Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_505.41025102553600.0
CAGL0G06270g132846321680.0
YAL026C (DRS2)135548021400.0
Kwal_26.7070131544620210.0
KLLA0A04015g134345020100.0
ADR350W131144617090.0
CAGL0G08085g15783666528e-70
YER166W (DNF1)15713766208e-66
AGR120C15474526127e-65
CAGL0L11814g15763625861e-61
KLLA0C17644g15763735833e-61
YDR093W (DNF2)16123965833e-61
Scas_576.815913665824e-61
Scas_636.1615543705815e-61
CAGL0H04477g16263585461e-56
KLLA0E01650g15503785381e-55
Kwal_23.355615973825192e-53
YMR162C (DNF3)16563855174e-53
AFL191W15753464721e-47
Scas_669.316383484693e-47
Kwal_23.578911333763737e-36
YIL048W (NEO1)11513543655e-35
Scas_704.3811613483522e-33
Sklu_2193.111433503495e-33
ADL079C11663493432e-32
CAGL0L00715g11443503423e-32
KLLA0C08393g11483003389e-32
Scas_89.12711462415e-22
Kwal_56.234672802401167e-06
Kwal_23.316011003401028e-04
Scas_665.30143970940.008
AFR354C121062910.014
AGL097C1096346900.019
CAGL0M11308g1452149890.026
Scas_583.14*87559890.027
CAGL0L01419g121452890.028
YOR291W1472209870.047
YEL031W (SPF1)121547860.051
KLLA0A08910g128071860.051
KLLA0E22352g120665860.051
YGL006W (PMC1)1173113860.054
KLLA0B08217g143970860.056
Kwal_26.833342285840.088
Kwal_47.175471240172830.12
CAGL0A00517g112299830.14
Scas_297.180059810.20
CAGL0K12034g1087203810.21
KLLA0F20658g1082249810.23
YDR039C (ENA2)1091251800.27
YDR040C (ENA1)1091251800.27
Kwal_26.9207146961800.30
YDR038C (ENA5)1091251790.33
Scas_569.0d468193780.47
AFR567W144961760.80
AFL011W124273760.89
AEL301W957185750.98
CAGL0J01870g946120751.0
Kwal_14.1498939202751.2
KLLA0E14630g1082118722.8
CAGL0I04312g95156713.2
Kwal_23.5035744100704.4
YDR270W (CCC2)100461696.0
Scas_707.48*74156686.3
KLLA0A03157g93863696.4
Kwal_47.1752289957688.0
Scas_608.322981668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_505.4
         (1025 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_505.4                                                           2069   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   839   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   828   0.0  
Kwal_26.7070                                                          783   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   778   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   662   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   255   8e-70
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   243   8e-66
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   240   7e-65
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   230   1e-61
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   229   3e-61
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   229   3e-61
Scas_576.8                                                            228   4e-61
Scas_636.16                                                           228   5e-61
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   214   1e-56
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   211   1e-55
Kwal_23.3556                                                          204   2e-53
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   203   4e-53
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   186   1e-47
Scas_669.3                                                            185   3e-47
Kwal_23.5789                                                          148   7e-36
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   145   5e-35
Scas_704.38                                                           140   2e-33
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         139   5e-33
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   136   2e-32
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   136   3e-32
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   134   9e-32
Scas_89.1                                                              97   5e-22
Kwal_56.23467                                                          49   7e-06
Kwal_23.3160                                                           44   8e-04
Scas_665.30                                                            41   0.008
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    40   0.014
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    39   0.019
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    39   0.026
Scas_583.14*                                                           39   0.027
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    39   0.028
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    38   0.047
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    38   0.051
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    38   0.051
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    38   0.051
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    38   0.054
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    38   0.056
Kwal_26.8333                                                           37   0.088
Kwal_47.17547                                                          37   0.12 
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    37   0.14 
Scas_297.1                                                             36   0.20 
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    36   0.21 
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    36   0.23 
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    35   0.27 
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    35   0.27 
Kwal_26.9207                                                           35   0.30 
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    35   0.33 
Scas_569.0d                                                            35   0.47 
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    34   0.80 
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    34   0.89 
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    33   0.98 
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    33   1.0  
Kwal_14.1498                                                           33   1.2  
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    32   2.8  
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    32   3.2  
Kwal_23.5035                                                           32   4.4  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    31   6.0  
Scas_707.48*                                                           31   6.3  
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    31   6.4  
Kwal_47.17522                                                          31   8.0  
Scas_608.3                                                             30   8.2  

>Scas_505.4
          Length = 1025

 Score = 2069 bits (5360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 995/1025 (97%), Positives = 995/1025 (97%)

