Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_506.674274235280.0
Sklu_1665.16997338961e-110
Kwal_27.113017006818234e-99
CAGL0M04455g7117596801e-78
KLLA0D16918g6826735731e-63
AGL167C7276784421e-45
YLR139C (SLS1)6437014363e-45
Kwal_33.15339118483703.0
Scas_635.644052684.0
CAGL0D00286g73377684.7
Scas_660.30774116677.4
Scas_538.4d53196667.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_506.6
         (742 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_506.6                                                           1363   0.0  
Sklu_1665.1 YLR139C, Contig c1665 672-2771                            349   e-110
Kwal_27.11301                                                         321   4e-99
CAGL0M04455g complement(489048..491183) weakly similar to sp|P42...   266   1e-78
KLLA0D16918g complement(1432797..1434845) weakly similar to sp|P...   225   1e-63
AGL167C [4145] [Homologous to ScYLR139C (SLS1) - SH] (382880..38...   174   1e-45
YLR139C (SLS1) [3549] chr12 complement(421543..423474) Protein i...   172   3e-45
Kwal_33.15339                                                          32   3.0  
Scas_635.6                                                             31   4.0  
CAGL0D00286g 37583..39784 weakly similar to DEHA0D08195g Debaryo...    31   4.7  
Scas_660.30                                                            30   7.4  
Scas_538.4d                                                            30   7.9  

>Scas_506.6
          Length = 742

 Score = 1363 bits (3528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/742 (90%), Positives = 675/742 (90%)

Query: 1   MEYHQYQLKHYSNCLSPYYKKQAIMLPMLSRFVLPSKRVALSHYKCTFINSRRLYSHXXX 60
           MEYHQYQLKHYSNCLSPYYKKQAIMLPMLSRFVLPSKRVALSHYKCTFINSRRLYSH   
Sbjct: 1   MEYHQYQLKHYSNCLSPYYKKQAIMLPMLSRFVLPSKRVALSHYKCTFINSRRLYSHTEE 60

Query: 61  XXXXXXXXXXXXDGEHAITRGKKLKPSKAKIVVLNHQEAGLFKNRQQPHFQSRTTQNPLF 120
                       DGEHAITRGKKLKPSKAKIVVLNHQEAGLFKNRQQPHFQSRTTQNPLF
Sbjct: 61  QQQDQTVTEIEEDGEHAITRGKKLKPSKAKIVVLNHQEAGLFKNRQQPHFQSRTTQNPLF 120

Query: 121 KGIFDLDVDSDMTLKELTQRPNKSNLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPIT 180
           KGIFDLDVDSDMTLKELTQRPNKSNLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPIT
Sbjct: 121 KGIFDLDVDSDMTLKELTQRPNKSNLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPIT 180

Query: 181 ETISHYEYINLVEKLKGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKIVTN 240
           ETISHYEYINLVEKLKGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKIVTN
Sbjct: 181 ETISHYEYINLVEKLKGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKIVTN 240

Query: 241 GDDGSLQSNSIEQVXXXXXXXXXXXXYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGL 300
           GDDGSLQSNSIEQV            YEILTMDLQNTEITLLLFTQRGKLLQNLTRINGL
Sbjct: 241 GDDGSLQSNSIEQVSATTNTSTASSSYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGL 300

Query: 301 TIAFPLDENKIIIKAATRGVARYVEVSIRKILSNVINEFVNIDHLLQGMSSTLNLKDLIN 360
           TIAFPLDENKIIIKAATRGVARYVEVSIRKILSNVINEFVNIDHLLQGMSSTLNLKDLIN
Sbjct: 301 TIAFPLDENKIIIKAATRGVARYVEVSIRKILSNVINEFVNIDHLLQGMSSTLNLKDLIN 360

Query: 361 LIESHTDTVFEKIEXXXXXXXXXKTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQIL 420
           LIESHTDTVFEKIE         KTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQIL
Sbjct: 361 LIESHTDTVFEKIENDNNGNTNNKTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQIL 420

Query: 421 AVLPSSLNGNTNNLKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQEPLTLSITN 480
           AVLPSSLNGNTNNLKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQEPLTLSITN
Sbjct: 421 AVLPSSLNGNTNNLKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQEPLTLSITN 480

Query: 481 MDSIYQMFAPQQEDSQEKSMYSMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYDS 540
           MDSIYQMFAPQQEDSQEKSMYSMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYDS
Sbjct: 481 MDSIYQMFAPQQEDSQEKSMYSMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYDS 540

Query: 541 SLTQDELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRCI 600
           SLTQDELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRCI
Sbjct: 541 SLTQDELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRCI 600

