Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_533.41961968281e-114
CAGL0J00957g1971977791e-107
Sklu_1938.51961967751e-106
YLR009W (RLP24)1991997651e-104
KLLA0E09416g1981987391e-100
ADR346W1971977234e-98
Kwal_33.152991961966904e-93
YGR148C (RPL24B)155571607e-14
YGL031C (RPL24A)155571582e-13
Sklu_1642.2149571553e-13
Kwal_14.2299155571545e-13
CAGL0A01562g155571521e-12
KLLA0E10857g155571484e-12
AFR477C155571475e-12
Scas_648.9155571422e-11
Scas_4.166521337e-11
CAGL0L12584g29489651.5
KLLA0C11055g54864642.0
Sklu_1742.468555599.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_533.4
         (196 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_533.4                                                            323   e-114
CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomy...   304   e-107
Sklu_1938.5 YLR009W, Contig c1938 7059-7649                           303   e-106
YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal...   299   e-104
KLLA0E09416g complement(836948..837544) similar to sgd|S0003999 ...   289   e-100
ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH] complement...   283   4e-98
Kwal_33.15299                                                         270   4e-93
YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosoma...    66   7e-14
YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosoma...    65   2e-13
Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement         64   3e-13
Kwal_14.2299                                                           64   5e-13
CAGL0A01562g 152953..153420 highly similar to sp|P24000 Saccharo...    63   1e-12
KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA Kluyv...    62   4e-12
AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C...    61   5e-12
Scas_648.9                                                             59   2e-11
Scas_4.1                                                               56   7e-11
CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080 S...    30   1.5  
KLLA0C11055g complement(950647..952293) similar to sp|P38775 Sac...    29   2.0  
Sklu_1742.4 YGL145W, Contig c1742 3577-5634                            27   9.2  

>Scas_533.4
          Length = 196

 Score =  323 bits (828), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 164/196 (83%), Positives = 164/196 (83%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120
           KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120

Query: 121 LRDKKLVEANPELLRMREVEIANKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDKKLVEANPELLRMREVEIANKLA                                KQ
Sbjct: 121 LRDKKLVEANPELLRMREVEIANKLAREQERAEMVSEEEEEEEEMDIDSEEEEEEQLEKQ 180

Query: 181 KILLKNKKRNSKKIAF 196
           KILLKNKKRNSKKIAF
Sbjct: 181 KILLKNKKRNSKKIAF 196

>CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomyces
           cerevisiae YLR009w, start by similarity
          Length = 197

 Score =  304 bits (779), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 161/197 (81%), Gaps = 1/197 (0%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ATTLKAMSRIEEIR KRERAFYKNRM+GN ERDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120

Query: 121 LRDKKLVEANPELLRMREVEIANKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XK 179
           LRDKKLVE NPELLR+REVEIAN+LA                                 K
Sbjct: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAAEEVSEEESEEEEDMEVDSEEEEEEKLQK 180

Query: 180 QKILLKNKKRNSKKIAF 196
           QKILLKNKKRN+KK+AF
Sbjct: 181 QKILLKNKKRNAKKLAF 197

>Sklu_1938.5 YLR009W, Contig c1938 7059-7649
          Length = 196

 Score =  303 bits (775), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 150/196 (76%), Positives = 160/196 (81%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSPVYP HGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ATTLKAMSRIEEIR +RERAFYKNRMRGNKER+F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKKLVEANPELLRMREVEIANKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDK LVE+NPELL++REVEIANKLA                                KQ
Sbjct: 121 LRDKSLVESNPELLKVREVEIANKLASKEAEEQDEEMDVDSEEEIDVESEEESEEEQEKQ 180

Query: 181 KILLKNKKRNSKKIAF 196
           K+LLKNK++NSKKIAF
Sbjct: 181 KVLLKNKRKNSKKIAF 196

>YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal
           protein with similarity to ribosomal protein L24 [600
           bp, 199 aa]
          Length = 199

 Score =  299 bits (765), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 161/199 (80%), Gaps = 3/199 (1%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ATTLKAM+RIEEIR KRERAFYKNRMRGNKE+DF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120

Query: 121 LRDKKLVEANPELLRMREVEIANKLAXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXX 177
           LRDKKLVE+NPELLR+REVEIA KLA                                  
Sbjct: 121 LRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQL 180

Query: 178 XKQKILLKNKKRNSKKIAF 196
            KQKILLKN++RN+KKIAF
Sbjct: 181 EKQKILLKNRRRNTKKIAF 199

>KLLA0E09416g complement(836948..837544) similar to sgd|S0003999
           Saccharomyces cerevisiae YLR009w, start by similarity
          Length = 198

 Score =  289 bits (739), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/198 (72%), Positives = 157/198 (79%), Gaps = 2/198 (1%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60
           MR+Y CHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYACHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ATTLKAMSRIEEIR +RERAFYKNRM+GN ERDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMKGNNERDF 120

Query: 121 LRDKKLVEANPELLRMREVEIANKLAXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXX 178
           LRDK LVE+NPELLR+REVE+A + A                                  
Sbjct: 121 LRDKALVESNPELLRLREVELARQAAKEEAIEQASDEEMDIESEAESEVESESEAEEQLQ 180

Query: 179 KQKILLKNKKRNSKKIAF 196
           KQKILLKNK++NSK+IAF
Sbjct: 181 KQKILLKNKRKNSKRIAF 198

>ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH]
           complement(1316666..1317259) [594 bp, 197 aa]
          Length = 197