Query: 1    IDICERCITFQTFERYLYYPSGHISNCALLICSLKLIIARLPVQATTIMSKDAKVADDTL 60
            IDICERCITFQTFERYLYYPSGHISNCALLICSLKLIIARLPVQATTIMSKDAKVADDTL
Sbjct: 1    IDICERCITFQTFERYLYYPSGHISNCALLICSLKLIIARLPVQATTIMSKDAKVADDTL 60

Query: 61   FDIDILNDSAEPSNSTQPHIIANNRDAEARVIPPHTFPXXXXXXXXXXXXXXXXXXXPFQ 120
            FDIDILNDSAEPSNSTQPHIIANNRDAEARVIPPHTFP                   PFQ
Sbjct: 61   FDIDILNDSAEPSNSTQPHIIANNRDAEARVIPPHTFPEETIDLDNDDNIENDIYDNPFQ 120

Query: 121  DEESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDSGSYEMNRYN 180
            DEESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDSGSYEMNRYN
Sbjct: 121  DEESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDSGSYEMNRYN 180

Query: 181  AVTNNELDGRYADSRNRFNIKILFNRYILRKNVGASDDGTPREIYLNDRTANHAFNYGDN 240
            AVTNNELDGRYADSRNRFNIKILFNRYILRKNVGASDDGTPREIYLNDRTANHAFNYGDN
Sbjct: 181  AVTNNELDGRYADSRNRFNIKILFNRYILRKNVGASDDGTPREIYLNDRTANHAFNYGDN 240

Query: 241  HISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVVLIVS 300
            HISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVVLIVS
Sbjct: 241  HISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVVLIVS 300

Query: 301  AFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSEEAIPADLI 360
            AFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSEEAIPADLI
Sbjct: 301  AFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSEEAIPADLI 360

Query: 361  VISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNSSLYT 420
            VISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNSSLYT
Sbjct: 361  VISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNSSLYT 420

Query: 421  YEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKRTAVE 480
            YEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKRTAVE
Sbjct: 421  YEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKRTAVE 480

Query: 481  RVINLQIVALFGXXXXXXXXXXXGNAIISSTQEKHLSYLYGRYSRPVVEFEFHTRKNMRD 540
            RVINLQIVALFG           GNAIISSTQEKHLSYLYGRYSRPVVEFEFHTRKNMRD
Sbjct: 481  RVINLQIVALFGVLIVLVLISSLGNAIISSTQEKHLSYLYGRYSRPVVEFEFHTRKNMRD 540

Query: 541  KIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKA 600
            KIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKA
Sbjct: 541  KIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKA 600

Query: 601  LVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKK 660
            LVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKK
Sbjct: 601  LVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKK 660

Query: 661  LLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTV 720
            LLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTV
Sbjct: 661  LLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTV 720

Query: 721  FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLF 780
            FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLF
Sbjct: 721  FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLF 780

Query: 781  YRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIF 840
            YRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIF
Sbjct: 781  YRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIF 840

Query: 841  FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY 900
            FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY
Sbjct: 841  FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY 900

Query: 901  HLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKIIRMYDTT 960
            HLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKIIRMYDTT
Sbjct: 901  HLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKIIRMYDTT 960

Query: 961  QKRGVYGELHDANPFSNNNAENIFNESFNMVNDGNIPTDPFGDTNELSNDPDLIENPFAN 1020
            QKRGVYGELHDANPFSNNNAENIFNESFNMVNDGNIPTDPFGDTNELSNDPDLIENPFAN
Sbjct: 961  QKRGVYGELHDANPFSNNNAENIFNESFNMVNDGNIPTDPFGDTNELSNDPDLIENPFAN 1020

Query: 1021 DADIR 1025
            DADIR
Sbjct: 1021 DADIR 1025

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/463 (84%), Positives = 427/463 (92%), Gaps = 10/463 (2%)

Query: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593
            TR+NM +K+ AL EH LS+H+MNTLALVIDG SLS+ALE+DLEDY LA+GK+CKAV+CCR
Sbjct: 850  TRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCR 909

Query: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653
            VSPLQKALVVKMVKRKT+SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADI+VG
Sbjct: 910  VSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVG 969

Query: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713
            QFRFLKKLLLVHG+WSYQRISVAILYSFYKNTALYMTQFW+VFANAFSGQSIMESWTMS 
Sbjct: 970  QFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSL 1029

Query: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773
            YNVFFTV PPFVIGVFDQFV+SRLLERYPQLYKLGQ+G+FFSV IFWGWIVNGFYHSAVV
Sbjct: 1030 YNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVV 1089

Query: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833
            ++GT+LFYRYG AL  HGE ADHWSWGIA+YTSS++IVLGKAALVTNQWTKFTLFAIPGS
Sbjct: 1090 FVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGS 1149