Query: 601 AQLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKTXXXXXXXXXXXXXXXXXXFLT 660
           AQLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKT                  FLT
Sbjct: 601 AQLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKTSSSSSSSSSSSSSSSSSSFLT 660

Query: 661 SQDGINQFLKNSTLNFQTXXXXXXXXXXXXXSMNVNISKNPTSKTQMVNYKYLITHHHSV 720
           SQDGINQFLKNSTLNFQT             SMNVNISKNPTSKTQMVNYKYLITHHHSV
Sbjct: 661 SQDGINQFLKNSTLNFQTNNKDKKNKLLLPNSMNVNISKNPTSKTQMVNYKYLITHHHSV 720

Query: 721 LRLKYLDKYMVQFSDINAGSLC 742
           LRLKYLDKYMVQFSDINAGSLC
Sbjct: 721 LRLKYLDKYMVQFSDINAGSLC 742

>Sklu_1665.1 YLR139C, Contig c1665 672-2771
          Length = 699

 Score =  349 bits (896), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 242/733 (33%), Positives = 377/733 (51%), Gaps = 96/733 (13%)

Query: 30  SRFVLPSKRVALSH---YKCTFINSRRLYSHXXXXXXXXXXXXXXXDGEHAI-TRGKKLK 85
           SR +LP   V  +H      ++++ RRLYS                DG     TRGKKLK
Sbjct: 7   SRLILPVS-VTTNHIFNLAPSYLSHRRLYS---TQDDIEDQENSTPDGSKLTSTRGKKLK 62

Query: 86  PSKAKIVVLNHQEAGLFKNRQQP-HFQSRTTQNPLFKGIFDLDVDSDMTLKELTQRPNKS 144
           P+KAKIVVL+ ++AGLFK ++ P +F+    +N     +  +++      K ++   N S
Sbjct: 63  PTKAKIVVLSPKQAGLFKKKRTPGYFKQNEKRNERLTVLEGVELG-----KSVSNSTNSS 117

Query: 145 NLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPITETISHYEYINLVEKLKGSYTLPQL 204
           ++LQ+IE+Q  KLLV K +V   QVIQSI   RP    +S   Y  L   L+ +YTLPQL
Sbjct: 118 DILQQIENQRRKLLVFKGSVPKEQVIQSIHDLRPTGTQVSSKRYEQLKSLLESAYTLPQL 177

Query: 205 RSYTKQNFNLSL-PHVTKSKLIERIILKMWNCKIVTNGDDGSLQSNS---IEQVXXXXXX 260
           R Y  Q +  S+     K  LI RI+ ++W C+I     D S+       +E++      
Sbjct: 178 RDYVAQYYKTSVVKSAPKKVLIPRIMNRLWGCQI-----DESISEAEDLIVERI------ 226

Query: 261 XXXXXXYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGLTIAFPLDENKIIIKAATRGV 320
                      +DL+  +I LLL T  GK+L N  R+ G T+A  L+ENKII++A T  +
Sbjct: 227 -----------IDLETKDIYLLLLTNNGKILYNFARV-GATLAVVLNENKIIVRA-TSAM 273

Query: 321 ARYVEVSIRKILSNVINEFVNIDHLLQGMSS-----TLNLKDLINLIESHTDTVFEKIEX 375
            +YVEVS+RKILSN+ +E + +  ++   +S     TL   ++I+L++  +   FE++  
Sbjct: 274 VKYVEVSLRKILSNMQSEVLPVRDIISNHTSLNSNATLTPGEVISLVQKESAAYFEEM-- 331

Query: 376 XXXXXXXXKTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQILAVLPSSLNGNTNNLK 435
                      + ++AFG +R+  AK LL+W    +     E +        N   ++ K
Sbjct: 332 -----LDEDGTYTLTAFGDKRVNHAKNLLLWAMNYNPQRVEEHVFCG-----NEERSSYK 381

Query: 436 KYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQE--PLTLSITNMDSIYQMFAPQQE 493
            YP+ +I+  DWL    EW R Q P+ K       ++     +S   +D +Y  F  +  
Sbjct: 382 LYPFTNIECLDWLESAKEWYRFQRPVSKKMAKDFDEKINKFEMSDKKVDELYNFFTKENR 441

Query: 494 DS-------QEKSMYSMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYDSSLTQDE 546
           ++        +  + S++LG  L   +N ++I  FQPKIPQ+  RLL LPLYDS  T DE
Sbjct: 442 NNIATIDSLGDSKVLSITLGQVLITATNKESI--FQPKIPQITPRLLELPLYDSMATMDE 499

Query: 547 LFSIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRCIAQLNKK 606
           L+++D+HEYY+QLKFIP+    ++ +S    PP+ELWFELD+    I  S+R +  L ++
Sbjct: 500 LYTVDQHEYYIQLKFIPDL---STTNSGKNIPPLELWFELDDYDKAITSSVRSVVHLEER 556

