Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_538.875275237710.0
YDR264C (AKR1)76457816620.0
CAGL0M08712g76356914570.0
KLLA0E16764g75257810571e-133
AER388C72456910071e-126
YOR034C (AKR2)7495679551e-118
Kwal_55.199873431394291e-46
Scas_699.365111652087e-17
CAGL0C01309g1110911553e-10
YIL112W (HOS4)1083941534e-10
Scas_671.301054921526e-10
KLLA0F03619g960921437e-09
ADL244W1089921321e-07
Kwal_23.49141043921312e-07
Scas_595.8235991209e-07
YIR033W (MGA2)1113751106e-05
ACL003C3751271079e-05
KLLA0D18370g3551541052e-04
KLLA0E18029g11511091062e-04
Sklu_2319.5333841023e-04
YOL003C378711033e-04
Scas_595.91148921025e-04
YGR232W (NAS6)22892995e-04
YKL020C (SPT23)1082761017e-04
Scas_392.2376172997e-04
Sklu_2202.81367461018e-04
Sklu_1541.237956999e-04
Scas_716.4832777980.001
CAGL0E02497g376122980.001
Kwal_55.2212636063950.002
CAGL0L06622g113754960.002
KLLA0C06204g37791950.002
Kwal_27.1275023396930.003
CAGL0L06600g23197930.003
AGL125C36767950.003
CAGL0D02508g332120940.003
KLLA0E02068g32555940.003
YNL326C33678940.003
KLLA0D08910g206100920.003
CAGL0K06347g35257930.004
ADL197C39065930.004
CAGL0J07040g124546940.004
YLR246W (ERF2)359134920.005
YDR459C37473920.005
CAGL0F06831g109270930.006
ACR165W113956930.007
Sklu_2237.519899880.008
ADL143W110289920.009
Kwal_47.1836635637900.011
Sklu_2436.436437880.017
YLR182W (SWI6)80345880.020
Scas_679.7374151870.020
AGR223W132155880.022
Kwal_56.2245938352860.028
Scas_713.9120840870.030
KLLA0D06149g34967860.030
Kwal_23.3302353143860.030
KLLA0E15796g23096840.031
Scas_700.13113368860.035
CAGL0G08217g326142840.043
YPL239W (YAR1)200101830.044
AFL146W19894820.046
Scas_458.319897820.048
KLLA0C09108g208104820.049
CAGL0H00935g193101820.052
ADL142C22994810.080
Scas_717.6237457810.10
Kwal_56.2428419898790.12
Scas_628.4105757820.12
ABR203W35942810.13
Scas_587.475145810.15
Kwal_14.889109470810.15
KLLA0E05357g75444790.22
Kwal_27.12751109365790.24
ADR151W42099780.27
YPL110C122357790.29
KLLA0E15774g114883780.32
Sklu_2055.374365780.33
Scas_415.145290770.36
AAR063C22078750.43
CAGL0B01166g80848770.49
KLLA0F00660g137455770.51
YDR126W (SWF1)33649750.53
CAGL0C03003g20684740.58
YGR233C (PHO81)117853750.80
Kwal_33.1325966439740.87
YMR068W (AVO2)42674740.89
CAGL0F06655g408116731.2
Scas_649.837379721.2
KLLA0F26004g33680721.4
Scas_720.7923084711.5
KLLA0C01826g74148721.5
CAGL0B01991g33041711.5
AGR065W32644702.2
Kwal_14.98241656693.7
YER111C (SWI4)109343685.7
Scas_510.2104343676.3
Scas_693.3232942667.0
AGL297C97044669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_538.8
         (752 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_538.8                                                           1457   0.0  
YDR264C (AKR1) [1097] chr4 complement(996021..998315) Protein wi...   644   0.0  
CAGL0M08712g 866454..868745 similar to sp|P39010 Saccharomyces c...   565   0.0  
KLLA0E16764g 1484752..1487010 gi|28565052|gb|AAO32609.1 Kluyvero...   411   e-133
AER388C [2888] [Homologous to ScYDR264C (AKR1) - SH; ScYOR034C (...   392   e-126
YOR034C (AKR2) [4846] chr15 complement(394836..397085) Protein i...   372   e-118
Kwal_55.19987                                                         169   1e-46
Scas_699.36                                                            85   7e-17
CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces c...    64   3e-10
YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p c...    64   4e-10
Scas_671.30                                                            63   6e-10
KLLA0F03619g 342770..345652 weakly similar to sp|P40480 Saccharo...    60   7e-09
ADL244W [1497] [Homologous to ScYIL112W - SH] complement(273379....    55   1e-07
Kwal_23.4914                                                           55   2e-07
Scas_595.8                                                             51   9e-07
YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor...    47   6e-05
ACL003C [1046] [Homologous to ScYOL003C - SH] (352024..353151) [...    46   9e-05
KLLA0D18370g complement(1549382..1550449) similar to sgd|S000423...    45   2e-04
KLLA0E18029g complement(1600015..1603470) weakly similar to sp|P...    45   2e-04
Sklu_2319.5 YNL326C, Contig c2319 9193-10194                           44   3e-04
YOL003C (YOL003C) [4813] chr15 complement(321858..322994) Nuclea...    44   3e-04
Scas_595.9                                                             44   5e-04
YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting ...    43   5e-04
YKL020C (SPT23) [3235] chr11 complement(398475..401723) Transcri...    44   7e-04
Scas_392.2                                                             43   7e-04
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           44   8e-04
Sklu_1541.2 YOL003C, Contig c1541 950-2089 reverse complement          43   9e-04
Scas_716.48                                                            42   0.001
CAGL0E02497g complement(241118..242248) similar to tr|Q12006 Sac...    42   0.001
Kwal_55.22126                                                          41   0.002
CAGL0L06622g complement(743602..747015) similar to sp|P17442 Sac...    42   0.002
KLLA0C06204g complement(548912..550045) similar to sgd|S0005363 ...    41   0.002
Kwal_27.12750                                                          40   0.003
CAGL0L06600g 742803..743498 similar to sp|P50086 Saccharomyces c...    40   0.003
AGL125C [4187] [Homologous to ScYLR246W (ERF2) - SH] (473496..47...    41   0.003
CAGL0D02508g 256760..257758 similar to sp|P42836 Saccharomyces c...    41   0.003
KLLA0E02068g complement(195185..196162) weakly similar to sp|P42...    41   0.003
YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein ...    41   0.003
KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces c...    40   0.003
CAGL0K06347g complement(623217..624275) similar to tr|Q03289 Sac...    40   0.004
ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165) [...    40   0.004
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    41   0.004
YLR246W (ERF2) [3642] chr12 (627120..628199) Protein that, in a ...    40   0.005
YDR459C (YDR459C) [1277] chr4 complement(1382307..1383431) Prote...    40   0.005
CAGL0F06831g 668173..671451 similar to sp|P40578 Saccharomyces c...    40   0.006
ACR165W [1212] [Homologous to ScYKL020C (SPT23) - SH; ScYIR033W ...    40   0.007
Sklu_2237.5 YPL239W, Contig c2237 9761-10357                           39   0.008
ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH] complement...    40   0.009
Kwal_47.18366                                                          39   0.011
Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement       39   0.017
YLR182W (SWI6) [3586] chr12 (517942..520353) Transcription facto...    39   0.020
Scas_679.7                                                             38   0.020
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    39   0.022
Kwal_56.22459                                                          38   0.028
Scas_713.9                                                             38   0.030
KLLA0D06149g 527705..528754 similar to sgd|S0002867 Saccharomyce...    38   0.030
Kwal_23.3302                                                           38   0.030
KLLA0E15796g complement(1406502..1407194) similar to sp|P50086 S...    37   0.031
Scas_700.13                                                            38   0.035
CAGL0G08217g complement(778823..779803) similar to tr|Q06551 Sac...    37   0.043
YPL239W (YAR1) [5211] chr16 (99484..100086) Protein with 2 ankyr...    37   0.044
AFL146W [3049] [Homologous to ScYPL239W (YAR1) - SH] complement(...    36   0.046
Scas_458.3                                                             36   0.048
KLLA0C09108g complement(795433..796059) similar to sp|P25631 Sac...    36   0.049
CAGL0H00935g 91979..92560 highly similar to sp|P46683 Saccharomy...    36   0.052
ADL142C [1599] [Homologous to ScYGR232W (NAS6) - SH] (443625..44...    36   0.080
Scas_717.62                                                            36   0.10 
Kwal_56.24284                                                          35   0.12 
Scas_628.4                                                             36   0.12 
ABR203W [797] [Homologous to ScYDR459C - SH] complement(782702.....    36   0.13 
Scas_587.4                                                             36   0.15 
Kwal_14.889                                                            36   0.15 
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    35   0.22 
Kwal_27.12751                                                          35   0.24 
ADR151W [1892] [Homologous to ScYMR068W - SH] complement(971060....    35   0.27 
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    35   0.29 
KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces...    35   0.32 
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            35   0.33 
Scas_415.1                                                             34   0.36 
AAR063C [249] [Homologous to ScYCR051W - SH] (453099..453761) [6...    33   0.43 
CAGL0B01166g 103561..105987 similar to sp|P09959 Saccharomyces c...    34   0.49 
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    34   0.51 
YDR126W (SWF1) [973] chr4 (703228..704238) Protein involved in v...    33   0.53 
CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces c...    33   0.58 
YGR233C (PHO81) [2181] chr7 complement(954675..958211) Cyclin-de...    33   0.80 
Kwal_33.13259                                                          33   0.87 
YMR068W (AVO2) [4027] chr13 (406303..407583) Component of the TO...    33   0.89 
CAGL0F06655g 654908..656134 similar to sp|Q04749 Saccharomyces c...    33   1.2  
Scas_649.8                                                             32   1.2  
KLLA0F26004g complement(2411261..2412271) some similarities with...    32   1.4  
Scas_720.79                                                            32   1.5  
KLLA0C01826g 144307..146532 gi|730856|sp|P40418|SWI6_KLULA Kluyv...    32   1.5  
CAGL0B01991g 182894..183886 similar to sp|Q04629 Saccharomyces c...    32   1.5  
AGR065W [4375] [Homologous to ScYDR126W (PSL10) - SH] complement...    32   2.2  
Kwal_14.982                                                            31   3.7  
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    31   5.7  
Scas_510.2                                                             30   6.3  
Scas_693.32                                                            30   7.0  
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    30   9.1  

>Scas_538.8
          Length = 752

 Score = 1457 bits (3771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/752 (94%), Positives = 713/752 (94%)

Query: 1   LLPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPL 60
           LLPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPL
Sbjct: 1   LLPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPL 60

Query: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYP 120
           HWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYP
Sbjct: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYP 120

Query: 121 KRKLFKKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPS 180
           KRKLFKKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPS
Sbjct: 121 KRKLFKKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPS 180

Query: 181 YSNYGLHSTSLLKSPXXXXXXXXXXXXXXIVWIFKIAPFTIFKSRLLTNFFMFLILMQIY 240
           YSNYGLHSTSLLKSP              IVWIFKIAPFTIFKSRLLTNFFMFLILMQIY
Sbjct: 181 YSNYGLHSTSLLKSPFLSGTFFGSLLLLTIVWIFKIAPFTIFKSRLLTNFFMFLILMQIY 240

Query: 241 YLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNT 300
           YLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNT
Sbjct: 241 YLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNT 300

Query: 301 HNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVACF 360
           HNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVACF
Sbjct: 301 HNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVACF 360

Query: 361 LLGDDELCAGFVYDRFTFLIALWALIQSVWVGFLIXXXXXXXXXXXXNKEFNKYVKEKKN 420
           LLGDDELCAGFVYDRFTFLIALWALIQSVWVGFLI            NKEFNKYVKEKKN
Sbjct: 361 LLGDDELCAGFVYDRFTFLIALWALIQSVWVGFLIVVQVFQTFTGVTNKEFNKYVKEKKN 420

Query: 421 QHAFDPIFFNDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTIPSEGSRINTRKPRTCF 480
           QHAFDPIFFNDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTIPSEGSRINTRKPRTCF
Sbjct: 421 QHAFDPIFFNDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTIPSEGSRINTRKPRTCF 480

Query: 481 NLCFAITGLDQVRTIVRETLGIGGANEMSRMQLLSSIPTNYGWKRNLADFWLTSDVMAPI 540
           NLCFAITGLDQVRTIVRETLGIGGANEMSRMQLLSSIPTNYGWKRNLADFWLTSDVMAPI
Sbjct: 481 NLCFAITGLDQVRTIVRETLGIGGANEMSRMQLLSSIPTNYGWKRNLADFWLTSDVMAPI 540

Query: 541 WRRLFYSPVESRALLNGVEVDYFKLYDFPEKTYPEPTGPESVXSTDEEYAEVEIHAMSDI 600
           WRRLFYSPVESRALLNGVEVDYFKLYDFPEKTYPEPTGPESV STDEEYAEVEIHAMSDI
Sbjct: 541 WRRLFYSPVESRALLNGVEVDYFKLYDFPEKTYPEPTGPESV*STDEEYAEVEIHAMSDI 600

Query: 601 NTESGESTSLPNSTDPPLSDVNIDVEDDDTAESISSLQPIVSXXXXXXXXXXXXVLGQYH 660
           NTESGESTSLPNSTDPPLSDVNIDVEDDDTAESISSLQPIVS            VLGQYH
Sbjct: 601 NTESGESTSLPNSTDPPLSDVNIDVEDDDTAESISSLQPIVSNTTNPPEEPINPVLGQYH 660

Query: 661 QACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAG 720
           QACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAG
Sbjct: 661 QACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAG 720

Query: 721 DLEATPLHWAARYGYVHIVDCLLNKGADPTMC 752
           DLEATPLHWAARYGYVHIVDCLLNKGADPTMC
Sbjct: 721 DLEATPLHWAARYGYVHIVDCLLNKGADPTMC 752

>YDR264C (AKR1) [1097] chr4 complement(996021..998315) Protein with
           palmitoyl transferase activity, has an inhibitory effect
           on signaling in the pheromone pathway, contains ankyrin
           repeats [2295 bp, 764 aa]
          Length = 764

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/578 (54%), Positives = 399/578 (69%), Gaps = 21/578 (3%)

Query: 1   LLPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPL 60
           +L VLF VV+KG++DIDC+DPKGRT LLWAAYQGDSL+V  LLKFGAS KI D  GFTPL
Sbjct: 192 VLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPL 251

Query: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYP 120
           HW TVKGQP+VL +LI+DGADFF KT+ GKDCF IAQEMNT +S ++AL+  GF+  GYP
Sbjct: 252 HWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYP 311

Query: 121 KRKLFKKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPS 180
            +K FKKS HAK++TF  P + L I F LF+H++PLF +++  +  +A NK L + +LPS
Sbjct: 312 IKKWFKKSQHAKLVTFITPFLFLGIAFALFSHINPLFVIIVLFLLAIATNKGLNKFVLPS 371