Query: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893
              FW+IFFPIY S+FPYA ISREYFGVV+HTYGS TFWLTLIVLP FAL RDF+WKYY+R
Sbjct: 1150 LFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKR 1209

Query: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953
            MY PESYHL+QEMQK+N+SD RPHVQHFQN IRKVRQVQRMKKQRGFAFSQ+EE GQ+KI
Sbjct: 1210 MYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFAFSQAEE-GQEKI 1268

Query: 954  IRMYDTTQKRGVYGELHD--ANPFSN-------NNAENIFNES 987
            IRMYDTTQKRG YGELHD  A+PFS+       NN EN F+++
Sbjct: 1269 IRMYDTTQKRGKYGELHDASADPFSDTHKLVPENNEENPFSDA 1311

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/475 (61%), Positives = 340/475 (71%), Gaps = 18/475 (3%)

Query: 49  MSKDAKV-ADDTLFDIDILNDSAEPSNSTQPHIIANNRDAEARVIPPHTFPXXXXXXXXX 107
           M K  +V   DTLFDID  ND  +             R +E      H FP         
Sbjct: 5   MGKGTRVPTGDTLFDID-FNDGNKI------------RASENERTTSHGFPEEIIDLDND 51

Query: 108 XXXXXXXXXXPFQD-EESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNT 166
                     PF +      W+TNRF+  N QP L   G +   F      +K IF F +
Sbjct: 52  SIENDLHDN-PFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQS 110

Query: 167 KPSDSGSYEMNRYNAVTNNELDGRYADSRNRFNIKILFNRYILRKNVG-ASDDGTPREIY 225
             S+  S+EM+ YN V+  E+D  +  SRN+F+IKILFN+Y+LRKN     D G PREI+
Sbjct: 111 N-SEPQSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIH 169

Query: 226 LNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTN 285
           ++DR +N+ F Y DNHISTTKYN ATFLPKFLFQEFSKYANLFFLCT+AIQQVPHVSPTN
Sbjct: 170 ISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTN 229

Query: 286 RYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGD 345
           RYTT+GTLMVVLIVSA KES+ED+KRA+SD ELNNSK EIY E  GDFI++RWIDI+ GD
Sbjct: 230 RYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKVGD 289

Query: 346 VIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNF 405
           +IRV SEE IPAD+I++SSSEPEGLCYIETANLDGETNLKIKQAR ETA++MDSR+L N 
Sbjct: 290 IIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELRNI 349

Query: 406 KGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKL 465
           KG + SEQPNSSLYTYEGTLE N  KIPLSPEQMILRGATLRNT W+FG+VIFTGHETKL
Sbjct: 350 KGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHETKL 409

Query: 466 MRNATATPIKRTAVERVINLQIVALFGXXXXXXXXXXXGNAIISSTQEKHLSYLY 520
           MRNATATPIKRTAVE+VIN+QI+ALF            GN I+S+   KHLSYLY
Sbjct: 410 MRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLY 464

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/480 (79%), Positives = 435/480 (90%), Gaps = 10/480 (2%)

Query: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593
            T +N+ +KI AL EH+LS H+M +LALVIDGKSL +ALE +LEDYLL + K+CKAV+CCR
Sbjct: 869  TERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCR 928

Query: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653
            VSPLQKALVVKMVKRK+SSLLLAI  GANDVSMIQAAHVGVGISGMEGMQAARSADIA+G
Sbjct: 929  VSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALG 988

Query: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713
            QF+FLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFW+VFANAFSGQSIMESWTMS+
Sbjct: 989  QFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSF 1048

Query: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773
            YN+FFTV+PPFVIGVFDQFVSSRLLERYPQLYKLGQ+G+FFSV IFWGWI+NGF+HSA+V
Sbjct: 1049 YNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV 1108

Query: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833
            +IGT+L YRYG ALNMHGE+ADHWSWG+ VYT+S++IVLGKAALVTNQWTKFTL AIPGS
Sbjct: 1109 FIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGS 1168

Query: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893
             +FW+IFFPIYAS+FP+ANISREY+GVVKHTYGSG FWLTLIVLP+FAL+RDF+WKYY+R
Sbjct: 1169 LLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKR 1228

Query: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953
            MYEPE+YH++QEMQK+NISD+RPHVQ FQN IRKVRQVQRMKKQRGFAFSQ+EEGGQ+KI
Sbjct: 1229 MYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQRMKKQRGFAFSQAEEGGQEKI 1288