Query: 607 SMILQTPTAPFDYAINMESYIDLLEPTATTLKTXXXXXXXXXXXXXXXXXXFLTSQDGIN 666
           ++ LQTP    D+ INM+   +L+ P     +                   +L  Q G+ 
Sbjct: 557 NVYLQTPQLSHDFKINMDRIGELVRPYEENPEN------------------WLQDQPGLK 598

Query: 667 QFLKNSTLNFQTXXXXXXXXXXXXXSMNVNISKNPTSKTQMVNYKYLITHHHSVLRLKYL 726
           +FL  S L FQ               MN+N+  + T   + +++ Y+   +  VL+LKY+
Sbjct: 599 EFLLKSNLTFQGRKKLVIPKKLV---MNLNVEGSNTP--EQISFDYVNVKYRRVLKLKYM 653

Query: 727 DKYMVQFSDINAG 739
           DKY+VQF+D+N G
Sbjct: 654 DKYLVQFTDVNGG 666

>Kwal_27.11301
          Length = 700

 Score =  321 bits (823), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 225/681 (33%), Positives = 354/681 (51%), Gaps = 79/681 (11%)

Query: 75  EHAITRGKKLKPSKAKIVVLNHQEAGLFKNRQQPHFQSRTTQNPLFKGIFDLDVDSDMTL 134
           E   TRGKKLKPSKAKIVVLN +EAGLFK RQ P F +  T+ P  +      V+ D+  
Sbjct: 50  EAKSTRGKKLKPSKAKIVVLNPREAGLFKQRQAPGFFNDHTK-PRERLSALEGVEYDLRR 108

Query: 135 KELTQRPNKSN-LLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPITET--ISHYEYINL 191
            ++ ++   S+ +LQEIESQ  KLL+ K +V   QV++SI   RP   +  IS   Y  L
Sbjct: 109 GQIARQSQTSDSILQEIESQRRKLLIFKSSVPKEQVVKSIHDLRPSKNSNLISSKRYEQL 168

Query: 192 VEKLKGSYTLPQLRSYTKQNFNLSLPH-VTKSKLIERIILKMWNCKIVTNGDDGSLQSNS 250
              L+ +YTLPQL++Y  + + L LP   TK  +I+ I+   W C+I  + + G  Q   
Sbjct: 169 KSLLEMAYTLPQLKAYANEFYKLKLPKSTTKKAVIKTILQDFWQCEIDESINAG--QDLI 226

Query: 251 IEQVXXXXXXXXXXXXYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGLTIAFPLDENK 310
           IE++                 +D+Q  +I LLL T  GK+L N  R+ G T+A  L ENK
Sbjct: 227 IERI-----------------IDVQTRDIYLLLLTNNGKILHNFARL-GATVAVALSENK 268

Query: 311 IIIKAATRGVARYVEVSIRKILSNVINEFVNIDHLLQGMSS----TLNLKDLINLIESHT 366
           II++A T  + +YVEVS+RKIL N   E + +  +++  +S     ++ K+++ L++  +
Sbjct: 269 IIVRA-TSALVKYVEVSLRKILDNAQREVIPVCEIIRSHTSYDSIPVSPKEIVPLVQKES 327

Query: 367 DTVFEKIEXXXXXXXXXKTIFKISAFGQRRIELAKKLLIWG-TYNDHSMTNEQILAVLPS 425
            T FEK+             + ++  G++R+  AK LL+W   Y        + ++    
Sbjct: 328 ATYFEKM------LEDDSDSYVVTGLGEKRLTNAKVLLLWALNYCPQRSERTRFVS---- 377

Query: 426 SLNGNTNNLKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQEPLTLSITNMDSIY 485
             N + +   ++P+ D+   DW+     W RLQ P+ K    T    P+ L    +D +Y
Sbjct: 378 --NEDFSAYHRFPFTDVQCLDWIQAKENWYRLQQPVLKNQPPTAAL-PVNLPEHIIDELY 434

Query: 486 -QMFAPQQEDSQEKS-----MYSMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYD 539
            ++       +  K+     + S++LG  L + +  KT   FQ K+P +  +LL LPLY+
Sbjct: 435 TELLGSANTTAIAKAEHDFKIMSITLGQVLHSENEEKTT--FQSKVPGVTKKLLQLPLYE 492

Query: 540 SSLTQDELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRC 599
              T DEL+S+D+HEY++QLKFIP          K   PP+ELWFELD+    I  S+R 
Sbjct: 493 GFDTPDELYSVDQHEYFIQLKFIPRL----DGTEKKHIPPLELWFELDDNDRAINTSVRA 548