 Score =  283 bits (723), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 143/197 (72%), Positives = 156/197 (79%), Gaps = 1/197 (0%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ TTLKAM+RIEEIR KRERAFYKNRM+GN E+DF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVETTLKAMTRIEEIRQKRERAFYKNRMKGNTEKDF 120

Query: 121 LRDKKLVEANPELLRMREVEIANKLA-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK 179
           LRDKKLVE+NPELL+MREVE+  +                                   +
Sbjct: 121 LRDKKLVESNPELLKMREVELQRQAERAAAGVDEDAEMGDSDEEMEDASEEESEEEEQQQ 180

Query: 180 QKILLKNKKRNSKKIAF 196
           QKI+LKNKKR++KKIAF
Sbjct: 181 QKIVLKNKKRSAKKIAF 197

>Kwal_33.15299
          Length = 196

 Score =  270 bits (690), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 152/196 (77%)

Query: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60
           MR+Y CHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120
           KELAVDSTL FAQRRNVPVRYNREL+ATTL+AM+R+EEIR +RERAFYKNRMRGNKER+F
Sbjct: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKKLVEANPELLRMREVEIANKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQ 180
           LRDK+LVE NPELL++R+VE+    A                                KQ
Sbjct: 121 LRDKQLVERNPELLKVRDVELDRAEARAAAREAESEEEMDVDSEAESESEQESEAEREKQ 180

Query: 181 KILLKNKKRNSKKIAF 196
            ++L  K++N+KK+AF
Sbjct: 181 AVVLTTKRKNTKKLAF 196

>YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosomal
          protein L24B (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Ap [468 bp, 155 aa]
          Length = 155

 Score = 66.2 bits (160), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosomal
          protein L24A (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Bp [468 bp, 155 aa]
          Length = 155

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement
          Length = 149

 Score = 64.3 bits (155), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPRK+ WT  +R+
Sbjct: 1  MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRKIAWTVLYRR 57

>Kwal_14.2299
          Length = 155

 Score = 63.9 bits (154), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSSSLFKQRKNPRRIAWTVLYRR 57

>CAGL0A01562g 152953..153420 highly similar to sp|P24000
          Saccharomyces cerevisiae YGR148c RPL30B or sp|P04449
          Saccharomyces cerevisiae YGL031c RPL30A, start by
          similarity
          Length = 155

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRVAWTVLYRR 57

>KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA
          Kluyveromyces lactis 60S RIBOSOMAL PROTEIN L24 (L30),
          start by similarity
          Length = 155

 Score = 61.6 bits (148), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRR 57

>AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C
          (RPL24B) - SH] (1296295..1296762) [468 bp, 155 aa]
          Length = 155

 Score = 61.2 bits (147), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKVFRFHSSKSASLFHQRKNPRRIAWTVLYRR 57

>Scas_648.9
          Length = 155

 Score = 59.3 bits (142), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK 57
          M++    F  + +YPG G +F+R D+K FRF  SK    F QR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWTVLYRR 57

>Scas_4.1
          Length = 66

 Score = 55.8 bits (133), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 1  MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWT 52
          M++    F  + +YPG G +F+R D+K FRF  SK    F QR+NPR++ WT
Sbjct: 3  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWT 54

>CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080
           Saccharomyces cerevisiae YPL039w, hypothetical start
          Length = 294

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 11/89 (12%)

Query: 20  MFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRK--AAGKELA---------VDST 68
           + +R   ++++  R K  K  ++ R+PR ++ T    +  A   +LA         + ST
Sbjct: 153 ILIRRSREQYKAIRYKQMKDARRERDPRIIQLTNDMNEDTATMSDLALHNFLEPFDITST 212

Query: 69  LTFAQRRNVPVRYNRELMATTLKAMSRIE 97
            TF +R N+       L A+ +  MSR +
Sbjct: 213 FTFTKRNNIGTSAPASLGASMMLNMSRTD 241

>KLLA0C11055g complement(950647..952293) similar to sp|P38775
           Saccharomyces cerevisiae YHR045w hypothetical protein
           singleton, start by similarity
          Length = 548

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 49  LKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFY 108
           + W    +      + V ST+ F    +V +   R+L   +L A S +E +R + E A Y
Sbjct: 2   VDWITFSKYLVAILVIVASTVWFIN--SVIIDSKRDLHTISLNAQSNVESVRKEHETAIY 59

Query: 109 KNRM 112
           +N +
Sbjct: 60  RNLL 63

>Sklu_1742.4 YGL145W, Contig c1742 3577-5634
          Length = 685

 Score = 27.3 bits (59), Expect = 9.2,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 96  IEEIRVKRERAFYKNRMRGNKERDFLR-----DKKLVEANPELLRMREVEIANKL 145
           I ++  +RER   + R + N+E DFL      D  LV  + E+ +++ VE   KL
Sbjct: 29  IGQVNNQRERLALQLRTKKNEEEDFLEHFVLMDVTLVTISEEISKVKSVEDIKKL 83

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,941,792
Number of extensions: 165945
Number of successful extensions: 582
Number of sequences better than 10.0: 30
Number of HSP's gapped: 576
Number of HSP's successfully gapped: 32
Length of query: 196
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 100
Effective length of database: 13,272,781
Effective search space: 1327278100
Effective search space used: 1327278100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)