Query: 181 YSNYGLHSTSLLKSPXXXXXXXXXXXXXXIVWIFKIAPFTIFKSRLLTNFFMFLILMQIY 240
           Y   G+H+ +LL+SP              IVW FK+ P T F     TN  M +IL+ ++
Sbjct: 372 YGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRT-FSDEQYTNILMLVILVSVF 430

Query: 241 YLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNT 300
           YLF +L+  DPGC+P ETDHENVR TI  LL+ GKFD KNFC+ETWIRKPLRS FS LN 
Sbjct: 431 YLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKPLRSKFSPLNN 490

Query: 301 HNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVA-- 358
             VARFDH+CPWI+ND+GLKNHK F++FI L E GI+ F++L ++YFD LED +ED +  
Sbjct: 491 AVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDELEDAHEDTSQK 550

Query: 359 ---CFLLGDDELCAGFVYDRFTFLIALWALIQSVWVGFLIXXXXXXXXXXXXNKEFNKYV 415
              CF+LG  +LC+G +YDRF FLI LWAL+QS+WV  LI            N EFN  +
Sbjct: 551 NGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEFNVLM 610

Query: 416 KEKKNQHAFDPIFFNDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTI--PSEGSRINT 473
           KE K+    D + FN+ FNTTPE      D          P   +  T+  P  GS I  
Sbjct: 611 KESKSIGP-DGLSFNENFNTTPEGFAPSID----------PGEESNDTVLAPVPGSTI-- 657

Query: 474 RKPRTCFNLCFAITGLDQVRTIVRETLGIGGANEMSRMQLLSSIPTNYGWKRNLADFWLT 533
           RKPRTCF +C+A+TG+DQ   +++ET+GI  +   +   + S IPTNYGWKRN+ DFWLT
Sbjct: 658 RKPRTCFGVCYAVTGMDQWLAVIKETIGIKDSTGHNVYSITSRIPTNYGWKRNVKDFWLT 717

Query: 534 SDVMAPIWRRLFYSPVESRALLNGVEVDYFKLYDFPEK 571
           SD+ AP+WRR+ Y P  S+ALLNG+EVDYFKLY  P K
Sbjct: 718 SDINAPLWRRILYPPSGSKALLNGIEVDYFKLYKLPNK 755

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 101/157 (64%), Gaps = 13/157 (8%)

Query: 608 TSLPNSTDPPLSDVNIDVEDDDTAE--SISSLQPIVSXXXXXXXXXXXX---------VL 656
           T+   + DP  +D   D+   D+ E  S++SL+ I S                     +L
Sbjct: 15  TNEEQTVDPSNNDSQEDISLGDSNEITSLASLKAIRSGNEEESGNEQVNHNDEAEEDPLL 74

Query: 657 GQYHQACQKGDLATVKQLLDSGVLDLNTD--LTGDITGLHWASINNRLSVVKYLISQGID 714
            +YH ACQ+GDLATVK+++   +L++N D   T  ITGLHWASINNRLSVV +L+SQG D
Sbjct: 75  TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGAD 134

Query: 715 VNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
           VNA+AG L ATPLHWAARYGYV+IVD LL  GADPTM
Sbjct: 135 VNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTM 171

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 673 QLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGDLEA-TPLHWAA 731
            ++  G+LD++       T L WA+       V  L+  G  +  K  D E  TPLHW  
Sbjct: 198 NVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASI--KIADTEGFTPLHWGT 255

Query: 732 RYGYVHIVDCLLNKGAD 748
             G  H++  L+  GAD
Sbjct: 256 VKGQPHVLKYLIQDGAD 272

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGID 714
           A  +GD  TV +LL  G      D  G  T LHW ++  +  V+KYLI  G D
Sbjct: 221 AAYQGDSLTVAELLKFGASIKIADTEG-FTPLHWGTVKGQPHVLKYLIQDGAD 272

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 25  TPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--TPLHWATVKGQPYVLTHLIRDGADF 82
           T L WA+       V  L+  GA       G    TPLHWA   G  Y++  L++ GAD 
Sbjct: 111 TGLHWASINNRLSVVDFLVSQGADVN-ARAGALHATPLHWAARYGYVYIVDFLLKHGADP 169

Query: 83  FLKTNDG 89
            +  + G
Sbjct: 170 TMTDDQG 176

>CAGL0M08712g 866454..868745 similar to sp|P39010 Saccharomyces
           cerevisiae YDR264c ankyrin repeat-containing protein,
           hypothetical start
          Length = 763

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/569 (50%), Positives = 366/569 (64%), Gaps = 15/569 (2%)

Query: 10  AKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQP 69
           +KGIIDID  DPKGRT LLWAAYQGDSL+V  L+KF AS KI DEGGFTPLHW TVKGQP
Sbjct: 185 SKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNASVKIADEGGFTPLHWGTVKGQP 244

Query: 70  YVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYPKRKLFKKSD 129
           +VL +LI+DGADFF KTND KDCF IA+EM+ +HSF++AL    F+++GYP  KL K+ D
Sbjct: 245 HVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQEALRHNNFDKNGYPINKLVKRDD 304

Query: 130 HAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPSYSNYGLHST 189
           HAK+ITF +PL+ L   F  F+HLH LFAL + ++  LA NK +K  +LPSY   G +S 
Sbjct: 305 HAKIITFLIPLLVLGFAFFGFSHLHILFALPVIILLLLASNKFIKSFLLPSYETKGTNSA 364

Query: 190 SLLKSPXXXXXXXXXXXXXXIVWIFKIAPFTIFKSRLLTNFFMFLILMQIYYLFIKLIFS 249
           SLLKSP               VWI +I P+T F  R L N     IL  + Y    L FS
Sbjct: 365 SLLKSPLIAGILFGSIFWLAFVWILRILPYT-FTKRPLGNLTFCAILCFVCYSLFLLAFS 423

Query: 250 DPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHF 309
           DPG +  E DHE +R TI  LL  GKFD ++FCLETW+RKPLRS +S LN   + RFDH+
Sbjct: 424 DPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHY 483

Query: 310 CPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVACFLLGDDELCA 369
           CPWIYND+GLKNHK F++FIL  E+GI+ F+ + +KYFD L+    D  CF+LGDD+LC+
Sbjct: 484 CPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFDELD---MDGDCFILGDDDLCS 540

Query: 370 GFVYDRFTFLIALWALIQSVWVGFLIXXXXXXXXXXXXNKEFNKYVKEKKNQHAFDPIFF 429
           G + DRFTFLI  WA IQ+VW+  L+            N E N  ++E + +   D    
Sbjct: 541 GLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSELNALIREGR-RVDIDSQTH 599

Query: 430 NDTFNTTPEELRNDDD--DTAASRTGNNPNHSNGTTIPSEGSRINTRKPRTCFNLCFAIT 487
           N+ FNT PE   N+ D  + AA    NN N    TT        N  KPRTC  +  A+T
Sbjct: 600 NEFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTTFSG-----NLPKPRTCMGMICAVT 654

Query: 488 GLDQVRTIVRETLGI---GGANEMSRMQLLSSIPTNYGWKRNLADFWLTSDVMAPIWRRL 544
           GL Q   I+++T GI   G +   +   LLSSI T+YGW+RN  DFWL SD   P+W+R+
Sbjct: 655 GLHQCVAIIKDTFGIARHGSSRSTNTRSLLSSISTDYGWRRNWCDFWLLSDTNTPLWKRI 714

Query: 545 FYSPVESRALLNGVEVDYFKLYDFPEKTY 573
           F+SP  ++ALLNG E DY  LY+ P K +
Sbjct: 715 FFSPPSTKALLNGKEADYATLYEVPNKNH 743

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 76/97 (78%), Gaps = 1/97 (1%)

Query: 655 VLGQYHQACQKGDLATVKQLLDSGVLDLNTDLTGD-ITGLHWASINNRLSVVKYLISQGI 713
           +L +YH ACQ+GDL  V++++  G +++++D   + +TGLHWA+INNRL+VV +L+ +G 
Sbjct: 58  ILSKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGA 117

Query: 714 DVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPT 750
           +V +KAG LEATPLHWAARYG+V++VD LL  GA  T
Sbjct: 118 NVESKAGALEATPLHWAARYGFVYVVDYLLQHGASAT 154

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 4/82 (4%)

Query: 2   LPVLFFVVAKGIIDIDCQ-DPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--T 58
           L V+  ++  G +++    D +G T L WAA       V  L++ GA+ +    G    T
Sbjct: 71  LEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGANVE-SKAGALEAT 129

Query: 59  PLHWATVKGQPYVLTHLIRDGA 80
           PLHWA   G  YV+ +L++ GA
Sbjct: 130 PLHWAARYGFVYVVDYLLQHGA 151

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721
           A  +GD  TV  L+         D  G  T LHW ++  +  V+KYLI  G D   K  D
Sbjct: 205 AAYQGDSLTVAALIKFNASVKIAD-EGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTND 263

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 678 GVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGDLEA-TPLHWAARYGYV 736
           G++D++       T L WA+       V  LI    + + K  D    TPLHW    G  
Sbjct: 187 GIIDIDYVDPKGRTALLWAAYQGDSLTVAALIK--FNASVKIADEGGFTPLHWGTVKGQP 244

Query: 737 HIVDCLLNKGAD 748
           H++  L+  GAD
Sbjct: 245 HVLKYLIQDGAD 256

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 30  AAYQGDSLSVMLLLKFGASTKI---VDEGGFTPLHWATVKGQPYVLTHLIRDGAD 81
           A  +GD L V+  +  G    +    D  G T LHWA +  +  V+  L+R+GA+
Sbjct: 65  ACQRGD-LEVVREMIHGGQVNVSSDADREGVTGLHWAAINNRLNVVDFLVREGAN 118

>KLLA0E16764g 1484752..1487010 gi|28565052|gb|AAO32609.1
           Kluyveromyces lactis AKR1, hypothetical start
          Length = 752

 Score =  411 bits (1057), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/578 (39%), Positives = 322/578 (55%), Gaps = 33/578 (5%)

Query: 4   VLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWA 63
           VLFFVV  G  D+D  DP  RT L WA YQ D+L+V  LLKF A  K  D+ GFT LHW 
Sbjct: 195 VLFFVV-DGKEDVDQPDPHQRTALQWATYQADALTVENLLKFNADVKNADDAGFTALHWG 253

Query: 64  TVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYPKRK 123
           TVKG   V+  LI+ G+DFF  TNDGK+CFTI +E+ +  S + +L   GF+++G+P  +
Sbjct: 254 TVKGSIPVMDLLIKHGSDFFQTTNDGKNCFTIGKELYSIGSLEASLYKNGFDKNGFPLPQ 313

Query: 124 LFKKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPSYSN 183
            F  S   K++TFF+P V + ++F +F+ +    ALLI+ I  +     L  L++PSY  
Sbjct: 314 YFSAST-GKMLTFFLPWVLIPLVFYIFSKITFFIALLINTIVLVISGLVLSRLVVPSYLL 372

Query: 184 YGLHSTSLLKSPXXXXXXXXXXXXXXIVWIFKIAPFTIFKSRLLTNFFMFLILMQIYYLF 243
              H   +L SP               +W  KI+  T F  + + N  M    + +  LF
Sbjct: 373 SKRHP--ILNSPLLAGILSGTIAIAFFIWFTKISILT-FTEKPVGNIIMLGFFIGLITLF 429

Query: 244 IKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNV 303
           I L+ SDPG +P   DH+ VR TIKELL  GKFD K+FC+ TWIR PLRS +   +   +
Sbjct: 430 IGLMKSDPGYIPGTVDHDKVRETIKELLSLGKFDAKHFCVHTWIRIPLRSKYDRDSACLI 489

Query: 304 ARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILEDTNEDVA----- 358
           + FDHFCPW+YN IGL NHK F  F++L E+ +W+F+ L M+YFD LED  E+       
Sbjct: 490 SAFDHFCPWVYNQIGLLNHKLFYMFVVLLEISVWWFLPLMMEYFDELEDYLENRKGKHFG 549

Query: 359 -CFLLGDDELCAGFVYDRFTFLIALWALIQSVWVGFLIXXXXXXXXXXXXNKEFNKYVKE 417
            C  LGD++LC G  +D F FL+  W + Q+ WV  LI            + EF +  K+
Sbjct: 550 DCHFLGDEDLCFGLHHDTFNFLLLCWVIFQAFWVLCLIAVQTVQMLKGVTDYEFVQINKK 609

Query: 418 KKNQHAFDPIFFNDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTIPSEGSRINTRKPR 477
            K+          D F++TP EL +++          +P       +P           R
Sbjct: 610 LKSNGTTT----EDIFSSTPPELMSEELIAELDAPALDPRQ-----VPQ----------R 650

Query: 478 TCFNLCFAITGLDQVRTIVRETLGIGGANEMSR---MQLLSSIPTNYGWKRNLADFWLTS 534
           TCF +C  + GLD++ T+++  L +      SR   +  L+ IPT+YGWK+NL DFWL  
Sbjct: 651 TCFTVCCTLLGLDKLVTMIKSVLRLKSDEPSSRSSHLSALARIPTDYGWKQNLKDFWLLP 710

Query: 535 DVMAPIWRRLFYSPVESRALLNGVEVDYFKLYDFPEKT 572
           D  +P+WRR+   P +S ALLNG+EVDY+ LY  P  T
Sbjct: 711 DTSSPLWRRILLPPKDSHALLNGMEVDYYTLYTLPNAT 748

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 74/99 (74%), Gaps = 2/99 (2%)

Query: 655 VLGQYHQACQKGDLATVKQLLDSGVLDLNTDL--TGDITGLHWASINNRLSVVKYLISQG 712
           +L +YH AC++GD+ T++++++S V+DL+ D      ++GLHWA INNRLS VKYL   G
Sbjct: 73  ILERYHAACKQGDMKTLREMVESKVIDLSNDYDPKERVSGLHWACINNRLSAVKYLAGAG 132

Query: 713 IDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
            +VN K G+L+ATPLHWA++ G V+IVD LL  GADP +
Sbjct: 133 AEVNFKGGELDATPLHWASKSGLVYIVDELLKAGADPNI 171

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 8   VVAKGIIDIDCQ-DPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGG---FTPLHWA 63
           +V   +ID+    DPK R   L  A   + LS +  L  GA  ++  +GG    TPLHWA
Sbjct: 92  MVESKVIDLSNDYDPKERVSGLHWACINNRLSAVKYLA-GAGAEVNFKGGELDATPLHWA 150

Query: 64  TVKGQPYVLTHLIRDGAD 81
           +  G  Y++  L++ GAD
Sbjct: 151 SKSGLVYIVDELLKAGAD 168

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 691 TGLHWASINNRLSVVKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGAD 748
           T L WA+       V+ L+    DV   A D   T LHW    G + ++D L+  G+D
Sbjct: 215 TALQWATYQADALTVENLLKFNADVK-NADDAGFTALHWGTVKGSIPVMDLLIKHGSD 271