Query: 600 IAQLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKTXXXXXXXXXXXXXXXXXXFL 659
           +      S+ LQTP    DY IN++  +++++P     +T                  +L
Sbjct: 549 LLHAEDTSVYLQTPQISHDYKINIDRTLEVVKPYDQDPQT------------------WL 590

Query: 660 TSQDGINQFLKNSTLNFQTXXXXXXXXXXXXXSMNVNISKNPTSKTQMVNYKYLITHHHS 719
             Q+G+  +L  + L+F               ++N+N+    +++ Q V + Y+   +  
Sbjct: 591 HDQEGLKNYLLQARLDFGG-----KEKLHMPKTLNLNLHFEGSAEPQSVTFDYVSVMYRR 645

Query: 720 VLRLKYLDKYMVQFSDINAGS 740
           VL+LKYLDKY+VQFSD+N G+
Sbjct: 646 VLKLKYLDKYLVQFSDLNGGT 666

>CAGL0M04455g complement(489048..491183) weakly similar to sp|P42900
           Saccharomyces cerevisiae YLR139c SLS1 suppresses
           lethality of SSM4 deletion, hypothetical start
          Length = 711

 Score =  266 bits (680), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 217/759 (28%), Positives = 363/759 (47%), Gaps = 132/759 (17%)

Query: 26  LPMLSRFVLPSKRVALSHYKCTFINSRRLYSHXXXXXXXXXXXXXXXDGEHAITRGKKLK 85
           LP+L + +LP+ R  +           RLYS                      TRGKK  
Sbjct: 5   LPLLRKRILPAFRTRI-----------RLYSDDSLKEKLLS------------TRGKKKM 41

Query: 86  PSKAKIVVLNHQEAGLFKNRQQ----PHFQSRTTQNPL-----------------FKGIF 124
           P K KIVVLN  +   FK R++     H  + TT + L                  +G+ 
Sbjct: 42  PEKQKIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGV- 100

Query: 125 DLDVDSDMTLKELTQRPNKSNLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPITETIS 184
           DL + ++ + KE  +      +L+EI+ +  KL+V +  V+  Q +++I  Q+P+   +S
Sbjct: 101 DLGISTNGS-KEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMS 159

Query: 185 HYEYINLVEKLKGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKI---VTNG 241
              Y  L   LK +YT+ QLR+Y+K+ F  SL   +K+ +I++I+ + W C++   +   
Sbjct: 160 QKRYEQLENLLKSAYTVNQLRAYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQVDENINEK 219

Query: 242 DDGSLQSNSIEQVXXXXXXXXXXXXYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGLT 301
           DD  ++                        +D++  +  LLL T  GK+L NL RI G  
Sbjct: 220 DDLIIERE----------------------LDIKTRDTYLLLLTDNGKILHNLARI-GAI 256

Query: 302 IAFPLDENKIIIKAATRGVARYVEVSIRKILSNVINEFVNI-----DHLLQG-MSSTLNL 355
           +A   +ENKIII+A+   V RYVE+S+ +IL NV  E V I     DH + G +   +N+
Sbjct: 257 LAVAPEENKIIIRASA-NVIRYVEISLNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNV 315

Query: 356 KDLINLIESHTDTVFEKIEXXXXXXXXXKTIFKISAFGQRRIELAKKLLIWGT-YNDHSM 414
           + +I+L++       + I             + ISAFG++RI+ AK  L W + Y  H  
Sbjct: 316 EQIIDLVQKQASVYIDLISDSSEEKQ-----YNISAFGKKRIDTAKLYLTWASKYTPH-- 368

Query: 415 TNEQILAVLPSSLNGNTNNLKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQE-P 473
             E+ +      +       K+YPY D+D+F+WL K+  W RLQ+P  K    T   E P
Sbjct: 369 VQEEYITTGDKCMK---EKCKEYPYTDMDSFNWLDKNKLWYRLQLPENKLLGKTDKLEYP 425

Query: 474 LTLSITNMDSIYQMFAPQQEDSQEK---------SMYSMSLGYSLQALSNGKTIQYFQPK 524
            T+ + ++  IY     +    ++K          + S+++G  L+A      I+ F P+
Sbjct: 426 PTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTRQHVISVTMGQLLKA--GNSMIRTFLPR 483

Query: 525 IPQLASRLLNLPLYDSSLTQDELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPP-VELW 583
           IP +++ L++LP ++ +   D     +  +YYVQLKF P+  +S+      +YPP +ELW
Sbjct: 484 IPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQLKFKPD--LSSIPPGIKSYPPNMELW 541

Query: 584 FELDEEGHPIMDSLRCIAQLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKTXXXX 643
           FELD+  + I  S+ CI  +++K+++L+ P  PFD+ I  ++ +  L P+          
Sbjct: 542 FELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFDFKIVSDAVVS-LNPSLEN------- 593

