
             LKK+ Q IR+
Sbjct: 457 MVLKKLQQNIRL 468

>Kwal_26.7136
          Length = 1083

 Score =  145 bits (365), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 162/301 (53%), Gaps = 31/301 (10%)

Query: 284 QRPQNQSRELPNVLGQINQIFSTEEQRALLQEAMEACKNYQRNQFGNANVPDQARQLFIR 343
           Q PQ  ++E+PNVL ++NQIF+  EQ+AL +   +  ++ QR     A +  Q + ++I+
Sbjct: 332 QAPQVTTQEMPNVLNRLNQIFTPAEQKALYENGKKLIEDLQRTNRLPAVLAPQQQAIYIK 391

Query: 344 KYINQKALKKIQTIRMXXXXXXXXXNGNIPKSQSNQPVPSQRNNG----QQPTP-SINGF 398
           KYINQ ALKK+Q  RM          G+ P  Q N P+ + +  G     Q TP S N  
Sbjct: 392 KYINQMALKKLQAARMNQM------GGSNPNPQ-NAPLANNQVAGMPTMSQFTPISANIA 444

Query: 399 NGNANMNQ------VP-NPQI--NNMP--------PTSNGAPMQNXXXXXXXXXXXXXXX 441
           N  A M Q      VP NP +  NN+P        P    +  Q                
Sbjct: 445 NVPAGMAQRRTYSGVPANPVVGDNNLPGGNIQVPPPPQQSSTHQLPVSQPQAQSQAQPQA 504

Query: 442 XXXXXXXXP--QDIETVRKISSDASRTPLRLSDITNSLSPQEKEEIKRKLQMNQQLFAQV 499
                   P  QD+  +R+IS++  ++ LRLS+ITN +S ++K+ I+ KLQ+N+QLF  V
Sbjct: 505 QPKFSLPRPTEQDLMVLRRISAEIQKSHLRLSNITNQISQEQKQAIRNKLQLNRQLFTNV 564

Query: 500 SNYAPQVYVFTKSEGFLKEVLQLRIFVKEILEKCAEGIFVVKLDTVDKLVMKYQKYWESM 559
            ++ P +Y+ T++E  ++++LQ+R+  KEI E     +F+V  + VDK++ +YQKY+E +
Sbjct: 565 DSFIPTLYMITRNEENVRQLLQIRMLAKEITEHATRDVFIVPPEVVDKVIFRYQKYYEFI 624

Query: 560 K 560
           K
Sbjct: 625 K 625

 Score =  138 bits (348), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 156/313 (49%), Gaps = 31/313 (9%)

Query: 692  KSVSKKNSPATATATSGT--INQATPS-NIVGSKSNTPMVGNFA----SPLVPNKTSTQQ 744
            K VS + +P+    TS    I    PS  +  S++ TP +G       SP+V NK +   
Sbjct: 785  KQVSNQGTPSAPVITSNNTPIPLTGPSVGVAASRTGTPQMGTAGISSISPMVNNKVANTN 844

Query: 745  PQNSPSPLTVPVAXXXXXXXXXXXPYRGEEEKLADLNIKKSEIMSRFKHRREVYGESQID 804
               SPSP +VP             PY+ +EEK+  L  +K+E++SRFK R++V  +S +D
Sbjct: 845  --QSPSPRSVP---NGVVQQPIEHPYKEDEEKMKKLASRKNEVISRFKRRQDVLKKSPVD 899

Query: 805  LFLLTLGDCLGCKDGNMEPIYEIPQIMIDHTNGTGKKKVTKAVQ-RIXXXXXXXXXXXXX 863
            LFL +L DCLG    + E +  IPQ ++D  NG GKKK  K  + R              
Sbjct: 900  LFLASLSDCLGVPSDSFELLKTIPQDVVDQVNGLGKKKAFKPDEARSKLQDVADVSIVDN 959

Query: 864  KL------IMQSKSKPEDRSYTIDIRDVASVFKNASGLCNLTDMSISPNIKFSEGTNKKK 917
            K+      ++ SKS P    Y I + D+ASVF++  G  +L   S   N  F+     KK
Sbjct: 960  KIVFADSKVLSSKSSP----YGISLADIASVFRDTYGSTDLAAFSFE-NKAFT--GRSKK 1012

Query: 918  RKLQDVDIXXXXXXXXXXXXLMSESKRIKIDSPDDMFMGKTSVN--EDTADMDKTNLNVA 975
            R   ++D             +MSESK++KIDSP+D++   ++ N  ++    D     + 
Sbjct: 1013 RAAGEMD--NSPNPSPASSAIMSESKKLKIDSPEDLYSSISAENCKKEFPKADAGTTYLP 1070