>AER388C [2888] [Homologous to ScYDR264C (AKR1) - SH; ScYOR034C
           (AKR2) - SH] (1365604..1367778) [2175 bp, 724 aa]
          Length = 724

 Score =  392 bits (1007), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/569 (39%), Positives = 313/569 (55%), Gaps = 30/569 (5%)

Query: 7   FVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVK 66
           +V+  G I +D  DP G+T L WAAYQGD  +V  LLKF A  ++VD GGFTPLHWATVK
Sbjct: 176 YVLFTGQIPVDSPDPTGKTALHWAAYQGDPNTVEALLKFDADVRVVDTGGFTPLHWATVK 235

Query: 67  GQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYPKRKLFK 126
           G P+VL  LI  G+D FLK NDGK+   IAQEMNT  + ++AL  CGFN+DG+  RK FK
Sbjct: 236 GHPHVLKALIEHGSDVFLKNNDGKNALMIAQEMNTQKALQNALYECGFNKDGFAIRKYFK 295

Query: 127 KSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPSYSNYGL 186
              HAK++TFF P + L +I   F +   L A+L  L+  LA    L   + PS+    +
Sbjct: 296 NPMHAKMVTFFTPWLILGLILSFFAYFSILLAILGCLLTVLAAGYGLYNFVFPSF--ILM 353

Query: 187 HSTSLLKSPXXXXXXXXXXXXXXIVWIFKIAPFTIFKSRLLTNFFMFLILMQIYYLFIKL 246
               + K+P               VW+FK+ P T F    + N  +F +   + +L  KL
Sbjct: 354 KRIVIFKTPLLAGILSGTIFWLLYVWLFKMLPAT-FDDEPILNLTVFALFAGVVFLLTKL 412

Query: 247 IFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARF 306
           + SDPG +   TDH  +R TI ELL  GK+D K+FC+ +WIR PLR+ +       + R+
Sbjct: 413 LQSDPGYIVPATDHNQIRATIIELLRVGKYDSKHFCIHSWIRLPLRAKYKRFVHSVILRY 472

Query: 307 DHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFDILED--TNED-VACFLLG 363
           DH+CPWIYN IG +NHK F++FILL ++GI     L ++YFD L+D   N+D + C +L 
Sbjct: 473 DHYCPWIYNYIGFRNHKIFIYFILLLDLGILALAKLCLEYFDELKDHAKNKDALKCSILS 532

Query: 364 DDELCAGFVYDRFTFLIALWALIQSVWVGFLIXXXXXXXXXXXXNKEFNKYVKEKKNQHA 423
            D LCAGF YD FT  +  W  +Q +W+  L               EF  + +  +    
Sbjct: 533 KD-LCAGFTYDPFTLFLLEWVCVQGMWILALSFVQFFECLKGVTEHEFAHWQRRNRGVVG 591

Query: 424 FDPIFFNDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTIPSEGSRINTRKPRTCFNLC 483
            + +     FNT PEEL  +D +   ++                   +     R C +  
Sbjct: 592 REHV-----FNTAPEELMEEDPEEERNKL----------------RSLGAAGQRHCCSTL 630

Query: 484 FAITGLDQVRTIVRETLGIGGANEMSRMQLLSSIPTNYGWKRNLADFWLTSDVMAPIWRR 543
              TG D+  +++  +L  G     +   +   I T+YGWK+NL DFWLTSD+ AP+WRR
Sbjct: 631 TTATGFDRFLSVIGSSL--GRQPRTTHNPINYPIETDYGWKQNLKDFWLTSDISAPMWRR 688

Query: 544 LFYSPVESRALLNGVEVDYFKLYDFPEKT 572
           +   PV +R LLNG EVDY KLY+ PE+ 
Sbjct: 689 ILLPPVGTRGLLNGQEVDYQKLYNLPERV 717

 Score =  133 bits (334), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 96/146 (65%), Gaps = 18/146 (12%)

Query: 612 NSTDPPLSDVNI--DVEDDD--TAESISSLQPIVSXXXXXXXXXXXXVLGQYHQACQKGD 667
           +S  P +SDV    DV D+D  +  SI+  +P                L +YH ACQ+GD
Sbjct: 20  SSIQPIVSDVPAAEDVGDEDHISGASIAENRP------------KDPTLVKYHAACQRGD 67

Query: 668 LATVKQLLDSGVLDLNTDLTGD--ITGLHWASINNRLSVVKYLISQGIDVNAKAGDLEAT 725
           L TVK ++++GV+D+  D   +  ++GLHWAS NNRL++V+YLI+QG DVN K GDLEAT
Sbjct: 68  LKTVKDMIEAGVIDVKADWDEEEQVSGLHWASANNRLNLVRYLIAQGADVNIKGGDLEAT 127

Query: 726 PLHWAARYGYVHIVDCLLNKGADPTM 751
           PLHWA++ GYV+IV CLL  GADP +
Sbjct: 128 PLHWASKSGYVYIVHCLLEHGADPLI 153

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 5/91 (5%)

Query: 660 HQACQKGDLATVKQLLDSGVLDLNT-DLTGDITGLHWASINNRLSVVKYLISQGIDVNAK 718
           H +    ++  +  +L +G + +++ D TG  T LHWA+     + V+ L+    D + +
Sbjct: 163 HTSTFSSEVMLITYVLFTGQIPVDSPDPTGK-TALHWAAYQGDPNTVEALLK--FDADVR 219

Query: 719 AGDLEA-TPLHWAARYGYVHIVDCLLNKGAD 748
             D    TPLHWA   G+ H++  L+  G+D
Sbjct: 220 VVDTGGFTPLHWATVKGHPHVLKALIEHGSD 250

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 8   VVAKGIIDI--DCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGG---FTPLHW 62
           ++  G+ID+  D  + +  + L WA+       V  L+  GA   I  +GG    TPLHW
Sbjct: 74  MIEAGVIDVKADWDEEEQVSGLHWASANNRLNLVRYLIAQGADVNI--KGGDLEATPLHW 131

Query: 63  ATVKGQPYVLTHLIRDGADFFLKTNDG 89
           A+  G  Y++  L+  GAD  +    G
Sbjct: 132 ASKSGYVYIVHCLLEHGADPLITDRQG 158

>YOR034C (AKR2) [4846] chr15 complement(394836..397085) Protein
           involved in constitutive endocytosis of Ste3p [2250 bp,
           749 aa]
          Length = 749

 Score =  372 bits (955), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 201/567 (35%), Positives = 306/567 (53%), Gaps = 15/567 (2%)

Query: 14  IDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLT 73
           +DID +D   RTPLLWAAYQGD L+V LLLKFG++    D  GF  LH A V G   V+ 
Sbjct: 181 VDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVIC 240

Query: 74  HLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYPKRKLFKKSDHAKV 133
            LI  GA+F+ + N  +DCF +A+ M T   F+ AL   G+++ G  K KLFKKS HA+ 
Sbjct: 241 DLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQHHGYDRLGNQKDKLFKKSSHAQF 300

Query: 134 ITFFVPLVALSIIFILFTHLHPLFALLISLIFGLAVNKALKELILPSYSNYGLHSTSLLK 193
             F  P + +  I+++   L P+ A+++SL+  + +   LK+ +LP       +  SL +
Sbjct: 301 TIFLSPFLLMVYIYLISLVLSPVLAIMLSLLVTVVMVNTLKKFVLPCLPRKNTYKVSLTR 360

Query: 194 SPXXXXXXXXXXXXXXIVWIFKIAPFTIFKSRLLTNFFMFLILMQIYYLFIKLIFSDPGC 253
           +P               +W  K+ P+++    +    F+    + +  LF++L+ SDPGC
Sbjct: 361 TPFFSGLFLSTFCFLIYIWTKKLYPYSVSDYTMKNVQFLVTSFLTV-VLFLRLVRSDPGC 419

Query: 254 VPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWI 313
           +  +    +++ TIK+L+D GKFD +NFC+ET  RKPLRS +S  +   VAR+DH+CPWI
Sbjct: 420 LKTDDSLTSIQETIKQLIDLGKFDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWI 479

Query: 314 YNDIGLKNHKNFMWFILLTEVGIWFFISLTMKYFD----ILEDTNEDVACFLLGDDELCA 369
           YND+GLKNHK F++F +  +  ++ F+ L + YF     I E   E   C LL ++ LC 
Sbjct: 480 YNDVGLKNHKLFVFFAVTVQYHMFLFMWLCLAYFKKTNYIYEQVEEYARCALLKNETLCK 539

Query: 370 GFVYDRFTFLIALWALIQSVWVGFLIXXXXXXXXXXXXNKEFNKYVKEKKNQHAFDPIFF 429
           G  YD  TF + +W  +  +W+G ++              E    +KE+      + I F
Sbjct: 540 GSNYDPSTFFLFIWISVNFIWLGAMLIVQFFQILKGITTPELFILIKEEHKAKFINLIPF 599

Query: 430 NDTFNTTPEELRNDDDDTAASRTGNNPNHSNGTTIPSEGSRINTRKPRTCFNLCFAITGL 489
            ++  T+  +   D D      +     H    TI  +G     R+ R   + CF++ G+
Sbjct: 600 ENSIYTSESKGVEDSDMIPEGPSATTITH----TISIDGLEPRNRR-RAILSACFSMMGI 654

Query: 490 DQVRTIVRETLGI-----GGANEMSRMQLLSSIPTNYGWKRNLADFWLTSDVMAPIWRRL 544
           +Q    ++E +GI     G   +     LL S      WK NL DFWL SDV AP+W+R 
Sbjct: 655 NQWLVTIKEIVGITHILHGQVPQQHHSSLLRSFLVTNHWKTNLTDFWLNSDVTAPLWQRF 714

Query: 545 FYSPVESRALLNGVEVDYFKLYDFPEK 571
           FYS   S+A+L G EVDY++LY++P +
Sbjct: 715 FYSSDTSKAMLGGTEVDYYELYEYPAR 741

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 65/91 (71%)

Query: 661 QACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAG 720
           +A + GDL  VK +++SG +D+N D   +++GLHWA INNR SV K+L+ +G + N  AG
Sbjct: 56  EAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAG 115

Query: 721 DLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
              AT LHWAARYG ++IVD LL  GADPT+
Sbjct: 116 PGGATALHWAARYGNIYIVDLLLKHGADPTL 146

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 2   LPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGD-SLSVMLLLKFGASTKIVDEGGFTPL 60
           L V+  VV  G +DI+       + L WA      S++  LLL+     +    GG T L
Sbjct: 63  LKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATAL 122

Query: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDG 89
           HWA   G  Y++  L++ GAD  LK   G
Sbjct: 123 HWAARYGNIYIVDLLLKHGADPTLKDEQG 151

>Kwal_55.19987
          Length = 343

 Score =  169 bits (429), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 98/139 (70%), Gaps = 1/139 (0%)

Query: 1   LLPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPL 60
           +L VL+FVV   +  +DC DP  RTPLLWAAYQGDSLSV  LL+F A+  I D GGF P 
Sbjct: 205 VLYVLYFVVGDKL-SVDCLDPNNRTPLLWAAYQGDSLSVKALLEFNANLNIADSGGFLPP 263

Query: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYP 120
           HWATVKGQP VL +L+  G+DFF KT D KDCF I+QEM+T  S  ++L   GF +DG P
Sbjct: 264 HWATVKGQPTVLKYLLEGGSDFFQKTADNKDCFVISQEMHTQESLTNSLQESGFKKDGTP 323

Query: 121 KRKLFKKSDHAKVITFFVP 139
             KLF+   HAK+ITF +P
Sbjct: 324 IMKLFRNPRHAKLITFIIP 342

 Score =  129 bits (324), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/136 (48%), Positives = 87/136 (63%), Gaps = 13/136 (9%)

Query: 629 DTAESISSLQPIVSXXXXXXXXXXXXVLG-----------QYHQACQKGDLATVKQLLDS 677
           DT  SI+S++PI S             LG           +Y +ACQ GDL  VK+L++S
Sbjct: 49  DTQVSIASIEPIASEIEASAPSAEDISLGNESYHIDPVLQEYREACQTGDLTKVKELIES 108

Query: 678 GVLDLNTDL--TGDITGLHWASINNRLSVVKYLISQGIDVNAKAGDLEATPLHWAARYGY 735
           G +D++ D      I+GLHWASINNRL +V+YLI +G +V+ + GDL ATPLHWAARYGY
Sbjct: 109 GRIDISHDYDEKERISGLHWASINNRLGIVRYLIGKGANVDFQGGDLNATPLHWAARYGY 168

Query: 736 VHIVDCLLNKGADPTM 751
           V+IVD LL  GAD ++
Sbjct: 169 VYIVDSLLESGADASL 184

 Score = 36.6 bits (83), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 8   VVAKGIIDIDCQ-DPKGR-TPLLWAAYQGDSLSVMLLLKFGASTKIVDEGG---FTPLHW 62
           ++  G IDI    D K R + L WA+       V  L+  GA+     +GG    TPLHW
Sbjct: 105 LIESGRIDISHDYDEKERISGLHWASINNRLGIVRYLIGKGANVDF--QGGDLNATPLHW 162

Query: 63  ATVKGQPYVLTHLIRDGADFFLKTNDG 89
           A   G  Y++  L+  GAD  L  + G
Sbjct: 163 AARYGYVYIVDSLLESGADASLTDHQG 189

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721
           A  +GD  +VK LL+    +LN   +G     HWA++  + +V+KYL+  G D   K  D
Sbjct: 233 AAYQGDSLSVKALLEFNA-NLNIADSGGFLPPHWATVKGQPTVLKYLLEGGSDFFQKTAD 291

>Scas_699.36
          Length = 511

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 87/165 (52%), Gaps = 6/165 (3%)

Query: 1   LLPVLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPL 60
           +L +L FVV+  + DI+  D  GR+PL+ A+  GD L + LLLKFG++  +VD  G+   
Sbjct: 124 VLYILLFVVSLELEDINMCDENGRSPLMLASAHGDLLIIKLLLKFGSNVNLVDNDGYNAA 183

Query: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYP 120
           H+A + G+  +   LI +G D   KT +GK C  +A EMNT    ++       N DG  
Sbjct: 184 HFAIIGGEFRIFDILIENGTDVLSKTKNGKSCLQLATEMNTVTRLQNIFRNHCLNDDGVK 243

Query: 121 KRKLF--KKSDHAKVITFFVPLVALSIIFILFTHLHPLFALLISL 163
             K++   +     + +  +PL  + I    F+ L  L+++  SL
Sbjct: 244 DYKIYLINRKFWVSLTSMLIPLCCVMI----FSTLVNLYSIGYSL 284

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 655 VLGQYHQACQKGDLATVKQLLDSGVLDLN-----TDLTGDITGLHWASINNRLSVVKYLI 709
           V+  +  +C+ G++ TVKQL+ S V++ N      D    +  L WA IN+R+ V++YLI
Sbjct: 6   VVDNFLLSCELGNIDTVKQLVSSNVIEGNYINEIRDNCQGLNALQWACINDRIEVIEYLI 65