Query: 644 XXXXXXXXXXXXXXFLTSQDGINQFLKNSTLNFQTXXXXXXXXXXXXXSMNVNISKNPTS 703
                         +L  QD +  ++  + L+F               S+ VNI   PT 
Sbjct: 594 ---------DDPGQWLEGQDELKHYVDQAKLDF-----GQGNKMLLGNSVCVNI---PTE 636

Query: 704 K--TQMVNYKYLITHHHSVLRLKYLDKYMVQFSDINAGS 740
           +  T  V Y ++ T+ H + RLK+ D+++VQ+S+IN G+
Sbjct: 637 EEGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGA 675

>KLLA0D16918g complement(1432797..1434845) weakly similar to
           sp|P42900 Saccharomyces cerevisiae YLR139c SLS1
           suppresses lethality of SSM4 deletion singleton,
           hypothetical start
          Length = 682

 Score =  225 bits (573), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 181/673 (26%), Positives = 307/673 (45%), Gaps = 81/673 (12%)

Query: 81  GKKLKPSKAKIVVLNHQEAGLFKNRQQPHFQSRTTQNPLFKGIFDLDVDSDMTLKELTQR 140
           GKKLKP +   +VL   + G+ +  ++       +   + +G FD    ++        R
Sbjct: 48  GKKLKPKQDHFLVLTPHQTGVMRLPRKSKTLQSNSHLSILEG-FDFKRHTENGTNHSQVR 106

Query: 141 PNKSNLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPITETISHYEYINLVEKLKGSYT 200
               ++L  I+  T+KL+  K      Q+ ++ID  +P +E IS   Y+ L + L   +T
Sbjct: 107 --DVDILSNIQDTTSKLMKFKEQEDNEQMAKAIDSCKPSSEAISEKRYLQLEKVLDEQFT 164

Query: 201 LPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKIVTNGD--DGSLQSNSIEQVXXXX 258
           L QLR+Y      +    + K  LI  II K+WNC I  N    D  +  N I       
Sbjct: 165 LQQLRNYCYLKHGVRKARIPKKNLIPTIITKLWNCSIDYNKSEHDDLIVENEIS------ 218

Query: 259 XXXXXXXXYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGLTIAFPLDENKIIIKAATR 318
                          L+  +I LLL T+ G++LQNL RI G TIA  +DENK++++ AT 
Sbjct: 219 ---------------LETRDIYLLLLTKNGRILQNLARI-GATIAVVIDENKLVVR-ATS 261

Query: 319 GVARYVEVSIRKILSNVINEFVNIDHLLQGMSST-----LNLKDLINLIESHTDTVFEKI 373
            + +YVEVSI +IL NV+++  +I+  ++  S       +  +++I L+++ + +  E  
Sbjct: 262 HIFKYVEVSISRILENVVSDDFSIEEFIKDHSQIDGVHHMTPEEIIALMQTQSSSYVEIT 321

Query: 374 EXXXXXXXXXKTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQILAVLPSSLNGNTNN 433
           +          + +KIS  G++ + +   LL+W   N +  T E    ++P      T  
Sbjct: 322 D---------DSKYKISTIGRKNMNIINSLLLW-VLNYNPQTTE---ILVPYDGGEKT-- 366

Query: 434 LKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGTMTTVPQEPLTLSITNMDSIYQMFAPQQE 493
            ++YP  + +  +W+ +   W R+Q P+       +    + LS   +D I+ +    + 
Sbjct: 367 -EQYPLTNYEWINWVARKQSWHRIQQPV--AINQEIKDTKIDLS-EKIDKIWDILEINKT 422

Query: 494 DSQEKSMY----SMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYD-SSLTQDELF 548
              +   +    S+S+ +    L N +    FQ KIP++  ++L LPL+D     +D+LF
Sbjct: 423 KCAKPLAFTETKSLSIAFG-HILENAQNKILFQSKIPEVVPKVLRLPLWDKDGYVEDDLF 481

Query: 549 SIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRCIAQLNKKSM 608
           S+D+H Y VQ+KF+PN    A    K+   P+E+WF LDE  +    ++RCI   +  S 
Sbjct: 482 SVDQHLYLVQMKFVPNL---ADVSHKVNVSPLEVWFTLDENNNADTSTVRCIHTYSDNSA 538

Query: 609 ILQTPTAPFDYAINMESYIDLLEPTATTLKTXXXXXXXXXXXXXXXXXXFLTSQDGINQF 668
            +QTPT   D+ I +   +D L     +                         Q    +F
Sbjct: 539 CIQTPTLSHDFKITVTDTVDALPEDLES---------------SEFFDWLQREQPSFRKF 583