Query: 976  QN-IWDWNYWETV 987
            +N +WDW++W+T+
Sbjct: 1071 ENKLWDWSFWDTI 1083

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 36/51 (70%), Positives = 46/51 (90%)

Query: 176 MKIAPIPRELLQKIPNIPQGVTTWQQVTELAQQKRLSPQDMQIAKEMYKIH 226
           MK A IPRELLQ+IPN+P GV TWQ+VTELAQQKRL P+D+Q+AK++Y++H
Sbjct: 176 MKNAEIPRELLQRIPNLPPGVNTWQKVTELAQQKRLGPKDLQVAKQVYQMH 226

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 61/87 (70%), Gaps = 5/87 (5%)

Query: 1  MSSSSKDSVTMEDRSKHVSELLKVLMDINVMNGGNTDT--AEKMKLHAKNFESALYAKSS 58
          M +  + +++ ++RSK+++EL ++L  I+ +NGG+      EK+K  A+ FE +LYA SS
Sbjct: 1  MEADWRTTLSNQERSKYITELAQILAQISQVNGGDKGNFNLEKLKKTAEQFEKSLYASSS 60

Query: 59 SKKEYLDSMQEKVSAMRNTRDARQKAI 85
          SK+ YLDSM+++++AM     A++KAI
Sbjct: 61 SKELYLDSMRKRIAAMDT---AKKKAI 84

>Scas_643.23
          Length = 653

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 77/110 (70%)

Query: 450 PQDIETVRKISSDASRTPLRLSDITNSLSPQEKEEIKRKLQMNQQLFAQVSNYAPQVYVF 509
           P+D   +++ISS+ S+T   LS+++NSLS +EK +IK+ L  NQ LF +V  +A   ++ 
Sbjct: 289 PEDWSIIKRISSEISKTQFNLSNLSNSLSGREKLDIKKSLSDNQPLFKKVKFFAIAYFIA 348

Query: 510 TKSEGFLKEVLQLRIFVKEILEKCAEGIFVVKLDTVDKLVMKYQKYWESM 559
           +K E FL++ L+L +F++EI+ K  +G+F++    ++K+ +K+QK+WE M
Sbjct: 349 SKDESFLRDFLKLNLFLREIINKINDGVFIINSMIMNKINLKFQKFWEIM 398

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 15/127 (11%)

Query: 778 ADLNIKKSEIMSRFKHRREVY-GESQIDLFLLTLGDCLGCKDGN---------MEPIYEI 827
            D  +++ E+ SR+KH ++++ G S  DLFL TL DCLG               EPI   
Sbjct: 418 VDKKLRRQEVKSRYKHHQDIFEGSSTPDLFLSTLSDCLGLSVTTQARMNTMTVYEPILPF 477

Query: 828 PQIMIDHTNGTGKKK----VTKAVQRIXXXXXXXXXXXXXKLIMQSKSKPEDRSYTIDIR 883
            +  I+  NG+  KK     T+  +R              KL+M++K+    R  +I  +
Sbjct: 478 TKKTIELINGSSTKKQPFTKTQLKRREKDVFELSIIASDTKLLMKNKN-VNSRLESISDK 536

Query: 884 DVASVFK 890
            +A+VFK
Sbjct: 537 QIANVFK 543

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 56/93 (60%), Gaps = 3/93 (3%)

Query: 1   MSSSSKDSVTM--EDRSKHVSELLKVLMDINVMNGGNTDTAEKMKLHAKNFESALYAKSS 58
           + SS  + +TM  + R+ ++++L+++LM +N  NGG+++TA  +K  AK FE+A+++K S
Sbjct: 14  VGSSPSEPLTMGQKLRASNINKLIQILMKLNFANGGDSNTATTIKEQAKVFENAVFSKFS 73

Query: 59  SK-KEYLDSMQEKVSAMRNTRDARQKAIDQRTD 90
           +    Y   M  K+  +  T  A++  I+   D
Sbjct: 74  NDLNSYTKFMNGKMENLVRTSQAKKAKINGLMD 106

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,522,339
Number of extensions: 947058
Number of successful extensions: 4551
Number of sequences better than 10.0: 162
Number of HSP's gapped: 4633
Number of HSP's successfully gapped: 267
Length of query: 989
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 878
Effective length of database: 12,753,511
Effective search space: 11197582658
Effective search space used: 11197582658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)