Query: 710 SQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGA 747
           SQG D N + G    TPL  A ++G+++ +D LL   A
Sbjct: 66  SQGADTNIQCG--LHTPLQLAVQFGHIYTIDLLLKNDA 101

>CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces
           cerevisiae YIL112w, hypothetical start
          Length = 1110

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 54/91 (59%), Gaps = 1/91 (1%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721
           AC KG     K+L++    D+N       + LH A++N  LS+VK LIS G +VN ++ +
Sbjct: 368 ACDKGKYDVAKRLIEEEDYDVNDQDNAGNSALHEAALNGHLSIVKLLISHGANVNIQSYE 427

Query: 722 L-EATPLHWAARYGYVHIVDCLLNKGADPTM 751
           + + TPL  A+  G++ IV  LL  GADPT+
Sbjct: 428 MFKDTPLVDASANGHLDIVRYLLRHGADPTI 458

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 7   FVVAKGII-----DIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--TP 59
           + VAK +I     D++ QD  G + L  AA  G    V LL+  GA+  I     F  TP
Sbjct: 374 YDVAKRLIEEEDYDVNDQDNAGNSALHEAALNGHLSIVKLLISHGANVNIQSYEMFKDTP 433

Query: 60  LHWATVKGQPYVLTHLIRDGAD 81
           L  A+  G   ++ +L+R GAD
Sbjct: 434 LVDASANGHLDIVRYLLRHGAD 455

>YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p
           complex that has histone deacetylase activity and a role
           in repression of meiotic-specific sporulation gene
           expression, contains ankyrin repeats [3252 bp, 1083 aa]
          Length = 1083

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 7/94 (7%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKA-- 719
           AC KG    VK++++ G  D+N       T LH A++   + +V+ LI  G DVN K+  
Sbjct: 337 ACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIE 396

Query: 720 --GDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
             GD   TPL  A+  G++ +V  LL  GADPT+
Sbjct: 397 MFGD---TPLIDASANGHLDVVKYLLKNGADPTI 427

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 4   VLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKI--VDEGGFTPLH 61
           V+  ++ +G  DI+ QD  G T L  AA QG    V LL++ GA   I  ++  G TPL 
Sbjct: 345 VVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLI 404

Query: 62  WATVKGQPYVLTHLIRDGADFFLKTNDGKDCF 93
            A+  G   V+ +L+++GAD  ++   G   F
Sbjct: 405 DASANGHLDVVKYLLKNGADPTIRNAKGLTAF 436

>Scas_671.30
          Length = 1054

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721
           AC KG     K+L++    D+N       + LH A++N  +S+VK LI  G +VN ++ +
Sbjct: 311 ACDKGKYDVAKRLIEEEGYDVNDQDNAGNSALHEAALNGHISIVKLLIDNGANVNIQSYE 370

Query: 722 L-EATPLHWAARYGYVHIVDCLLNKGADPTMC 752
           + + TPL  A+  G++ +V  LL  GADPT+ 
Sbjct: 371 MFQDTPLVDASANGHLDVVQLLLENGADPTIT 402

>KLLA0F03619g 342770..345652 weakly similar to sp|P40480
           Saccharomyces cerevisiae YIL112w singleton, start by
           similarity
          Length = 960

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721
           AC KG     K+L++    D+N       T LH A++N   ++V+ L+  G +VN ++ D
Sbjct: 266 ACDKGKYDLAKKLIEEDGYDVNDQDNAGNTPLHEAALNGHSAIVELLVRNGANVNIQSYD 325

Query: 722 L-EATPLHWAARYGYVHIVDCLLNKGADPTMC 752
           +   TPL  A+  G++++V  LL+ GADPTM 
Sbjct: 326 MFLDTPLIDASANGHINVVKYLLDHGADPTMV 357

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 7   FVVAKGII-----DIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--TP 59
           + +AK +I     D++ QD  G TPL  AA  G S  V LL++ GA+  I     F  TP
Sbjct: 272 YDLAKKLIEEDGYDVNDQDNAGNTPLHEAALNGHSAIVELLVRNGANVNIQSYDMFLDTP 331

Query: 60  LHWATVKGQPYVLTHLIRDGAD 81
           L  A+  G   V+ +L+  GAD
Sbjct: 332 LIDASANGHINVVKYLLDHGAD 353

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 19  QDPKGRTPLLWAAYQGD-SLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIR 77
           +D  GRT L  A  +G   L+  L+ + G      D  G TPLH A + G   ++  L+R
Sbjct: 255 RDAGGRTKLQIACDKGKYDLAKKLIEEDGYDVNDQDNAGNTPLHEAALNGHSAIVELLVR 314

Query: 78  DGADFFLKTND 88
           +GA+  +++ D
Sbjct: 315 NGANVNIQSYD 325

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 16  IDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWAT 64
           ++  + +G+TPL+ +  +G    V LLL+ GA  +  D+   T LH+A 
Sbjct: 489 VNMSNKEGQTPLMLSVGRGHVNVVKLLLEAGADPQKTDKRKKTALHYAN 537

>ADL244W [1497] [Homologous to ScYIL112W - SH]
           complement(273379..276648) [3270 bp, 1089 aa]
          Length = 1089

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 53/92 (57%), Gaps = 2/92 (2%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721
           AC KG     ++L++ G  D+N       + LH A++N  L VVK LI  G +VN ++ +
Sbjct: 348 ACDKGKYDLARKLIEEG-YDVNDQDNAGNSPLHEAALNGHLEVVKLLIRHGANVNIQSYE 406

Query: 722 L-EATPLHWAARYGYVHIVDCLLNKGADPTMC 752
           + + TPL  A+  G++ I+  LL  GADPT+ 
Sbjct: 407 MFKDTPLIDASANGHLDILRELLQNGADPTIV 438

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 15  DIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--TPLHWATVKGQPYVL 72
           D++ QD  G +PL  AA  G    V LL++ GA+  I     F  TPL  A+  G   +L
Sbjct: 366 DVNDQDNAGNSPLHEAALNGHLEVVKLLIRHGANVNIQSYEMFKDTPLIDASANGHLDIL 425

Query: 73  THLIRDGAD 81
             L+++GAD
Sbjct: 426 RELLQNGAD 434

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%)

Query: 19  QDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRD 78
           +D  GRT L  A  +G       L++ G      D  G +PLH A + G   V+  LIR 
Sbjct: 337 RDAGGRTRLQVACDKGKYDLARKLIEEGYDVNDQDNAGNSPLHEAALNGHLEVVKLLIRH 396

Query: 79  GADFFLKT 86
           GA+  +++
Sbjct: 397 GANVNIQS 404

>Kwal_23.4914
          Length = 1043

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAGD 721
           AC KG+    K+L+  G    + D  G+ + LH A++N  L +V+ L+  G  VN ++ +
Sbjct: 329 ACDKGNYEVAKRLIQEGYNVDDQDNAGN-SSLHEAALNGHLDIVELLLESGASVNVQSHE 387

Query: 722 -LEATPLHWAARYGYVHIVDCLLNKGADPTMC 752
            +  TPL  AA  G++ +V  LL   ADPT+ 
Sbjct: 388 PIRDTPLIDAAANGHLDVVKVLLRHRADPTIT 419

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 7   FVVAKGII----DIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGF--TPL 60
           + VAK +I    ++D QD  G + L  AA  G    V LLL+ GAS  +        TPL
Sbjct: 335 YEVAKRLIQEGYNVDDQDNAGNSSLHEAALNGHLDIVELLLESGASVNVQSHEPIRDTPL 394

Query: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDG 89
             A   G   V+  L+R  AD  +  + G
Sbjct: 395 IDAAANGHLDVVKVLLRHRADPTITNSKG 423

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 28/70 (40%)

Query: 28  LWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTN 87
           L A   G      L L FGA   +    G TPL  +  +G    +  L+  GAD  +K  
Sbjct: 532 LEAVKYGHEDITSLFLAFGAQPNMTSREGQTPLMVSVGRGHTGTVKLLLEAGADPLVKDK 591

Query: 88  DGKDCFTIAQ 97
            G+     A+
Sbjct: 592 QGRSVLNYAK 601

>Scas_595.8
          Length = 235

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 10/99 (10%)

Query: 660 HQACQKGDLATVKQLLDS-----GVLDLNTDLTGDITGLHWASINNRLSVVKYLIS--QG 712
           HQAC  G+LA V++L++       ++ L++D   + T LHWA    R  +V YL+S  + 
Sbjct: 11  HQACMDGNLAKVQELVEELATPDDIVALDSD---NRTPLHWAVSFQREEIVTYLLSFMKE 67

Query: 713 IDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
           ID++    D E TP+H AA  G + I+  L ++   P +
Sbjct: 68  IDLDKLKDDSEWTPVHIAASVGNLFILTQLYDREIKPDL 106

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 43/93 (46%), Gaps = 6/93 (6%)

Query: 660 HQACQKGDLATVKQLLDSGVL-DLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAK 718
           H A   G+L  + QL D  +  DLN       T LH +     LSV K+LI  G  V  K
Sbjct: 83  HIAASVGNLFILTQLYDREIKPDLNLQTKQGTTALHLSVAKKHLSVCKFLIDNGASVRLK 142

Query: 719 --AGDLEATPLHWAARYGYVHIVDCLLNKGADP 749
              G L   PLH AA  G + +V+ L  +G  P
Sbjct: 143 DQKGQL---PLHRAASIGSMTLVELLCTQGKSP 172

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (49%), Gaps = 12/105 (11%)

Query: 15  DIDCQDPKGRTPLLWA-AYQGDSLSVMLL--LKFGASTKIVDEGGFTPLHWATVKGQPYV 71
           DI   D   RTPL WA ++Q + +   LL  +K     K+ D+  +TP+H A   G  ++
Sbjct: 34  DIVALDSDNRTPLHWAVSFQREEIVTYLLSFMKEIDLDKLKDDSEWTPVHIAASVGNLFI 93

Query: 72  LTHLI-RD-GADFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGF 114
           LT L  R+   D  L+T  G    T A  ++ +   K  LS+C F
Sbjct: 94  LTQLYDREIKPDLNLQTKQG----TTALHLSVA---KKHLSVCKF 131

>YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor
           involved in the response to hypoxia and biosynthesis of
           unsaturated fatty acids, may be involved in the
           remodeling of chromatin structure [3342 bp, 1113 aa]
          Length = 1113

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%)

Query: 15  DIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTH 74
           +I   D  GRT L  A  +  S  V  L+K GA    +D  G TPLH+A + G P ++  
Sbjct: 712 NISICDSLGRTLLHLACLKNYSSLVYTLIKKGARVNDIDSFGLTPLHFACISGDPKIIKM 771

Query: 75  LIRDGADFFLKTNDG 89
           L+    ++ L++++G
Sbjct: 772 LLNCKVNYSLRSHNG 786

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 691 TGLHWASINNRLSVVKYLISQGIDVNAKAGDLEA---TPLHWAARYGYVHIVDCLLN 744
           T LH A + N  S+V  LI +G    A+  D+++   TPLH+A   G   I+  LLN
Sbjct: 722 TLLHLACLKNYSSLVYTLIKKG----ARVNDIDSFGLTPLHFACISGDPKIIKMLLN 774

>ACL003C [1046] [Homologous to ScYOL003C - SH] (352024..353151)
           [1128 bp, 375 aa]
          Length = 375

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 53/127 (41%), Gaps = 24/127 (18%)

Query: 226 LLTNFFMF-------LILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDI 278
           +LTNF  F       + L  I+  + K I+ +PG           +G         +++ 
Sbjct: 30  VLTNFLSFKELLWFQVSLSMIWISYWKAIYKNPG--------RPTKG-----FRPLRYEW 76

Query: 279 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLK----NHKNFMWFILLTEV 334
           +N+C +    KP R+H        V   DH CPW  N +GL+     H  F W I  T +
Sbjct: 77  QNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGI 136

Query: 335 GIWFFIS 341
            + +F+ 
Sbjct: 137 LLHYFVK 143

>KLLA0D18370g complement(1549382..1550449) similar to sgd|S0004236
           Saccharomyces cerevisiae YLR246w ERF2 protein involved
           in palmitoylation and localization of RAS2P,
           hypothetical start
          Length = 355

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 69/154 (44%), Gaps = 21/154 (13%)

Query: 211 VWIFKIAPFTIFKSRLL-----TNFFMFLILMQIYYL-----FIKLIFSDPGCVPIETDH 260
           ++I  +  F+IF+   L     TN+   ++++  +YL     F++   SDPG VP     
Sbjct: 82  MFIVPLILFSIFECNYLWHHKGTNWKPAIVILYYFYLLTICSFLRAACSDPGIVPRNVHI 141

Query: 261 ENVRGTIK---ELLDTGKFDIKN--------FCLETWIRKPLRSHFSTLNTHNVARFDHF 309
            ++  + K   E  +      KN        +C    I +P RS   ++    V   DH 
Sbjct: 142 PDLNASYKIPQEYYNYAILPTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHH 201

Query: 310 CPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLT 343
           C W+ N IG +N++ F+ F++ + +     I L+
Sbjct: 202 CKWLNNCIGKRNYRFFLEFLMASTISCILLILLS 235

>KLLA0E18029g complement(1600015..1603470) weakly similar to
           sp|P40578 Saccharomyces cerevisiae YIR033w MGA2 may be
           involved in the remodeling chromatin structure, start by
           similarity
          Length = 1151

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDGADF 82
           G+T L  A  +G    V  L+K GA   + D  GFTPLH+A + G    +  L+   A+ 
Sbjct: 769 GQTMLHLACLKGYFHLVSALVKKGARVDVTDSFGFTPLHFACINGDVKAIQLLVECKANV 828

Query: 83  FLKTNDGKDCFTI-------AQEMNTSHSFKDALSICGFNQDGYPKRKL 124
             + ++G D   +       A E N S+  +DAL +   +  G  K +L
Sbjct: 829 TARADNGVDALDLYKSQHVSAAEKNNSY-IEDALRLLATHDGGIEKNEL 876

>Sklu_2319.5 YNL326C, Contig c2319 9193-10194
          Length = 333

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 270 LLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFI 329
           L   G+F I   C + W  KP RSH  +       + DH CPW  + IG KN K F+ F+
Sbjct: 96  LKHNGRFRICRNC-KVW--KPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFL 152

Query: 330 LLTE-VGIWFFISLTMKYFDILED 352
           L T    ++ F++  ++ +  L++
Sbjct: 153 LYTTWYAVFVFMTTGLQLWKWLDN 176

>YOL003C (YOL003C) [4813] chr15 complement(321858..322994) Nuclear
           protein of unknown function [1137 bp, 378 aa]
          Length = 378

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 279 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFI--LLTEVGI 336
           +NFC +    KP RSH        V   DH CPW  N +G  N+ +F+ F+  ++    +
Sbjct: 77  RNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSV 136