Query: 669 LKNSTLNFQTXXXXXXXXXXXXXSMNVNISKNPTSKTQMVNYKYLITHHHSVLRLKYLDK 728
           L+ S  +F               S  +N+      + Q + Y YL  + H +LR KY + 
Sbjct: 584 LQESNFSFGG-----LKKPRIAPSFELNVKLEGMEEPQKIRYNYLHRYEHRLLRFKYKED 638

Query: 729 YMVQFSDINAGSL 741
            +VQ S+I  GSL
Sbjct: 639 CLVQLSEIEGGSL 651

>AGL167C [4145] [Homologous to ScYLR139C (SLS1) - SH]
           (382880..385063) [2184 bp, 727 aa]
          Length = 727

 Score =  174 bits (442), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 166/678 (24%), Positives = 296/678 (43%), Gaps = 90/678 (13%)

Query: 91  IVVLNHQEAGLFKNRQQPHFQSRTTQNPLFKGIFDLDVDSDMTLK---ELTQRPNKS--- 144
            +VL+ ++ GL   R +     R           D +  S   LK   +L+++P K    
Sbjct: 78  FIVLDPEQTGLLPKRGETGRSWRK----------DREHGSRRNLKTRDDLSEKPAKKQDK 127

Query: 145 ------NLLQEIESQTNKLLVS-KINVTTPQVIQSIDVQRPITETI--SHYEYINLVEKL 195
                 +LL  +E    K+L   K + +  + I  I+  RP    +  S   +  L + L
Sbjct: 128 EKVTARDLLDALEWSGEKMLREEKRSTSDEETIGVINNMRPDQAALQMSPERFEQLRKAL 187

Query: 196 KGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKI---VTNGDDGSLQSNSIE 252
             S++  QLR Y  + + L   + TK   + +++ + W CK+   ++   D  ++     
Sbjct: 188 AKSFSYTQLRLYASKLYGLKKTNETKKAFVTKVMQECWKCKVDKTISKKQDLIIKR---- 243

Query: 253 QVXXXXXXXXXXXXYEILTMDLQNTEITLLLFTQRGKLLQNLTRINGLTIAFPLDENKII 312
                             T+DL   ++ LLL T  G++LQN+ R  G +IA    ENK+I
Sbjct: 244 ------------------TIDLSQKDMYLLLMTDGGRILQNMAR-TGASIAAAFTENKLI 284

Query: 313 IKAATRGVARYVEVSIRKILSNVINEFVNIDHLLQGMSSTLNLKDLINLIESHTDTVFEK 372
           I A ++ +A Y+E SI  IL+++ +  +++    +  ++  + +      E     V  +
Sbjct: 285 IHA-SKSLATYIEASIASILNSIQSSRLSLYEFAKEHTAVQDSRSPQYSPEQLLAMVCRE 343

Query: 373 IEXXXXXXXXXKTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQILAVLPSSLNGNTN 432
                        +  +SA  Q ++  A++LL+W       +T + I       L  N  
Sbjct: 344 CSVHQEKYPEVPGLVALSALSQEKLAAARQLLLWAFDYKPEVTTDTIFC----GLEDNQI 399

Query: 433 NLKKYPYNDIDAFDWLHKDNEWTRLQIPLKKGT--MTTVPQEPLTLSITN-MDSIYQMFA 489
              KYP +D + F+WL +  +W RLQ    + +  M+     P+ +   N ++ +Y    
Sbjct: 400 TYAKYPVSDPEWFNWLERKTKWFRLQQVEHRLSPDMSGAAPAPVPVVPENVLNQVYDFCM 459

Query: 490 PQ--------QEDSQEKSMYSMSLGYSLQALSNGKTIQYFQPKIPQLASRLLNLPLYDSS 541
            Q        Q  + E  +  +SLG  L   S  +  Q FQP+ P +  +LL LPLY   
Sbjct: 460 RQSTGNVAEIQNHAAEAKVLRVSLGQVLTDESGQR--QMFQPQAPYMNQKLLQLPLYYPL 517

Query: 542 LTQDELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFELDEEGHPIMDSLRCIA 601
            ++ + +S+D+H+Y++QL++ P  L +  F  +   PP+ELWF L E       ++RCI 
Sbjct: 518 ESEHDYYSVDQHDYFLQLRYAP-VLSATGF--RYNLPPLELWFTLGENNRVEPHTVRCIN 574

Query: 602 QLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKTXXXXXXXXXXXXXXXXXXFLTS 661
           +L ++S++LQ P +P D  + +E   +++ P                          LT 
Sbjct: 575 RLAERSVMLQLPGSPVDCRVTLERVSEMVPPGDDA-----------------SHEWLLTH 617