Query: 954  IRMYDTTQKRGVYGELHD--ANPFSNNN--AENIFNESFNMVNDGNIPTDPFGDTNELSN 1009
            +RMYDTTQKRG YGEL D  ANPF++NN    N F  +   +       +PF D N+ SN
Sbjct: 1289 VRMYDTTQKRGKYGELQDASANPFNDNNGLGSNDFESAEPFIE------NPFADGNQNSN 1342

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/470 (64%), Positives = 346/470 (73%), Gaps = 10/470 (2%)

Query: 57  DDTLFDIDILNDSAEPSNSTQPHIIANNRDAEARVIPP-HTFPXXXXXXXXXXXXXXXXX 115
           DDTLFDID L+D+   S S        N  A    IPP H  P                 
Sbjct: 16  DDTLFDIDFLDDTTSHSGSRSK---VTNSHANGYYIPPSHVLPEETIDLDADDDNIENDV 72

Query: 116 XXPF----QDEESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDS 171
                     ++ T+W+ NRF+++ YQPQ     +  G FA   N +KN F F  K    
Sbjct: 73  HENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFKRKKGPE 132

Query: 172 GSYEMNRYNAVTNNELDGRYADSRNRFNIKILFNRYILRKNVG-ASDDGTPREIYLNDRT 230
            S+EMN YNAVTNNELD  Y DSRN+FNIKILFNRYILRKNVG A  +G PR I++ND  
Sbjct: 133 -SFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSL 191

Query: 231 ANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTV 290
           AN +F Y DNHISTTKYN ATFLPKFLFQEFSKYANLFFLCT+AIQQVPHVSPTNRYTT+
Sbjct: 192 ANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTI 251

Query: 291 GTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVK 350
           GTL+VVLIVSA KE IEDIKRANSDKELNNS  EI+SE + DF+E+RWIDIR GD+IRVK
Sbjct: 252 GTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVK 311

Query: 351 SEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVI 410
           SEE IPAD I++SSSEPEGLCYIETANLDGETNLKIKQ+R ETA+ +D + L N  GKV+
Sbjct: 312 SEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVV 371

Query: 411 SEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNAT 470
           SEQPNSSLYTYEGT+  N+R+IPLSP+QMILRGATLRNT+W+FGLVIFTGHETKL+RNAT
Sbjct: 372 SEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNAT 431

Query: 471 ATPIKRTAVERVINLQIVALFGXXXXXXXXXXXGNAIISSTQEKHLSYLY 520
           ATPIKRTAVE++IN QI+ LF            GN I+S+   KHLSYLY
Sbjct: 432 ATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLY 481

>Kwal_26.7070
          Length = 1315

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/446 (78%), Positives = 402/446 (90%), Gaps = 2/446 (0%)

Query: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593
            TRKN+ +K+ A+ +H++SQ +MN+LALVIDGKSL +ALE+DLEDYLLA+GK+CKAV+CCR
Sbjct: 868  TRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCR 927

Query: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653
            VSPLQKALVVKMVKRKT SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD A+ 
Sbjct: 928  VSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIA 987

Query: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713
            QF++LKKLLLVHGSWSYQRIS AILYSFYKN ALYMTQFW+VFANA+SGQSIMESWTM++
Sbjct: 988  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTF 1047

Query: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773
            YNVFFTV PPFV+GVFDQFVSSRLL+RYPQLYKLGQ+G+FFSVRIFWGW++NGFYHSAV 
Sbjct: 1048 YNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVT 1107

Query: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833
            +IG+ LFYR G  LN HGE ADHW+WG+++YT S++IV+GKAALVTNQWTKFT FAIPGS
Sbjct: 1108 FIGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGS 1167

Query: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893
             +FW++FFPIYAS+ P+AN+S+EY+GVV H YGS TFWL  IVLP FALMRD VWKYY+R
Sbjct: 1168 LVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKR 1227

Query: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953
             Y PESYH+VQEMQK+NI D RP ++ FQ  IR+VRQVQRMKKQRGFAFSQSE GGQDK+
Sbjct: 1228 TYTPESYHVVQEMQKYNIGDYRPRIEQFQKAIRRVRQVQRMKKQRGFAFSQSETGGQDKV 1287

Query: 954  IRMYDTTQKRGVYGELHD--ANPFSN 977
            +RMYDTT KRG +GEL D  ANPF +
Sbjct: 1288 MRMYDTTLKRGEHGELQDASANPFRD 1313

 Score =  494 bits (1271), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 244/404 (60%), Positives = 306/404 (75%), Gaps = 10/404 (2%)

Query: 118 PFQDEESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDSGSYEMN 177
           PF DE        R  ++N Q  ++ T Q    F  + NK+K     +   +    +EM+
Sbjct: 86  PFSDERRA-----RSSSHN-QGVVHLTPQNGSAFQRAINKIKKGLGRSGSGNSYQGFEMH 139