Query: 337 WFFISLTMKYF 347
            F I     YF
Sbjct: 137 LFCIQAKRIYF 147

>Scas_595.9
          Length = 1148

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 662 ACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASIN-----NRLSVVKYLISQGIDVN 716
           ACQ  +    + LL + +  LN   T  +T LH  + N     N   +V+ LI +G + N
Sbjct: 490 ACQYNNFEAAELLLAADINLLNVSDTKGLTPLHIVAKNGTNETNSRKLVQLLIQKGANPN 549

Query: 717 AKAGDLEATPLHWAARYGYVHIVDCLLNKGAD 748
           A     + TP+ +A + G   IVD LL  GAD
Sbjct: 550 ALDTFNKWTPIFYAIQRGQREIVDELLKNGAD 581

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 6/90 (6%)

Query: 7   FVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLS-----VMLLLKFGASTKIVDE-GGFTPL 60
            ++A  I  ++  D KG TPL   A  G + +     V LL++ GA+   +D    +TP+
Sbjct: 501 LLLAADINLLNVSDTKGLTPLHIVAKNGTNETNSRKLVQLLIQKGANPNALDTFNKWTPI 560

Query: 61  HWATVKGQPYVLTHLIRDGADFFLKTNDGK 90
            +A  +GQ  ++  L+++GAD  +K ++ +
Sbjct: 561 FYAIQRGQREIVDELLKNGADLAIKDDENR 590

>YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting
           with regulatory particle of the 26S proteasome [687 bp,
           228 aa]
          Length = 228

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 659 YHQACQKGDLATVKQLLDSGVL-DLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNA 717
           +H AC  G+L  VK L D  +  DLN      +T LH A       V ++LI  G  V  
Sbjct: 76  FHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRI 135

Query: 718 KAGDLEATPLHWAARYGYVHIVD--CLLNKGA 747
           K       PLH AA  G + +++  C L K A
Sbjct: 136 K-DKFNQIPLHRAASVGSLKLIELLCGLGKSA 166

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 660 HQACQKGDLATVKQLLDSG-VLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAK 718
           HQAC + +   V++LL S   L L  D  G I  LHW+       +  +L+S+  +VN  
Sbjct: 7   HQACMENEFFKVQELLHSKPSLLLQKDQDGRIP-LHWSVSFQAHEITSFLLSKMENVNLD 65

Query: 719 --AGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
               D   TP H A   G + +V  L ++   P +
Sbjct: 66  DYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDL 100

>YKL020C (SPT23) [3235] chr11 complement(398475..401723)
           Transcription factor required for transcription of a
           subset of genes; functionally redundant with Mga2p [3249
           bp, 1082 aa]
          Length = 1082

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%)

Query: 14  IDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLT 73
           +++   D +GRT L  AA+      V LL+K+G+     D  GFTPLH A + G   ++ 
Sbjct: 701 VNLSMCDVRGRTLLHLAAFNNWYSLVSLLIKYGSHLNDQDLFGFTPLHMACINGDLRIIR 760

Query: 74  HLIRDGADFFLKTNDG 89
            L+    +   KT +G
Sbjct: 761 LLLECNVNIMKKTRNG 776

>Scas_392.2
          Length = 376

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 75/172 (43%), Gaps = 31/172 (18%)

Query: 213 IFKIAPFTIFKSRLLTNFFMFLILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLD 272
           IF +A F  +K +L   F   L ++ I Y     IF++PG             + K L  
Sbjct: 28  IFVLANFMSWKLQLW--FQSSLTMLWISYALA--IFTNPG---------RPAKSFKPL-- 72

Query: 273 TGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLT 332
             K +  +FC +  + KP R+H        V   DH CPW  N +G KN  +F+ F+   
Sbjct: 73  --KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLF-- 128

Query: 333 EVGIWFFISLTMKYFDILEDTNEDVACFLLGDDELCAGFVYDR--FTFLIAL 382
               W  ++     + +L+ T      +L G  +L   +++++   TFLI L
Sbjct: 129 ----WVVVTTGFLLYQLLKRT-----IYLWGVKDL-PSYLFEKTEITFLIIL 170

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQ 68
           G TP+  AA +G +  V LLLK+GA   I DE G+TP+  A ++G 
Sbjct: 606 GWTPMFAAATEGYADIVRLLLKYGAKYDISDESGWTPMEHAALRGH 651

>Sklu_1541.2 YOL003C, Contig c1541 950-2089 reverse complement
          Length = 379

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 275 KFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 330
           KF+ +NFC +    KP R+H        V   DH CPW  N +G +N  +F+ F+ 
Sbjct: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLF 128

>Scas_716.48
          Length = 327

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 274 GKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLT- 332
           G++ +   C + W  KP R H  +     + + DH CPW    IG +N K F+ F++   
Sbjct: 96  GRYRLCQTC-QVW--KPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCT 152

Query: 333 --EVGIWFFISLTMKYF 347
              + + FF S  + Y+
Sbjct: 153 AYSIVVLFFTSCELHYW 169

>CAGL0E02497g complement(241118..242248) similar to tr|Q12006
           Saccharomyces cerevisiae YOL003c, start by similarity
          Length = 376

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 47/122 (38%), Gaps = 17/122 (13%)

Query: 214 FKIAPFTIFKSRLLTNFFMFLILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLDT 273
           F +  F   + +L   F   +I +  YYL    I++ PG  P                  
Sbjct: 29  FILLNFLSLRKQLWYQFCQTMIWLS-YYL---AIYTPPGKPPTN-------------FKP 71

Query: 274 GKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTE 333
            K + K +C +    KP RSH        V   DH CPW  N +G  N  +F+ F+    
Sbjct: 72  SKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVI 131

Query: 334 VG 335
           VG
Sbjct: 132 VG 133

>Kwal_55.22126
          Length = 360

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 270 LLDTGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFI 329
           L   G+F    FC    + KP R H  +       + DH CPW  + +G +N K F+ F+
Sbjct: 124 LKRNGRF---RFCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFL 180

Query: 330 LLT 332
           L T
Sbjct: 181 LYT 183

>CAGL0L06622g complement(743602..747015) similar to sp|P17442
           Saccharomyces cerevisiae YGR233c PHO81 cyclin-dependent
           kinase inhibitor, start by similarity
          Length = 1137

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLI 76
           GRTPL +A   G    V LLL+  AS  ++D+ G+TPL +   +    VL  ++
Sbjct: 550 GRTPLFYAVMNGKDNIVSLLLRCNASIDVMDDEGYTPLFYTIWESDVKVLNAML 603

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 655 VLGQYHQACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASIN-NRLSVVKYLISQGI 713
           VL     AC+KG+   VK +LD     +       +  LH  S N N  ++ + LIS+G 
Sbjct: 481 VLDPLSVACKKGNFEAVKLILDFLGDKIEGPSLDKMELLHIVSKNSNSSALAELLISKGA 540

Query: 714 DVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGA 747
           +VN     L  TPL +A   G  +IV  LL   A
Sbjct: 541 NVNYGDKFLGRTPLFYAVMNGKDNIVSLLLRCNA 574

>KLLA0C06204g complement(548912..550045) similar to sgd|S0005363
           Saccharomyces cerevisiae YOL003c, start by similarity
          Length = 377

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 16/91 (17%)

Query: 240 YYLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKPLRSHFSTLN 299
           YYL    I+++PG  P     ++ + + +E          N+C +  + KP R+H     
Sbjct: 54  YYL---AIYTNPGIPP-----KDFKPSAEEW--------HNYCKKCRVYKPERAHHCKTC 97

Query: 300 THNVARFDHFCPWIYNDIGLKNHKNFMWFIL 330
              V   DH CPW  N +G  N  +FM F+ 
Sbjct: 98  NQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128

>Kwal_27.12750
          Length = 233

 Score = 40.4 bits (93), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 6/96 (6%)

Query: 660 HQACQKGDLATVKQLL--DSGVLDLNTDLTGDITGLHWASINNRLSVVKYLIS--QGIDV 715
           H+AC++G    V++LL  D G L L+ DL      +HWA       VV  L+S  + +D+
Sbjct: 11  HEACREGQEGKVRELLNEDPG-LCLSKDLDSRYP-IHWAVSYQHEKVVDLLLSHMRNVDL 68

Query: 716 NAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
           +    +   +PLH A+  G ++IV  LL+    P +
Sbjct: 69  DDLVDESGWSPLHIASSVGNLNIVKSLLSLSIKPDL 104

 Score = 34.7 bits (78), Expect = 0.19,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 2/87 (2%)

Query: 660 HQACQKGDLATVKQLLDSGVL-DLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAK 718
           H A   G+L  VK LL   +  DL+   +  +T LH A     L V   LI +G  V  K
Sbjct: 81  HIASSVGNLNIVKSLLSLSIKPDLDLATSQGVTALHLACSKQHLPVASLLIEEGASVR-K 139

Query: 719 AGDLEATPLHWAARYGYVHIVDCLLNK 745
                   LH AA  G + +V  L ++
Sbjct: 140 KDTRNQLALHRAASVGNIPLVKLLCDQ 166

>CAGL0L06600g 742803..743498 similar to sp|P50086 Saccharomyces
           cerevisiae YGR232w, start by similarity
          Length = 231

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 43/97 (44%), Gaps = 8/97 (8%)

Query: 659 YHQACQKGDLATVKQLLDSGV-----LDLNTDLTGDITGLHWASINNRLSVVKYLISQGI 713
           +H +C  G L  V QL ++       LDL T  +  +T LH A     L V KYLI  G 
Sbjct: 77  FHISCSIGHLDIVDQLYNNNPDARPNLDLQT--SQGVTALHLAVAKKHLEVCKYLIKLGA 134

Query: 714 DVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPT 750
            V  K    +   LH AA  G + +V+ L +    P 
Sbjct: 135 SVRIKDKKGQIA-LHRAAAVGSIGVVEFLCSTAKSPV 170

 Score = 35.4 bits (80), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 660 HQACQKGDLATVKQLLDSG---VLDLNTDLTGDITGLHWASINNRLSVVKYLIS--QGID 714
           H+AC   +   V++LL+S       +  D  G +  LHWA      +++K L+   + +D
Sbjct: 6   HKACLNNEPRKVQELLESSDPFKAVVQRDDDGRVP-LHWAVSIQSDAIIKLLLPYMKSVD 64

Query: 715 VNAKAGDLEATPLHWAARYGYVHIVDCLLNKGAD 748
           ++    +   TP H +   G++ IVD L N   D
Sbjct: 65  IDTLTDEAGWTPFHISCSIGHLDIVDQLYNNNPD 98

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 9/86 (10%)

Query: 19  QDPKGRTPLLWA-AYQGDSLSVMLLLKFGASTKI---VDEGGFTPLHWATVKGQPYVLTH 74
           +D  GR PL WA + Q D++ + LLL +  S  I    DE G+TP H +   G   ++  
Sbjct: 33  RDDDGRVPLHWAVSIQSDAI-IKLLLPYMKSVDIDTLTDEAGWTPFHISCSIGHLDIVDQ 91

Query: 75  LIRDGAD----FFLKTNDGKDCFTIA 96
           L  +  D      L+T+ G     +A
Sbjct: 92  LYNNNPDARPNLDLQTSQGVTALHLA 117

>AGL125C [4187] [Homologous to ScYLR246W (ERF2) - SH]
           (473496..474599) [1104 bp, 367 aa]
          Length = 367

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 280 NFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEV-GIWF 338
            +C    I +P R+    +    +  FDH C W+ N IG +NH+ F+ F+  + +  IW 
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWL 244

Query: 339 FISLTMK 345
                +K
Sbjct: 245 LTCCALK 251

>CAGL0D02508g 256760..257758 similar to sp|P42836 Saccharomyces
           cerevisiae YNL326c, start by similarity
          Length = 332

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 45/120 (37%), Gaps = 19/120 (15%)

Query: 231 FMFLILMQIYYLFIKLIFSDPGCVP----------------IETDHENVRGTIKELLDTG 274
            +F I M   Y + KLI+  PG                    E   E +          G
Sbjct: 42  LVFTIAMVALYTYAKLIYVGPGTTKEYSILRVYDLNAAESGFELPPEMLVKRSYTQKRNG 101

Query: 275 KFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEV 334
           +F +   C  +W  KP R H  +     V + DH CPW    +G +N K F+ F++   V
Sbjct: 102 RFRVCKSC-SSW--KPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTV 158

>KLLA0E02068g complement(195185..196162) weakly similar to sp|P42836
           Saccharomyces cerevisiae YNL326c, hypothetical start
          Length = 325

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 280 NFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEV 334
            FC    I KP R H  +       + DH CPW  + +G +N K F+ F+  T V
Sbjct: 103 RFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTV 157

>YNL326C (YNL326C) [4289] chr14 complement(27336..28346) Protein
           with similarity to Akr1p and Swf1p [1011 bp, 336 aa]
          Length = 336

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 16/78 (20%)

Query: 274 GKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLT- 332
           G+F +   C   W  KP R H  +     + + DH CPW     G +N K F+ F++ T 
Sbjct: 101 GRFRVCQVC-HVW--KPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTT 157

Query: 333 ------------EVGIWF 338
                       E+G WF
Sbjct: 158 LYAFLVLIYTCYELGTWF 175

>KLLA0D08910g 750828..751448 similar to sp|P46683 Saccharomyces
           cerevisiae YPL239w YAR1 ankyrin repeat-containing
           protein singleton, start by similarity
          Length = 206

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 16/100 (16%)

Query: 663 CQKGDLATVKQ----LLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLIS-------- 710
            + GDL ++K     L+D   L   TD     + LH A+ N    VVKYL+S        
Sbjct: 20  ARAGDLESLKDIFTTLIDPSALIECTDELSKSSALHMAAANGHFEVVKYLLSIFPKDKLK 79

Query: 711 QGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNK-GADP 749
           + ++   + G+   T LHWA+  G + IV  L  +  ADP
Sbjct: 80  EWVNKQNETGN---TALHWASLNGKLDIVQLLCEEYEADP 116

>CAGL0K06347g complement(623217..624275) similar to tr|Q03289
           Saccharomyces cerevisiae YDR459c, hypothetical start
          Length = 352

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 292 RSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEV---GIWFFISLTMK 345
           R+  S+   H V RFDH+C W+   IG KN++ F+ F+    V    +W  IS+ ++
Sbjct: 126 RTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAVLLMIVWITISVYIR 182

>ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165)
           [1173 bp, 390 aa]
          Length = 390

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 280 NFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEV-GIWF 338
            +C++  + KP R H  +       R DH C W    IG  NHK F+ F+L   V   W 
Sbjct: 169 RYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWI 228

Query: 339 FISLT 343
            I  T
Sbjct: 229 CIITT 233

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQ 68
           G TPL   A +G S  V LL+  GA+  I+D+GG+TP+  A ++G 
Sbjct: 587 GWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPMEHAVLRGH 632