Query: 662 QDGINQFLKNSTLNFQTXXXXXXXXXXXXXSMNVNISKNPTSKTQMVNYKYLITHHHSVL 721
           Q  + Q+L   T                   +++N++  P S    + Y+++   HH VL
Sbjct: 618 QPALQQYLDRVTPTLDRHLRARMQNVALPDPIHLNVAL-PGSPPSPIPYRFVSMAHHRVL 676

Query: 722 RLKYLDKYMVQFSDINAG 739
            L+YLDKY VQ S ++ G
Sbjct: 677 SLRYLDKYRVQLSTVSGG 694

>YLR139C (SLS1) [3549] chr12 complement(421543..423474) Protein
           involved in mitochondrial transcription and/or
           translation processes [1932 bp, 643 aa]
          Length = 643

 Score =  172 bits (436), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 199/701 (28%), Positives = 312/701 (44%), Gaps = 140/701 (19%)

Query: 74  GEHAITRGKKLKPSKAKIVVLNHQEAGLFKNRQ-QPHFQSRTTQNPLFKGIFDLDVDSDM 132
           G  +   GKK  P   K VVLN  ++GL KN Q QP  +    ++    G  +LD  S  
Sbjct: 20  GPSSPLHGKKKLPQNLKFVVLNPTQSGLVKNDQKQPRHRPSKKRSHKETGDNNLDFGS-- 77

Query: 133 TLKELTQRPNKSNLLQEIESQTNKLLVSKINVTTPQVIQSIDVQRPITETISHYEYINLV 192
                                  KLLV +   +    + SI +++P + ++   EY  L+
Sbjct: 78  -----------------------KLLVFEKQNSLDSALNSIRLKKPTSASLPSLEYNALL 114

Query: 193 EKLKGSYTLPQLRSYTKQNFNLSLPHVT---KSKLIERIILKMWNCK-IVTNGDDGSLQS 248
           + L  SY   QLR +   +   S  H+T   KSKL + II K+WNC+ I T      ++S
Sbjct: 115 QSLTSSYNRYQLREFISTHQPDSSSHLTHWKKSKLSQYIIEKIWNCQPISTPTTPTGIKS 174

Query: 249 NSIEQVXXXXXXXXXXXXYEILTMDLQNT-EITLLLFTQRGKLLQNLTRINGLTIAFPLD 307
            S                   LT    +  EI LLL TQ GK+L N  ++ GLT    + 
Sbjct: 175 TS-------------------LTFQFDSPREIFLLLITQNGKILTNFNKL-GLTFIISIQ 214

Query: 308 ENKIIIKAATRGVARYVEVSIRKILSNVINEFVNIDHLLQGMSSTLNLKDLINLIESHTD 367
           +N++ +K +   + +Y E+S+ KI SN+ +E V        M S +  KD+INLI+  T 
Sbjct: 215 DNELTVKGSP-SLLKYAEISLNKIWSNITHENVR-------MYSLMPSKDVINLIQKETH 266

Query: 368 TVFEKIEXXXXXXXXXKTIFKISAFGQRRIELAKKLLIWGTYNDHSMTNEQILAVLPSSL 427
           T FE +            ++KISA   ++I +AK  L+    ++ + T        P+  
Sbjct: 267 TFFEYLPDLQ--------MYKISALSTKKISMAKVFLLNAVASNPNTTQHHHTIASPA-- 316

Query: 428 NGNTNNLKK--YPYND-IDAFDWLHKDNEWTRLQ--IPLKKGTMTTVPQEPLTLSITN-- 480
                 LK   YP+N+ ++  DWL+K  +W RLQ  +P K  T    P E  T  +T+  
Sbjct: 317 ------LKTELYPFNNTLENLDWLNKSQDWARLQSVVP-KNCTDLMTPTENATPELTDAQ 369

Query: 481 ---MDSIYQMFAPQ--QEDSQEKSMYSMSLGYSLQALSNGKTIQYFQPKIPQ-LASRLLN 534
               +S      P     DS  +S+ S++LG+SLQ+ S       FQP I +   S+LLN
Sbjct: 370 VSQFESSLSKNIPSLSPSDSISQSL-SITLGHSLQSASFSSI---FQPLIHKSFISKLLN 425

Query: 535 LPLYDSSLTQ--------DELFSIDKHEYYVQLKFIPNTLVSASFDSKITYPPVELWFEL 586
           LP+Y  S +         D+    + H+ ++QL F P    S S  S      +++WFE+
Sbjct: 426 LPMYKESSSSAVPVPVPLDQHLITNAHQSFIQLNFTPVPPTSGSSSSPF----LQIWFEI 481