Query: 178 RYNAVTNNELDGRYADSRNRFNIKILFNRYILRKNVGASDD-GTPREIYLNDRTANHAFN 236
            Y+ + N   D RYA SRN+F+IKI+F RYILR+N  + DD  +PR+IY+ND+ AN A  
Sbjct: 140 NYDDLGN---DDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKEANRARG 196

Query: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVV 296
           +G NHISTTKYN+ATF+PKFLFQEFSKYANLFFL T+AIQQVP+V+PTNRYTT+GTL++V
Sbjct: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256

Query: 297 LIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSEEAIP 356
           LIVSA KE +ED+KRA SD ELN+S+ +++SE+  DF   +W++I  GD+I+V SEEAIP
Sbjct: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKVNSEEAIP 316

Query: 357 ADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNS 416
           AD+IVI+SSEPEGLCYIETANLDGETNLKIKQAR ET++ +D   L   +GKV+SE PNS
Sbjct: 317 ADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLSEHPNS 376

Query: 417 SLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKR 476
           SLYTYEGT+  N + I LSPEQM+LRGATLRNT+W++GLV+FTGHETKLMRNATATPIKR
Sbjct: 377 SLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATPIKR 436

Query: 477 TAVERVINLQIVALFGXXXXXXXXXXXGNAIISSTQEKHLSYLY 520
           TAVERVIN+QIVALFG           GN I  ++  +HL+YLY
Sbjct: 437 TAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLY 480

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/450 (77%), Positives = 406/450 (90%), Gaps = 2/450 (0%)

Query: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593
            TR N++ K+ A++ H++SQ +MN+LALVIDGKSL YALE DLED  L +GK+CKAV+CCR
Sbjct: 872  TRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCR 931

Query: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653
            VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD A+G
Sbjct: 932  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIG 991

Query: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713
            QFRFL+KLL+VHGSWSYQRIS+AILYSFYKN ALYMTQFW+VFANAFSGQSIMESWT+++
Sbjct: 992  QFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTF 1051

Query: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773
            YNVFFTV PPFVIG+FDQFV+SRLL+RYPQLYKLGQ+G+FFSV IFWGW++NGFYHSAVV
Sbjct: 1052 YNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVV 1111

Query: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833
            +IG++LFYRYG  LNM GE ADHW WG+ +YT+SI+IVLGKAAL+T+QWTKFTL AIPGS
Sbjct: 1112 FIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQWTKFTLVAIPGS 1171

Query: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893
             + W++FFP Y++VFP  N+S+EY+G++ H YGS TFWL  IVLPVFAL+RDFVWKYY+R
Sbjct: 1172 LVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKR 1231

Query: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953
             Y PESYH+VQEMQK+NISD RP ++ FQ  IRKVRQVQRMKKQRGFAFSQSEEGGQD+I
Sbjct: 1232 TYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQRMKKQRGFAFSQSEEGGQDRI 1291

Query: 954  IRMYDTTQKRGVYGELHDA--NPFSNNNAE 981
            IRMYDTT KRGV+GEL DA  NPF++  A+
Sbjct: 1292 IRMYDTTLKRGVHGELADASLNPFNDTPAQ 1321

 Score =  496 bits (1276), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/481 (55%), Positives = 320/481 (66%), Gaps = 29/481 (6%)

Query: 49  MSKDAKVAD-DTLFDIDILNDSAEPSNSTQPH------IIANNRDAEARVIPPHTFPXXX 101
           MS   K  D D LFD+D L+DS  P     P       +I +  D   R + P       
Sbjct: 25  MSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSPSAVIDSGMDTSQRGLLPQ------ 78

Query: 102 XXXXXXXXXXXXXXXXPFQDEESTTW-DTNRFETNNYQPQLYPTGQRNGFFANSFNKVKN 160
                           PF D  S ++ DTN    N+  PQ  P+G  N F +N    VK+
Sbjct: 79  -ETIDLSDNIENDIENPFNDRYSASFADTN--PRNSVLPQ--PSG-FNRFMSN----VKS 128

Query: 161 IFVFNTKPSDS-GSYEMNRYNAVTNNELDGRYADSRNRFNIKILFNRYILRKNVGASDDG 219
               N        S+EMN Y+    N    RY  S  +F+IK+LFNRYILRK   +    
Sbjct: 129 AVGMNGGHKGQFQSFEMNDYDQSNTN----RYESSTRKFDIKVLFNRYILRKGKTSCKSD 184

Query: 220 TPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVP 279
            PR I LND +AN  F Y DNHISTTKYN ATFLPKFLFQEFSKYANLFFL T+ IQQVP
Sbjct: 185 EPRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVP 244