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 35/88 (39%), Gaps = 1/88 (1%)

Query: 662 ACQKGDLATVKQLLDSGVLDLN-TDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKAG 720
           A Q  +   +  +L S  +D+N  D     T L+ A   N       L+  G     K  
Sbjct: 525 AIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAVAANLFEATACLLINGASTEIKEK 584

Query: 721 DLEATPLHWAARYGYVHIVDCLLNKGAD 748
               TPL   A  GY  IV  L+N GA+
Sbjct: 585 LFGWTPLFIGAAEGYSDIVRLLVNNGAN 612

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 8   VVAKGIIDIDCQDPKGRTPLLWAAYQGDSL-SVMLLLKFGASTKIVDE-GGFTPLHWATV 65
           +++   IDI+ QD + +   L+ A   +   +   LL  GAST+I ++  G+TPL     
Sbjct: 537 ILSSSRIDINFQDEQTKETALYQAVAANLFEATACLLINGASTEIKEKLFGWTPLFIGAA 596

Query: 66  KGQPYVLTHLIRDGADFFLKTNDG 89
           +G   ++  L+ +GA+  +  + G
Sbjct: 597 EGYSDIVRLLVNNGANINILDDGG 620

>YLR246W (ERF2) [3642] chr12 (627120..628199) Protein that, in a
           complex with Shr5p, acts as a palmitoyltransferase for
           Ras2p [1080 bp, 359 aa]
          Length = 359

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 57/134 (42%), Gaps = 23/134 (17%)

Query: 219 FTIFKSRLL---TNFFMFLILMQIYYL------FIKLIFSDPGCVPIETDHENVRG---- 265
           F+IF++  L    N +  L++   Y+       FI+   SDPG +P       +R     
Sbjct: 91  FSIFEAHKLWHTQNGYKVLVIFFYYFWVITLASFIRTATSDPGVLPRNIHLSQLRNNYQI 150

Query: 266 --------TIKELLDTGKFDIKNFCLETWIRKPLRS-HFSTLNTHNVARFDHFCPWIYND 316
                   T+       K     +C    I +P RS H ST N   V   DH C W+ N 
Sbjct: 151 PQEYYNLITLPTHSSISKDITIKYCPSCRIWRPPRSSHCSTCNV-CVMVHDHHCIWVNNC 209

Query: 317 IGLKNHKNFMWFIL 330
           IG +N++ F+ F+L
Sbjct: 210 IGKRNYRFFLIFLL 223

>YDR459C (YDR459C) [1277] chr4 complement(1382307..1383431) Protein
           of unknown function, has similarity to Erf2p [1125 bp,
           374 aa]
          Length = 374

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 281 FCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWF-------ILLTE 333
           +C E    K  R+H S+   H + RFDH+C WI   IG  N++ F+ F       +L+  
Sbjct: 130 WCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLLLIMW 189

Query: 334 VGIWFFISLTMKY 346
           V I  +I +  ++
Sbjct: 190 VSICVYIRIITQH 202

>CAGL0F06831g 668173..671451 similar to sp|P40578 Saccharomyces
           cerevisiae YIR033w MGA2 or sp|P35210 Saccharomyces
           cerevisiae YKL020c SPT23, hypothetical start
          Length = 1092

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 35/70 (50%)

Query: 20  DPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDG 79
           D  GRT L  A+ +G    V  L+K GA     D   FTPLH+A V G   ++  L+  G
Sbjct: 728 DNLGRTLLHLASLKGYFKLVSTLIKKGARIDDKDSFDFTPLHFACVSGDVKIIRILLDCG 787

Query: 80  ADFFLKTNDG 89
           AD   KT  G
Sbjct: 788 ADKNRKTKHG 797

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 691 TGLHWASINNRLSVVKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGAD 748
           T LH AS+     +V  LI +G  ++ K    + TPLH+A   G V I+  LL+ GAD
Sbjct: 733 TLLHLASLKGYFKLVSTLIKKGARIDDKDS-FDFTPLHFACVSGDVKIIRILLDCGAD 789

>ACR165W [1212] [Homologous to ScYKL020C (SPT23) - SH; ScYIR033W
           (MGA2) - SH] complement(644229..647648) [3420 bp, 1139
           aa]
          Length = 1139

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%)

Query: 22  KGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIR 77
           +G T L  A  +G    V LL+K GA  ++ D  GFTPLH+A V G   +   LI+
Sbjct: 750 EGHTLLHLACLKGYYQLVSLLVKKGAHVEVTDRFGFTPLHFACVNGDTRITRLLIQ 805

>Sklu_2237.5 YPL239W, Contig c2237 9761-10357
          Length = 198

 Score = 38.5 bits (88), Expect = 0.008,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 16/99 (16%)

Query: 664 QKGDLATVK----QLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLIS--------Q 711
           + GDL ++K     L+   +L    D     T LH A+ N  L V+KYL+S        Q
Sbjct: 21  RAGDLDSLKDIFTNLVHPKLLTTCYDSVSKSTPLHMAAANGHLEVIKYLLSIAEPSEVKQ 80

Query: 712 GIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNK-GADP 749
            ++   + G+   T LHWA+  G + IV  L  +  ADP
Sbjct: 81  WVNTRNETGN---TALHWASLNGNLEIVKLLCEEYDADP 116

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 660 HQACQKGDLATVKQLLD----SGVLD-LNTDLTGDITGLHWASINNRLSVVKYLISQ 711
           H A   G L  +K LL     S V   +NT      T LHWAS+N  L +VK L  +
Sbjct: 55  HMAAANGHLEVIKYLLSIAEPSEVKQWVNTRNETGNTALHWASLNGNLEIVKLLCEE 111

>ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH]
           complement(440265..443573) [3309 bp, 1102 aa]
          Length = 1102

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 662 ACQKGDLATVKQLLDSGVLDLN--TDLTGDITGLHWASINN-RLSVVKYLISQGIDVNAK 718
           AC   +L   + +L+ G ++LN   D  G +  LH  + N   + +++ L+S G + NA 
Sbjct: 482 ACANKNLTAARMILEIGNINLNDVCDSQG-LQPLHIVAKNGGDVELIELLVSHGANPNAV 540

Query: 719 AGDLEATPLHWAARYGYVHIVDCLLNKGA 747
            G  + TP+ +A + GY   V  LL+ GA
Sbjct: 541 DGFNKWTPIFYAVQEGYGSTVQNLLSNGA 569

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 25  TPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDGA 80
           TP+ +A  +G   +V  LL  GA   +VD    +PL +A  +G   VL  L+   A
Sbjct: 547 TPIFYAVQEGYGSTVQNLLSNGAKLDVVDGDNLSPLFYALWEGHLSVLNILLNCAA 602

>Kwal_47.18366
          Length = 356

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 292 RSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWF 328
           R+H S+   + + RFDH+C WI   +G KN++ F+ F
Sbjct: 135 RTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQF 171

>Sklu_2436.4 YDR459C, Contig c2436 10516-11610 reverse complement
          Length = 364

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 292 RSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWF 328
           R+H S    + V RFDH+C WI   +G KN++ F+ F
Sbjct: 137 RTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>YLR182W (SWI6) [3586] chr12 (517942..520353) Transcription factor
           that participates in the SBF complex (Swi4p-Swi6p) for
           regulation at the cell cycle box (CCB) and in the MBF
           complex (Mbp1p-Swi6p) for regulation at the Mlu1 cell
           cycle box (MCB) [2412 bp, 803 aa]
          Length = 803

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 52  VDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIA 96
           VDE G TPLHW T      ++ HL++ G++     N G+ C   A
Sbjct: 314 VDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKA 358

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 705 VKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADP 749
           +K++I+  ++     GD   T L+ AAR G + IVD LL+ GADP
Sbjct: 455 LKWIIANMLNAQDSNGD---TCLNIAARLGNISIVDALLDYGADP 496

>Scas_679.7
          Length = 374

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 20/151 (13%)

Query: 210 IVWIFKIAPFTIFKSRLL--TNFFMFLILMQIYYL-------FIKLIFSDPGCVPIETDH 260
           ++ I  +  F+IF++  L  T     L+++  YY+       FIK   SDPG +P     
Sbjct: 92  LIIIIPMVLFSIFETGKLWHTEKGYKLLVIWFYYIWAICLGSFIKTATSDPGVLPRNVHL 151

Query: 261 ENVRGTIKE--------LLDTGKFD---IKNFCLETWIRKPLRSHFSTLNTHNVARFDHF 309
            +V+   +          L T   D   +  +C    I +P RS   ++    V   DH 
Sbjct: 152 GSVQRNFQIPQEYYNQITLPTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHH 211

Query: 310 CPWIYNDIGLKNHKNFMWFILLTEVGIWFFI 340
           C W+ N +G +N++ F+ F+  + +   F I
Sbjct: 212 CVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

>AGR223W [4534] [Homologous to ScYPL110C - SH]
           complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIR 77
           G TP+  AA +G +  V LL+  GA   + DE G+TP+  A ++G    ++ LIR
Sbjct: 564 GWTPIFAAATEGYARIVQLLVDHGAKYDLFDESGWTPMEHAALRGH-LDISQLIR 617

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 691 TGLHWASINNRLSVVKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGA 747
           T L+ A   +     +YL+ QG ++         TP+  AA  GY  IV  L++ GA
Sbjct: 532 TALYVACKLDIYEAAEYLVKQGANMELGEKLFGWTPIFAAATEGYARIVQLLVDHGA 588

>Kwal_56.22459
          Length = 383

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 279 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 330
           KN C +    KP R+H        V   DH CPW  N +G  N  +F+ F++
Sbjct: 77  KNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128

>Scas_713.9
          Length = 1208

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 4   VLFFVVAKGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLL 43
           V ++V  KG++DI+ +D  G TPL  AAYQ  + +V  L+
Sbjct: 86  VKYYVDEKGLLDINQKDANGNTPLHLAAYQSRTDAVAYLM 125

>KLLA0D06149g 527705..528754 similar to sgd|S0002867 Saccharomyces
           cerevisiae YDR459c, start by similarity
          Length = 349

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 292 RSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL-LTEVGIWFFISLTMKYFDIL 350
           R+H ST   + V RFDH+C WI   +G  N+K F+ F   L  V +   IS+  +   + 
Sbjct: 138 RTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVLILMISIATQMRQMK 197

Query: 351 EDTNEDV 357
              N +V
Sbjct: 198 GSANGNV 204

>Kwal_23.3302
          Length = 353

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 15/143 (10%)

Query: 243 FIKLIFSDPGCVP-------IETDHENVRG-----TIKELLDTG-KFDIKNFCLETWIRK 289
           F +   SDPG +P       + ++ E  +G     ++      G   D+K +C    I +
Sbjct: 122 FFRTATSDPGVLPRNVHVPIVSSEFELPQGYYNIISLPSANSNGLTVDVK-YCPTCRIWR 180

Query: 290 PLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEV-GIWFFISLTMKYFD 348
           P R+   ++    +   DH C W+ N IG +N++ F+ F++ + +  +   +S  ++   
Sbjct: 181 PPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVICIVSCAIRIAH 240

Query: 349 ILEDTNEDVACFLLGDDELCAGF 371
                   VA  LL    LC+ +
Sbjct: 241 ATRLVKVAVAILLLIYCALCSCY 263

>KLLA0E15796g complement(1406502..1407194) similar to sp|P50086
           Saccharomyces cerevisiae YGR232w NAS6 possible homolog
           of human 26S proteasome regulatory subunit p28
           singleton, start by similarity
          Length = 230

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 660 HQACQKGDLATVKQLLDS--GVLDLNTDLTGDITGLHWASINNRLSVVKYLIS--QGIDV 715
           H AC  GD   V+Q+L    G + +  D       LHWA    + +++  L+S  + ID+
Sbjct: 8   HAACMNGDTEKVQQILSEFPGAVKVKDD--DGRYPLHWAVSFQQDNIIDILLSYMKKIDL 65

Query: 716 NAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
           +    +   +P+H A+  G V I++ LLN   +P +
Sbjct: 66  DTILDESGWSPVHIASSIGSVTILEKLLNHTVEPNL 101

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 16  IDCQDPKGRTPLLWA-AYQGDSLSVMLL--LKFGASTKIVDEGGFTPLHWATVKGQPYVL 72
           +  +D  GR PL WA ++Q D++  +LL  +K      I+DE G++P+H A+  G   +L
Sbjct: 30  VKVKDDDGRYPLHWAVSFQQDNIIDILLSYMKKIDLDTILDESGWSPVHIASSIGSVTIL 89

Query: 73  THLIRDGAD--FFLKTNDGKDCFTIA 96
             L+    +    L+ N+G     +A
Sbjct: 90  EKLLNHTVEPNLDLQANNGITALHLA 115

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%)

Query: 15  DIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTH 74
           ++D Q   G T L  A  +     V LL++ GAS +I D  G  PLH A   G   +++ 
Sbjct: 100 NLDLQANNGITALHLACSKKHLNVVQLLVERGASVRIKDGLGQLPLHRAAASGSVGIVSI 159

Query: 75  LIRDGADFFLKTNDG 89
           L    +   +K  +G
Sbjct: 160 LCDKNSPVNIKDKNG 174

>Scas_700.13
          Length = 1133

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEG-GFTPLHWATVKGQPYVLTHLIRDGAD 81
           G T L  A        V  LL  GA++++V+   G+TPL  A  KG   VL  L++ G D
Sbjct: 485 GETALHIACKYNSPEIVACLLAHGANSEVVENKLGWTPLFIAAAKGYNEVLQILLQYGCD 544

Query: 82  FFLKTNDG 89
             LK N G
Sbjct: 545 VNLKDNAG 552

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQ 68
           G TPL  AA +G +  + +LL++G    + D  G+T   +A ++G 
Sbjct: 519 GWTPLFIAAAKGYNEVLQILLQYGCDVNLKDNAGWTAREYAIIEGH 564

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%)

Query: 691 TGLHWASINNRLSVVKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGAD 748
           T LH A   N   +V  L++ G +       L  TPL  AA  GY  ++  LL  G D
Sbjct: 487 TALHIACKYNSPEIVACLLAHGANSEVVENKLGWTPLFIAAAKGYNEVLQILLQYGCD 544

>CAGL0G08217g complement(778823..779803) similar to tr|Q06551
           Saccharomyces cerevisiae YLR246w ERF2, hypothetical
           start
          Length = 326

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 19/142 (13%)

Query: 219 FTIFKS-RLLTNFFMFLILMQIYYL--------FIKLIFSDPGCVPI------ETDHE-- 261
           F++F++ RL    + +  L+ ++Y         F K   SDPG +P       +T  E  
Sbjct: 78  FSVFEAHRLWHTRYGYKALVVLFYYAWAWSLLSFTKTATSDPGVLPRNIHMHKDTPQEYF 137