Query: 587 DEEGHPIMDSLRCIAQLNKKSMILQTPTAPFDYAINMESYIDLLEPTATTLKTXXXXXXX 646
           DE  + +  S+R + +L + S+IL+TP    DY I  +   DLL     T          
Sbjct: 482 DEFDNIVTTSMRPLLKLQENSVILRTPQCQTDYKITSDYIQDLLPDFDQT---------- 531

Query: 647 XXXXXXXXXXXFLTSQDGINQFLKNSTLNFQTXXXXXXXXXXXXXSMNVNISKNPTSKTQ 706
                      +L+ Q G+ +FL  S                    +N+++  N   + Q
Sbjct: 532 -------NPDAWLSEQKGLQEFLLKSHWKLN-------KYQNLMKKINISLPDNLIQQYQ 577

Query: 707 MVNYKYLITHHHSVLRLKYL------DKYMVQFSDINAGSL 741
           + +   ++TH   VL L++       DKY++Q+SDI+ G L
Sbjct: 578 LTD---VLTHR--VLNLRFPTNTAQDDKYIIQYSDISRGFL 613

>Kwal_33.15339
          Length = 1184

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 16/83 (19%)

Query: 484  IYQMFAPQQEDSQEKSMYSMSLGYSL--QAL-SNGKTIQYF---------QPKIPQLASR 531
             ++ F P+     +  MYS  +GY +  QA  S G + Q F         +P +P +ASR
Sbjct: 1016 FWEEFIPRPSKESDLEMYSSRIGYKIFEQATHSIGSSSQNFVSKLITNLTEPLVPPIASR 1075

Query: 532  LLNLPL----YDSSLTQDELFSI 550
               +P+     DS+L +D L ++
Sbjct: 1076 TYGIPVLTFSPDSALNEDALKAV 1098

>Scas_635.6
          Length = 440

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 142 NKSNLLQEIESQTNKLLVSKINVTTP-QVIQSIDVQRPITETISHYEYINLV 192
           NKSN +++IE  +      KIN+  P QV   I+  +PI+E I   + I+L+
Sbjct: 120 NKSNRIKQIEKFSYLDFKGKINLKNPQQVFTVIEEYKPISENIPGKDPIHLI 171

>CAGL0D00286g 37583..39784 weakly similar to DEHA0D08195g
           Debaryomyces hansenii and CA4636|IPF1520 Candida
           albicans, hypothetical start
          Length = 733

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 10/77 (12%)

Query: 163 NVTTPQVIQSIDV--QRPITETISHYEYINLVEKLKGSYTLPQ-------LRSYTKQNFN 213
           NV +P  + S DV  Q P T++   Y  I++ +  KGSY +         L+SYTK+  N
Sbjct: 637 NVLSPNSVISWDVLSQNPETKSYDDYMQISVSQSDKGSYVIKMKGVLDFILQSYTKEGLN 696

Query: 214 LSLPHVTKSKLIERIIL 230
            ++   + S L +RI L
Sbjct: 697 NNMDWES-SGLEDRIEL 712

>Scas_660.30
          Length = 774

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 12/116 (10%)

Query: 137 LTQRPNKSNLLQE-IESQTNKLLVSKINVTTPQVIQSIDVQRPITETISHYEYINLVEKL 195
           LT+ P    +  E I  +T K+L   IN  TP  I S  ++   TE++  ++   L +K+
Sbjct: 343 LTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKI 402

Query: 196 KGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKIVTNGDDGSLQSNSI 251
             SY +P      K+ F+            ER + K +   I T+ ++ S ++N I
Sbjct: 403 CTSYPVPVYVVPAKRMFDF-----------ERKLAKQFANPISTSEEELSTKNNFI 447

>Scas_538.4d
          Length = 531

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 8/96 (8%)

Query: 153 QTNKLLVSKINVTTPQVIQSIDVQRPITETISHYEYINLVEKLKGSYTLPQLRSYTKQNF 212
            T +  +    + +P    S+D  + ITE +S++     +  L    TLP +   T   F
Sbjct: 368 NTTEYFIPSFTLPSPYTTTSVDGGKTITEVVSYFTTTGYLPILTELTTLPYV-GITTSTF 426

Query: 213 NLSLPHVTKSKLIERIILKMWNCKIV----TNGDDG 244
           + S+P    S L E     M   +IV    T G DG
Sbjct: 427 SFSIPPPYTSTLTED---DMTVSEIVSYYSTTGSDG 459

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,407,114
Number of extensions: 941787
Number of successful extensions: 2982
Number of sequences better than 10.0: 26
Number of HSP's gapped: 3022
Number of HSP's successfully gapped: 27
Length of query: 742
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 633
Effective length of database: 12,822,747
Effective search space: 8116798851
Effective search space used: 8116798851
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)