Query: 280 HVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWI 339
           +V+PTNRYTT+GTL+VVLIVSA KES+ED+KR+N+DKELN+S  ++  E +G+F+ ++WI
Sbjct: 245 NVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWI 304

Query: 340 DIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDS 399
           DI  GD+IRV+SEEAIPADLI++SSSEPEGLCYIETANLDGETNLKIKQAR ETA  +D 
Sbjct: 305 DIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDE 364

Query: 400 RKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFT 459
           + L    G+V SE PNSSLYTYEGT+  N    PLSP+QM+LRGATLRNT+W+FGL++FT
Sbjct: 365 KALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFT 424

Query: 460 GHETKLMRNATATPIKRTAVERVINLQIVALFGXXXXXXXXXXXGNAIISSTQEKHLSYL 519
           GHETKLMRNATATPIKRTAVERVIN+QI+ALFG           GN I++     HL YL
Sbjct: 425 GHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYL 484

Query: 520 Y 520
           Y
Sbjct: 485 Y 485

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/446 (68%), Positives = 364/446 (81%), Gaps = 2/446 (0%)

Query: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593
            TR N+ DK+ A+ +H++SQ +MNTLALVIDGKSL +ALE DLE++LLA+GK+C+AV+CCR
Sbjct: 865  TRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCR 924

Query: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653
            VSPLQKALVVKMVKR+T SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD A+G
Sbjct: 925  VSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALG 984

Query: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713
            QF++LKKLLLVHGSWSYQRIS AILYSFYKN ALYMTQFW+V  NAFSGQSIMESWT+++
Sbjct: 985  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTF 1044

Query: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773
            YN   T  PP      DQF  S LL R  Q   +GQ+G+F+   IF G  +NG YH+ + 
Sbjct: 1045 YNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWIT 1104

Query: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833
              G ++ YRYG A  MHGE ADHW WG+A+  +SI+ VLGKAAL+TNQWTKFT+ AIPGS
Sbjct: 1105 IDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKAALITNQWTKFTVLAIPGS 1164

Query: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893
             +FW++FFPIYA + P  N+S+EY+G+V H YGS TFW    VLPV AL+RD +WKYY+R
Sbjct: 1165 LVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVLPVLALLRDLLWKYYKR 1224

Query: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953
             Y PESYH+VQEMQK++ISDNRP ++ FQ  IRKVRQVQRMKKQRGFAFSQSEE GQD+I
Sbjct: 1225 TYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVRQVQRMKKQRGFAFSQSEEAGQDRI 1284

Query: 954  IRMYDTTQKRGVYGELHDA--NPFSN 977
            +RMYDTTQKRG +GEL D   NPF +
Sbjct: 1285 VRMYDTTQKRGTHGELQDPSMNPFKD 1310

 Score =  496 bits (1277), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 240/357 (67%), Positives = 293/357 (82%), Gaps = 4/357 (1%)

Query: 165 NTKPSDSGSYEMNRYNAVTNNELDGRYADSRNRFNIKILFNRYILRKNVGA-SDDGTPRE 223
            T+ S   S+EM  Y    + +   RY  SRN+FN+K LF+ Y+LRK   A +  G PR 
Sbjct: 124 GTENSQYQSFEMQDYRDTHSGD---RYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRV 180

Query: 224 IYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSP 283
           IY+N+R AN A  YGDNHISTTKYN ATFLPKFLFQEFSKYANLFFL T+ IQQVP+V+P
Sbjct: 181 IYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP 240

Query: 284 TNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRA 343
           TNR+TT+GTL+VVL+VSA KES+ED+KR+NSDKELN+S+ ++YS+E G FI ++WIDI  
Sbjct: 241 TNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAV 300

Query: 344 GDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLN 403
           GD+IRV+SEEAIPADLIV+SSSEPEGLCYIETANLDGETNLKIKQARPET++++D R+L+
Sbjct: 301 GDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELS 360

Query: 404 NFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHET 463
             +GK++SEQPN+SLYTYEGT+  +N +IPLSP+Q++LRGATLRNT W+FG+VIFTGHET
Sbjct: 361 AMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHET 420

Query: 464 KLMRNATATPIKRTAVERVINLQIVALFGXXXXXXXXXXXGNAIISSTQEKHLSYLY 520
           KL RNATATPIKRTAVERVINLQIVALFG           GN I+   Q+++LSYLY
Sbjct: 421 KLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLY 477

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  255 bits (652), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 139/366 (37%), Positives = 213/366 (58%), Gaps = 11/366 (3%)

Query: 544  ALKEHKLSQHEMNTLALVIDGKSLSYALES-DLEDYLLALGKICKAVVCCRVSPLQKALV 602
            A  EH + + E    A++IDG++L YAL + D++   L L K CK+V+CCRVSP QKA V
Sbjct: 1063 AKAEHDIPRGE---FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAV 1119