Query: 262 -NVRGTIKELLDTGKFDIK-NFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGL 319
            NV          G   +   +C    I +P R+   ++    V   DH C W+ N +G 
Sbjct: 138 NNVTLPYGAGGSAGNASVTLKYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQ 197

Query: 320 KNHKNFMWFILLTEVGIWFFIS 341
           +N++ F+ F+L + +     I+
Sbjct: 198 RNYRYFLAFLLSSTLACALLIA 219

>YPL239W (YAR1) [5211] chr16 (99484..100086) Protein with 2 ankyrin
           repeats [603 bp, 200 aa]
          Length = 200

 Score = 36.6 bits (83), Expect = 0.044,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 16/101 (15%)

Query: 664 QKGDLATVKQLLDSGV----LDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKA 719
           + GDL ++K +  + V    L    +   D T LH A+ N  +  V+Y++      N+ A
Sbjct: 21  RAGDLDSLKDIFTTLVSPELLSTCKESESDSTALHMAAANGHIETVRYILETVSRANS-A 79

Query: 720 GDLEA----------TPLHWAARYGYVHIVDCLLNK-GADP 749
            DL+A          T LHWA+  G + +V  L ++  ADP
Sbjct: 80  EDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADP 120

 Score = 33.5 bits (75), Expect = 0.34,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 11/62 (17%)

Query: 660 HQACQKGDLATVKQLLDS-----GVLDLNT-----DLTGDITGLHWASINNRLSVVKYLI 709
           H A   G + TV+ +L++        DL       + TG+ T LHWAS+N +L VVK L 
Sbjct: 55  HMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGN-TALHWASLNGKLDVVKLLC 113

Query: 710 SQ 711
            +
Sbjct: 114 DE 115

>AFL146W [3049] [Homologous to ScYPL239W (YAR1) - SH]
           complement(161573..162169) [597 bp, 198 aa]
          Length = 198

 Score = 36.2 bits (82), Expect = 0.046,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 666 GDLATVKQ----LLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLIS--QGIDVNAKA 719
           GDL ++KQ    L+D  +L   +D     T LH A+ N    V +YL+S  +       A
Sbjct: 23  GDLDSLKQIFSELIDPKLLPSCSDPDTLCTPLHMAAANGHADVARYLLSLLEPAAARDWA 82

Query: 720 GDLEAT---PLHWAARYGYVHIVDCLLNK-GADP 749
               AT    LHWAA  G++ +V  L +   ADP
Sbjct: 83  AAQNATGNSALHWAALNGHLEVVKLLCDDYAADP 116

>Scas_458.3
          Length = 198

 Score = 36.2 bits (82), Expect = 0.048,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 11/97 (11%)

Query: 664 QKGDLATVKQ----LLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGIDVNAKA 719
           + G++ ++++    L+D  +L    D     T LH A+ N  + VV+YL+S   D + + 
Sbjct: 21  RHGEIGSLREIFTTLIDPSLLPTCRDEDTGTTALHMAAGNGHIMVVQYLLSLLPDEDDRK 80

Query: 720 GDLEA------TPLHWAARYGYVHIVDCLLNK-GADP 749
             + A      T LHWA+  G + +V  L ++  ADP
Sbjct: 81  EYVNAVNNTGNTALHWASLNGKLDVVKLLCDEYDADP 117

>KLLA0C09108g complement(795433..796059) similar to sp|P25631
           Saccharomyces cerevisiae YCR051w singleton, start by
           similarity
          Length = 208

 Score = 36.2 bits (82), Expect = 0.049,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 41/104 (39%), Gaps = 33/104 (31%)

Query: 28  LW-AAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRD-------- 78
           +W AA  G++  V   +K G +    DE G+TP+H A   G   +L  L+++        
Sbjct: 3   IWIAASNGETELVEKFIKQGQTANDKDENGYTPIHAAAAYGHIDLLKKLVQEHNGDVNIK 62

Query: 79  ------------------------GADFFLKTNDGKDCFTIAQE 98
                                   GAD  L  N+GK CF + QE
Sbjct: 63  DSDNDTPLHHCEDATTARSLIEQLGADRELLNNEGKTCFQVWQE 106

>CAGL0H00935g 91979..92560 highly similar to sp|P46683 Saccharomyces
           cerevisiae YPL239w YAR1 ankyrin repeat-containing
           protein, start by similarity
          Length = 193

 Score = 36.2 bits (82), Expect = 0.052,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 16/101 (15%)

Query: 664 QKGDLATVKQLLDSGVLD--LNTDLTGD--ITGLHWASINNRLSVVKYLISQGIDVNAKA 719
           + GDL +++++  + +    L T ++ D   T LH A+ N  L VVKY++ Q +  +A A
Sbjct: 21  RAGDLESLQEIFTTLIHPKLLATCVSSDNGSTALHMAAANGHLEVVKYIMEQ-VKQSADA 79

Query: 720 GDLEA----------TPLHWAARYGYVHIVDCLLNK-GADP 749
           G +            T LHWA   G + +V  L ++  ADP
Sbjct: 80  GAVGRYVNLQNKTGNTALHWATLNGKLDVVQYLCDECDADP 120

 Score = 36.2 bits (82), Expect = 0.052,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 11/62 (17%)

Query: 660 HQACQKGDLATVKQLL-------DSGVLDLNTDL---TGDITGLHWASINNRLSVVKYLI 709
           H A   G L  VK ++       D+G +    +L   TG+ T LHWA++N +L VV+YL 
Sbjct: 55  HMAAANGHLEVVKYIMEQVKQSADAGAVGRYVNLQNKTGN-TALHWATLNGKLDVVQYLC 113

Query: 710 SQ 711
            +
Sbjct: 114 DE 115

 Score = 30.0 bits (66), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 46  GASTKIVDEGGFTPLHWATVKGQPYVLTHLIRD-GADFFLKTNDGKD 91
           G    + ++ G T LHWAT+ G+  V+ +L  +  AD F+K   G D
Sbjct: 83  GRYVNLQNKTGNTALHWATLNGKLDVVQYLCDECDADPFVKNEFGHD 129

>ADL142C [1599] [Homologous to ScYGR232W (NAS6) - SH]
           (443625..444314) [690 bp, 229 aa]
          Length = 229

 Score = 35.8 bits (81), Expect = 0.080,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

Query: 660 HQACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQ--GIDVNA 717
           H+AC  GD A    LL      + +        LHWA     + +V+ L+S    +D++ 
Sbjct: 7   HEACMNGDYARAVALLSDNPGLVRSKDADSRYPLHWAVSYQHVKIVELLLSYMLQVDLDT 66

Query: 718 KAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
              D   +P+H AA  G   +   LL     P++
Sbjct: 67  LVDDALWSPVHVAAVVGNRELFGKLLAHAVQPSL 100

>Scas_717.62
          Length = 374

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 292 RSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFM----WFILLTEVGIWFFISLTM 344
           RSH S      + RFDH+C WI   I   N++ F+    WF LL    +W+++++ +
Sbjct: 128 RSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYVGWFNLLL---LWYWLTIAV 181

>Kwal_56.24284
          Length = 198

 Score = 35.0 bits (79), Expect = 0.12,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 46/98 (46%), Gaps = 13/98 (13%)

Query: 664 QKGDLATVK----QLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGID----- 714
           + GDL ++K     L++  ++    D     T LH A+ N    VV+YL S   +     
Sbjct: 21  RSGDLESLKDIFTNLVEPKLVVTCLDAVSKSTPLHMAAANGHTEVVQYLASLIAEPEERK 80

Query: 715 --VNAKAGDLEATPLHWAARYGYVHIVDCLLNK-GADP 749
             VNA+  +   T LHWA+  G V  V  L N+  ADP
Sbjct: 81  KWVNAQ-NETGNTALHWASLNGCVECVKVLCNELEADP 117

>Scas_628.4
          Length = 1057

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 11  KGIIDIDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKG 67
           K   +I   D  GRT L  A  +G S     L++ GA   + D  G+TPLH+A V G
Sbjct: 709 KSSSNISMCDNLGRTLLHLAVLKGYSHLTSQLIQSGARIAVKDIFGYTPLHFACVNG 765

>ABR203W [797] [Homologous to ScYDR459C - SH]
           complement(782702..783781) [1080 bp, 359 aa]
          Length = 359

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 289 KPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 330
           K LR+H S      V R DH+C W+   IG +N++ F  F++
Sbjct: 129 KGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>Scas_587.4
          Length = 751

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 52  VDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIA 96
           +DE G TPLHW T      ++  ++++GA+  L  N G+     A
Sbjct: 268 IDEYGNTPLHWLTSTANIDLVKEMVKNGANRLLGDNSGESALVKA 312

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 705 VKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTMC 752
           +K++++  ++     GD   T L+ AAR G V IVD LL  GADP + 
Sbjct: 395 LKWILTNMLNAQDVNGD---TCLNIAARLGNVGIVDALLEYGADPYIA 439

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 16  IDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHW--ATVKGQPYVLT 73
           ++ QD  G T L  AA  G+   V  LL++GA   I ++ G  PL +   T K Q + L 
Sbjct: 403 LNAQDVNGDTCLNIAARLGNVGIVDALLEYGADPYIANKSGLRPLDFGAGTSKFQTHELE 462

Query: 74  -HLIRDGAD 81
            +L  DGA+
Sbjct: 463 LNLDHDGAN 471

>Kwal_14.889
          Length = 1094

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%)

Query: 20  DPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDG 79
           D  G+T L  A  +G    V  L++ GA     D  GF PLH+A + G   +++ L++  
Sbjct: 731 DEDGQTMLHLACLKGYYNLVSALVRKGARVDAKDSFGFLPLHFACLNGDARIISLLVQCK 790

Query: 80  ADFFLKTNDG 89
           A    +T +G
Sbjct: 791 ATIHAETING 800

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 37  LSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGKDCF 93
           L V+ LL   ++  + DE G T LH A +KG   +++ L+R GA       D KD F
Sbjct: 715 LKVIKLLNSSSNLSMCDEDGQTMLHLACLKGYYNLVSALVRKGARV-----DAKDSF 766

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 16  IDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTP 59
           I+ QD  G +PL +AA   D     LLL+ GA T + +  G TP
Sbjct: 487 INQQDNDGNSPLHYAATNKDDQFYQLLLQNGALTTVQNNSGMTP 530

>Kwal_27.12751
          Length = 1093

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 18  CQDPKGRTPL-LWAAYQGDSLSVMLLLKFGASTKIVDE-GGFTPLHWATVKGQPYVLTHL 75
            +D  G  PL + A   GD+  + LL+K GA    VD   G+TP+ +A  +G    +  L
Sbjct: 503 VRDSHGLCPLHIVAKNGGDAKMIELLIKHGADPNGVDGFNGWTPVFYAVQEGHRNTVEEL 562

Query: 76  IRDGA 80
           +++GA
Sbjct: 563 LKNGA 567

 Score = 33.1 bits (74), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHL 75
           G TP+ +A  +G   +V  LLK GA   I DE   +P  +A  +G   V+  L
Sbjct: 543 GWTPVFYAVQEGHRNTVEELLKNGARLDITDEDNLSPYFYAPWEGHLSVVNLL 595

>ADR151W [1892] [Homologous to ScYMR068W - SH]
           complement(971060..972322) [1263 bp, 420 aa]
          Length = 420

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 39/99 (39%), Gaps = 11/99 (11%)

Query: 16  IDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHL 75
           +  +D  GRTP   A  Q     + LL   GA   + D  G TPLH A +    Y   + 
Sbjct: 102 LASKDVGGRTPAHIACMQDYHTCLSLLSSAGADLSLTDNDGNTPLHIAMM----YNSVNC 157

Query: 76  IR-------DGADFFLKTNDGKDCFTIAQEMNTSHSFKD 107
           IR          D+  K ND      +A  M T   F++
Sbjct: 158 IRLLVLGSLSEEDYLRKNNDNWKPEQLAGTMETQRVFQN 196

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 1/80 (1%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLK-FGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDGAD 81
           G T +  A   G   +  +LL+ F  +    D GG TP H A ++     L+ L   GAD
Sbjct: 75  GSTSVHLALKNGHEQTTHVLLQSFPQTLASKDVGGRTPAHIACMQDYHTCLSLLSSAGAD 134

Query: 82  FFLKTNDGKDCFTIAQEMNT 101
             L  NDG     IA   N+
Sbjct: 135 LSLTDNDGNTPLHIAMMYNS 154

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member of
           the glycerophosphoryl diester phosphodiesterase family,
           contains six ankyrin (Ank) repeats and a SYG1, Pho81 and
           XPR1 (SPX) N-terminal domain, has weak similarity to S.
           cerevisiae Pho81p, which is a cyclin-dependent kinase
           (CDK) inhibitor [3672 bp, 1223 aa]
          Length = 1223

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHL-IRD 78
           G T +  AA +G +  V LL+   A+  I DEGG+TP+  A ++G  ++   + IRD
Sbjct: 573 GWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIRD 629

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 670 TVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLIS-QGIDVNAKAGDLEATPLH 728
           T + LL S  LD N  L    + LH A+  N   ++  L+S +  D+N +  +L  TPL+
Sbjct: 488 TTEVLLQS--LDPNVKLKSS-SLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLY 544

Query: 729 WAARYGYVHIVDCLLNKGAD 748
            A R  +     CLL  GAD
Sbjct: 545 LACRLNFFEAAVCLLYNGAD 564

>KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces
           cerevisiae YGR233c PHO81 cyclin-dependent kinase
           inhibitor singleton, start by similarity
          Length = 1148

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 8   VVAKGIIDID-CQDPKGRTPL-LWAAYQGDSLSVMLLLKFGASTKIVDEGGFT---PLHW 62
           ++ KG I++   +D +G  PL + A   G S  + LL+ +GA    +D  GF    P+ +
Sbjct: 520 ILEKGDINLSRLRDSQGLCPLHIVAKMGGGSELIKLLVSYGADPDEID--GFNKWPPIFY 577

Query: 63  ATVKGQPYVLTHLIRDGADFFLK 85
           A  +G    +  L+  GAD F+K
Sbjct: 578 AIQEGHATTVQVLLELGADVFMK 600

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 44/94 (46%), Gaps = 9/94 (9%)

Query: 660 HQACQKGDLATVKQLLDSGVLDLNTDLTGDI--TGLHWASINNRLSVVKYLISQGIDVNA 717
           H AC+ G    V  L+++ ++D N DL  +   T L  + INN + V K LI+QG +VN 
Sbjct: 433 HYACELGKTNFVSLLINTELID-NIDLLDNTSKTPLVLSIINNHIEVTKILIAQG-NVNL 490

Query: 718 KAGDLEAT-----PLHWAARYGYVHIVDCLLNKG 746
                E T     PL+ A           +L KG
Sbjct: 491 SPSLCEGTKPQFHPLNVACSNKNYEAAKVILEKG 524

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 9/101 (8%)