Query: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662
            VK+VK     + LAIGDG+NDV+MIQ+A++GVGI+G EG QA  S+D A+GQFR+L +LL
Sbjct: 1120 VKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLL 1179

Query: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722
            LVHG W Y+R++  I   FYKN    +  FWF   N + G  + E   +++YN+ FT  P
Sbjct: 1180 LVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIP 1239

Query: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782
              ++G+FDQ VS  +   +PQLY++G   K +S   F  ++++G Y S + +    L YR
Sbjct: 1240 VILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYR 1299

Query: 783  YGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIF 840
              M +  +G   DH  + + V  ++I  +     ++  Q  W  F  F +  S    MIF
Sbjct: 1300 RHMIVTSNGLGLDH-RYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSI---MIF 1355

Query: 841  FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY 900
            F  +  ++  A+ S E++      +G+ TFW  L V  +F L+  F    ++R + P+  
Sbjct: 1356 F-TWTGIWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDI 1414

Query: 901  HLVQEM 906
             +++EM
Sbjct: 1415 DIIREM 1420

 Score =  141 bits (356), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 109/162 (67%), Gaps = 6/162 (3%)

Query: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392
           F +  W +++ GD++R+ + E IPAD+I++S+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 400 FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKC 459

Query: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN------RKIPLSPEQMILRGATL 446
           T+++  S  +   +  + SE P+++LY+Y+G   +N+      +  P++   ++LRG TL
Sbjct: 460 TSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTL 519

Query: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIV 488
           RNT W  G+V FTG +TK+M NA  TP K++ + + +NL ++
Sbjct: 520 RNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVL 561

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (50%), Gaps = 8/114 (7%)

Query: 222 REIYLN--------DRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTA 273
           R IY N        D       NY  N I TTKY   TFLPK +  +F  +AN++FL   
Sbjct: 173 RNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILI 232

Query: 274 AIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYS 327
            +        TN   +   L+V++I++A K+ IED +R   D E+NN+KT + +
Sbjct: 233 ILGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLT 286

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  243 bits (620), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 137/376 (36%), Positives = 209/376 (55%), Gaps = 11/376 (2%)

Query: 544  ALKEHKLSQHEMNTLALVIDGKSLSYAL-ESDLEDYLLALGKICKAVVCCRVSPLQKALV 602
            A K+H+  +      A+VIDG +L  AL   D+    L L K C+AV+CCRVSP QKA V
Sbjct: 1057 AKKDHEFPK---GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAV 1113

Query: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662
            VK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D A+GQFR+L +L+
Sbjct: 1114 VKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLV 1173

Query: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722
            LVHG WSY+R++  I   FYKN    +  FW+   N F G  + E   M +YN+ FT  P
Sbjct: 1174 LVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLP 1233

Query: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782
               +G+ DQ V+  +    PQLY++G   K ++ R F  ++++G Y S + +    L Y 
Sbjct: 1234 VIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYH 1293

Query: 783  YGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIF 840
              M +  +G   DH  + + VY ++I ++     ++ +Q  W  F+   I  S +    +
Sbjct: 1294 KNMIVTSNGLGLDH-RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAW 1352

Query: 841  FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY 900
              I++S    A  SRE+F      YG+ +FW    V  +F L+  F +  +++ + P   
Sbjct: 1353 TGIWSS----AIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDV 1408

Query: 901  HLVQEMQKFNISDNRP 916
             +V+EM +    D+ P
Sbjct: 1409 EIVREMWQHGHFDHYP 1424

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 109/165 (66%), Gaps = 6/165 (3%)

Query: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392
           F +  W  ++ GD++R+ + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 393 FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452

Query: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN------RKIPLSPEQMILRGATL 446
           T  +  S+ +   K  + SE P+S+LYTY+G +++ N      R  P++   ++LRG TL
Sbjct: 453 TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512

Query: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALF 491
           RNT W  G+V+FTG +TK+M N+  TP K++ + R +N  +V  F
Sbjct: 513 RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINF 557

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 54/98 (55%)

Query: 228 DRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRY 287
           D   N    Y  N I TTKY   TFLPK +  +F  +AN++FL    +        TN  
Sbjct: 182 DEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPG 241

Query: 288 TTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325
            +   L+V++I++A K++IED +R   D E+NN+KT I
Sbjct: 242 LSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHI 279

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  240 bits (612), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 151/452 (33%), Positives = 228/452 (50%), Gaps = 32/452 (7%)