Query: 658 QYHQ---ACQKGDLATVKQLLDSGVLDLNTDLTGDITGL---HW-ASINNRLSVVKYLIS 710
           Q+H    AC   +    K +L+ G  D+N     D  GL   H  A +     ++K L+S
Sbjct: 501 QFHPLNVACSNKNYEAAKVILEKG--DINLSRLRDSQGLCPLHIVAKMGGGSELIKLLVS 558

Query: 711 QGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTM 751
            G D +   G  +  P+ +A + G+   V  LL  GAD  M
Sbjct: 559 YGADPDEIDGFNKWPPIFYAIQEGHATTVQVLLELGADVFM 599

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 20  DPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYV------LT 73
           DP+G T   WA   G+      L   GAST+ V+  G TPL  +++    Y       + 
Sbjct: 353 DPEGHTAFHWACAMGNIAIAEALYNVGASTRSVNTLGETPLMRSSIFHNSYTKRTYPKIC 412

Query: 74  HLIRD 78
           HL++D
Sbjct: 413 HLLQD 417

>Scas_415.1
          Length = 452

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 1/90 (1%)

Query: 22  KGRTPLLWAAYQGDSLSVMLLLK-FGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDGA 80
           KG T +  A   G   +  LLL+ F        E G TP+H+A +      L+ LI  GA
Sbjct: 285 KGNTCVHLALINGHEQTTHLLLQHFPRFINEKGEHGRTPVHFACMYDHFQCLSLLIGVGA 344

Query: 81  DFFLKTNDGKDCFTIAQEMNTSHSFKDALS 110
           +  +K  DG+    I  E +  H  K  LS
Sbjct: 345 NLTIKDEDGETPLHICLEYSRIHCMKILLS 374

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%)

Query: 16  IDCQDPKGRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHL 75
           I+ +   GRTP+ +A        + LL+  GA+  I DE G TPLH      + + +  L
Sbjct: 313 INEKGEHGRTPVHFACMYDHFQCLSLLIGVGANLTIKDEDGETPLHICLEYSRIHCMKIL 372

Query: 76  IRDGADFFLKTNDGKD 91
           + +G        DG +
Sbjct: 373 LSEGQLDSANIKDGNN 388

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 25  TPLLWAAYQGDSLSVMLLLKFGAS--TKIVDEGGFTPLHWATVKGQPYVLTHLIRDGADF 82
           T L  A  +G+ L V  LL+      T I    G++ LH+A   G+  +  HLI+ G D 
Sbjct: 218 TRLRDAIIEGNLLIVKRLLRRHPELLTNINPANGWSSLHYAAYHGRYLICVHLIQLGHDK 277

Query: 83  --FLKTNDGKDCFTIA 96
              +KT  G  C  +A
Sbjct: 278 HEIIKTFKGNTCVHLA 293

>AAR063C [249] [Homologous to ScYCR051W - SH] (453099..453761) [663
           bp, 220 aa]
          Length = 220

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 28  LWAAYQGDSLSVM---LLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRD-GADFF 83
           +W A   D L+     LL + GA   + D  G+TP+H A   G   +L  LI +   D  
Sbjct: 3   VWVA-ASDGLTAQVEELLQQTGADANVKDPNGYTPMHAAAAYGHIDLLRLLIANYRGDVN 61

Query: 84  LKTNDGKDCFTIAQEMNT 101
           ++ NDG      A+++ T
Sbjct: 62  VRDNDGDTPLHHAEDLQT 79

 Score = 33.1 bits (74), Expect = 0.57,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 15  DIDCQDPKGRTPLLWAAYQGD-SLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLT 73
           D + +DP G TP+  AA  G   L  +L+  +     + D  G TPLH A       VL 
Sbjct: 25  DANVKDPNGYTPMHAAAAYGHIDLLRLLIANYRGDVNVRDNDGDTPLHHAEDLQTVRVLV 84

Query: 74  HLIRDGADFFLKTNDGKDCFTIAQE 98
             +  GAD  L   DG     + ++
Sbjct: 85  EEL--GADPSLLNADGNTPLAVYED 107

>CAGL0B01166g 103561..105987 similar to sp|P09959 Saccharomyces
           cerevisiae YLR182w SWI6 transcription factor,
           hypothetical start
          Length = 808

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 705 VKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTMC 752
           +K+ I+  ++     GD   T L+ AAR G V I+D LL+ GADP + 
Sbjct: 465 LKWFINNLLNAQDSNGD---TCLNIAARLGNVSIIDALLDYGADPVIS 509

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%)

Query: 52  VDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFTIA 96
            DE G TPLHW T      ++  L++ GA   L  N G+     A
Sbjct: 339 ADEHGNTPLHWLTSIANIDLVKELVKHGASRLLGDNAGESALVKA 383

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIR 77
           G TP+  AA +G +  V +L + GA+   +DE G++P+  A ++G    +T L+R
Sbjct: 606 GWTPIFVAATEGFTDLVKVLKEHGANYDALDESGWSPMEHAALRGH-LEITDLLR 659

>YDR126W (SWF1) [973] chr4 (703228..704238) Protein involved in
           vacuolar trafficking and secretion, required to maintain
           wild-type abundance of polarized actin cables, possibly
           required for full induction of IME1 during early meiosis
           [1011 bp, 336 aa]
          Length = 336

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%)

Query: 282 CLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 330
           C    I KP RS   ++    V   DH C WI N IG  N+  F  F++
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184

>CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces
           cerevisiae YCR051w, hypothetical start
          Length = 206

 Score = 33.1 bits (74), Expect = 0.58,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 17  DCQDPKGRTPLLWAAYQGD-SLSVMLLLKFGASTKIVDEGGFTPLHWAT-VKGQPYVLTH 74
           + +DP G TP+  AA  G   L   L  + G    + D  G TPLH    V+    ++  
Sbjct: 26  NSKDPNGYTPVHAAAAYGHLDLLRKLCQEHGGDINVRDSDGDTPLHHCEDVRVAQLIVEE 85

Query: 75  LIRDGADFFLKTNDGKDCFTIAQE 98
           L   G D+ L  ++GK    + +E
Sbjct: 86  L---GGDYTLTNDEGKTALQVFEE 106

 Score = 29.3 bits (64), Expect = 9.9,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 28 LW-AAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRD-GADFFLK 85
          +W AA  G    V   L  G S    D  G+TP+H A   G   +L  L ++ G D  ++
Sbjct: 3  IWIAASDGRGDIVEKFLADGLSANSKDPNGYTPVHAAAAYGHLDLLRKLCQEHGGDINVR 62

Query: 86 TNDG 89
           +DG
Sbjct: 63 DSDG 66

>YGR233C (PHO81) [2181] chr7 complement(954675..958211)
           Cyclin-dependent kinase (CDK) inhibitor for
           Pho80p-Pho85p cyclin-dependent protein kinase complex,
           positive regulator of phosphate pathway [3537 bp, 1178
           aa]
          Length = 1178

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 25  TPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIR 77
           TP+ +A   G S  +  LLK  A   I D+ G +PL +A  +    VL  L++
Sbjct: 594 TPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQ 646

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 30  AAYQGDSLSVMLLLKFGASTKIVDEGGF---TPLHWATVKGQPYVLTHLIRDGADFFLKT 86
           A   GD   + LL+++GA    +D  GF   TP+ +A   G   V+T L++  A   ++ 
Sbjct: 565 AKIGGDPQLIQLLIRYGADPNEID--GFNKWTPIFYAVRSGHSEVITELLKHNARLDIED 622

Query: 87  NDG 89
           ++G
Sbjct: 623 DNG 625

>Kwal_33.13259
          Length = 664

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (48%)

Query: 52  VDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGK 90
           +DE G TPLHW        +   LIR GAD  L    G+
Sbjct: 217 IDEHGNTPLHWLCSIANVNLTKDLIRSGADRLLGDTSGE 255

>YMR068W (AVO2) [4027] chr13 (406303..407583) Component of the TOR
          complex 2 (Tor2p-Lst8p-Kog1p-Avo1p-Avo2p-Tsc11p), which
          is involved in signaling to the actin cytoskeleton
          [1281 bp, 426 aa]
          Length = 426

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 27 LLWAAYQGDSLSVMLLLKFGAS--TKIVDEGGFTPLHWATVKGQPYVLTHLIRDGADF-- 82
          L  A  +G+ L V  LL+      T I  E G++ LH+A+  G+  +  +LI+ G D   
Sbjct: 9  LREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHE 68

Query: 83 FLKTNDGKDCFTIA 96
           +KT  G  C  +A
Sbjct: 69 LIKTFKGNTCVHLA 82

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 5/89 (5%)

Query: 660 HQACQKGDLATVKQLLDSGVLDLNTDLTGDITGLHWASINNRLSVVKYLISQGID--VNA 717
           H A  KG   T+  LL      +N         +H A +N+    +  LI  G D  V  
Sbjct: 80  HLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMD 139

Query: 718 KAGDLEATPLHWAARYGYVHIVDCLLNKG 746
             GD   TPLH    YG +  +  LLN+G
Sbjct: 140 TNGD---TPLHVCLEYGSISCMKMLLNEG 165

>CAGL0F06655g 654908..656134 similar to sp|Q04749 Saccharomyces
           cerevisiae YMR068w, start by similarity
          Length = 408

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 1/116 (0%)

Query: 22  KGRTPLLWAAYQGDSLSVMLLLK-FGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRDGA 80
           KG T +  A   G   +  LLL+ F        E G TP H A +      L+ LI  GA
Sbjct: 74  KGNTCVHLALMNGHEQTTHLLLQHFPRFINKAGELGRTPTHIACIHDYYQCLSLLIGVGA 133

Query: 81  DFFLKTNDGKDCFTIAQEMNTSHSFKDALSICGFNQDGYPKRKLFKKSDHAKVITF 136
           +  +K + G     +  E  +++  K  ++    + D       ++ SD AK +  
Sbjct: 134 NLMMKDDKGNTPLHLCLEFGSTNCMKMLVNEIQISDDSIRNNDNWRPSDVAKTVEL 189

>Scas_649.8
          Length = 373

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 20 DPKGRTPLLWAAYQGDSLSVMLLLKFGAST--KIVDEGGFTPLHWATVKGQPYVLTHLIR 77
          DP+ R  L  A  +G  L V  LL+   +    I    G++ LH+A+  G+  +  HLI+
Sbjct: 4  DPETR--LREAIIEGKLLIVKRLLRRYPNILHNIDCRNGWSSLHYASFHGRYLICVHLIQ 61

Query: 78 DGADFFLKTNDGKDCFTIA 96
           G +  ++T  G  C  +A
Sbjct: 62 LGHECTIRTFKGNSCIHLA 80

>KLLA0F26004g complement(2411261..2412271) some similarities with
          sp|Q04749 Saccharomyces cerevisiae YMR068w singleton,
          hypothetical start
          Length = 336

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 21 PKGRTPLLWAAYQGDSLSVMLLLKFGAS--TKIVDEGGFTPLHWATVKGQPYVLTHLIRD 78
          P+ R  L  A  QG    V  +LK        I    G++ LH+A   G+  +  HLI+ 
Sbjct: 3  PEPRIRLREAIVQGKLGVVRRILKRWPDLLENIDSTNGWSSLHYAAFYGRYLICRHLIQL 62

Query: 79 GAD--FFLKTNDGKDCFTIA 96
          G D    LKT DG  C  +A
Sbjct: 63 GHDATAMLKTYDGDTCIHLA 82

>Scas_720.79
          Length = 230

 Score = 32.0 bits (71), Expect = 1.5,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 5/84 (5%)

Query: 17  DCQDPKGRTPL-LWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWAT-VKGQPYVLTH 74
           + +DP G TP+   AAY    L  +L   +     + D  G TPLH    ++    ++  
Sbjct: 43  NSKDPNGYTPIHAAAAYGHKDLLRLLCSTYNGDVNVRDSDGDTPLHHCEDLETATMIIEE 102

Query: 75  LIRDGADFFLKTNDGKDCFTIAQE 98
           L     DF +  N+GK      +E
Sbjct: 103 L---NGDFTIANNEGKTALQTFEE 123

>KLLA0C01826g 144307..146532 gi|730856|sp|P40418|SWI6_KLULA
           Kluyveromyces lactis Regulatory protein SWI6 (Cell-cycle
           box factor, chain SWI6) (Trans-acting activator of HO
           endonuclease gene) (MBF subunit P90), start by
           similarity
          Length = 741

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 705 VKYLISQGIDVNAKAGDLEATPLHWAARYGYVHIVDCLLNKGADPTMC 752
           ++++I+  ++     GD   T L+ AAR G V IV+ LL+ GADP + 
Sbjct: 408 LQWVITHLLNARDSNGD---TCLNIAARLGNVAIVEALLDYGADPNIA 452

>CAGL0B01991g 182894..183886 similar to sp|Q04629 Saccharomyces
           cerevisiae YDR126w, hypothetical start
          Length = 330

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 289 KPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFI 329
           KP RS   T+    +   DH C WI N +G+ N+  F  F+
Sbjct: 143 KPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL 183

>AGR065W [4375] [Homologous to ScYDR126W (PSL10) - SH]
           complement(835877..836857) [981 bp, 326 aa]
          Length = 326

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%)

Query: 282 CLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNF 325
           C    +RKP RS    +    V   DH C W+ N +G  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_14.982
          Length = 416

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%)

Query: 23  GRTPLLWAAYQGDSLSVMLLLKFGASTKIVDEGGFTPLHWATVKGQPYVLTHLIRD 78
           GRTP+           + LLL  GA   + DE G T LH   + G    +  L+R+
Sbjct: 109 GRTPVQMTCQYDHYQCLSLLLGLGADLSVRDEFGNTALHICLIYGSENCMRMLVRE 164

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%)

Query: 52  VDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFT 94
           +D+ G TPLHWAT      ++  LI   A+       G +C T
Sbjct: 517 IDDQGHTPLHWATAMANIPLIKMLITLNANALQCNKLGFNCIT 559

>Scas_510.2
          Length = 1043

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%)

Query: 52  VDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFT 94
           +DE G TPLHWAT      ++  LI   A+     + G +C T
Sbjct: 521 IDEQGHTPLHWATAMANVPLIKLLIILNANALQCNSLGFNCVT 563

>Scas_693.32
          Length = 329

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%)

Query: 289 KPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 330
           KP RS   ++    V   DH C W+ N +G  N+  F  F++
Sbjct: 144 KPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLI 185

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 51  IVDEGGFTPLHWATVKGQPYVLTHLIRDGADFFLKTNDGKDCFT 94
           I+D+ G T LHWA       ++  L+   AD F   + G +C T
Sbjct: 444 IIDKQGHTSLHWAAAMANIPLIKILLTLEADIFHCNDKGFNCIT 487

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.140    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,272,412
Number of extensions: 1126231
Number of successful extensions: 3633
Number of sequences better than 10.0: 116
Number of HSP's gapped: 3599
Number of HSP's successfully gapped: 200
Length of query: 752
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 643
Effective length of database: 12,822,747
Effective search space: 8245026321
Effective search space used: 8245026321
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)