Query: 528  VEFEFHTRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALES-DLEDYLLALGKIC 586
            +E  F+ + +  +   A K+H   Q   +   +VIDG +L  AL   D+    L L K C
Sbjct: 1046 LETHFNMKGSPEELAAARKDHTPPQ---SAFGVVIDGDALKLALHGEDIRRKFLLLCKNC 1102

Query: 587  KAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR 646
            KAV+CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQAA VG+GI+G EG QA  
Sbjct: 1103 KAVLCCRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVM 1162

Query: 647  SADIAVGQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIM 706
            SAD A+GQFR+L +L+LVHG WSY+R++  I   FYKN    +  FWF   + + G  + 
Sbjct: 1163 SADYAIGQFRYLTRLVLVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLF 1222

Query: 707  ESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNG 766
            E   + +YN+ FT  P   +G+ DQ  S  L    PQLYK+G     ++   FW +  +G
Sbjct: 1223 EYTYLMFYNLAFTSLPVIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDG 1282

Query: 767  FYHSAVVYIGTML-FYRYGM-ALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--W 822
             Y S + +    L +YR G+   N +G   DH  +   V+ +SI +V     ++ +Q  W
Sbjct: 1283 VYQSIICFFFPYLCYYRTGLITKNAYG--LDH-RYTFGVFVTSIAVVSCNLYVLIHQYRW 1339

Query: 823  TKFT---LFAIPGSFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPV 879
              FT   +F   G   FW         V+  A  S E++      Y    FW  L V  +
Sbjct: 1340 DWFTTLFIFLSCGILFFW-------TGVWSSATYSGEFYKTAVRLYAQPVFWAVLFVGVI 1392

Query: 880  FALMRDFVWKYYRRMYEPESYHLVQEM----------QKFNISD-NRPHVQHFQNEIRKV 928
            F L+  F W   ++++ P    +V+E           + ++ +D NRP +      + + 
Sbjct: 1393 FCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDMYPEDYDPTDPNRPRINVSHTGVDRA 1452

Query: 929  RQVQRMKKQRGFAFSQSEEGGQDKIIRMYDTT 960
               +R +       +++    +D  + + D T
Sbjct: 1453 SDDERSRTGSDLGVTRTTVISEDIPMGLIDKT 1484

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 111/165 (67%), Gaps = 6/165 (3%)

Query: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392
           F +  W DIR GD++R+ + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 400 FGKSHWKDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKC 459

Query: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI------PLSPEQMILRGATL 446
           +  + +S+ ++  K  V SE P+++LY+Y+G  ++ + +       P++   M+LRG +L
Sbjct: 460 SHRIRNSKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSL 519

Query: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALF 491
           RNT W  G+V+FTG +TK+M NA  TP KR+ + R +N  ++  F
Sbjct: 520 RNTKWAMGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNF 564

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 8/120 (6%)

Query: 214 GASDDGTPREIYLN--------DRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYA 265
           G S     R +Y N                NY  N I TTKY   +FLPK L  +F   A
Sbjct: 172 GKSRAAEKRAVYFNMPLPPELTGENGRPVVNYPRNKIRTTKYTPLSFLPKNLAYQFKNAA 231

Query: 266 NLFFLCTAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325
           N++FL    +  V     TN       L+ +++++  K++ ED +R   D E+NN ++ I
Sbjct: 232 NIYFLLLVCLSFVSIFGVTNPALAAIPLIAIVVITGLKDAFEDSRRTILDLEVNNMRSHI 291

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  230 bits (586), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/362 (35%), Positives = 197/362 (54%), Gaps = 8/362 (2%)

Query: 558  LALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLA 616
             A+VIDG +L  AL  D ++   L L K CKAV+CCRVSP QKA VVK+VK     + LA
Sbjct: 1064 FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLA 1123

Query: 617  IGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVA 676
            IGDG+NDV+MIQ+A VG+GI+G EG QA   +D A+GQFR+L +LLLVHG WSY+R+S  
Sbjct: 1124 IGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEM 1183

Query: 677  ILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSR 736
            I   FYKN    +  FW+   N F G  + E   + +YN+ FT  P  ++G+ DQ V+  
Sbjct: 1184 IPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDT 1243

Query: 737  LLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADH 796
            +    PQLY++G     ++   F  ++ +G Y S + +    L Y+    +  +G   +H
Sbjct: 1244 ISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEH 1303

Query: 797  WSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIFFPIYASVFPYANIS 854
              + + +  ++I +      ++ +Q  W  F+ F I  S I  + +  I+ S F     S
Sbjct: 1304 -RYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSF----TS 1358

Query: 855  REYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQEMQKFNISDN 914
             + +   +  Y S +FW    +   F L+  F W  Y + + P    +++EM K    D+
Sbjct: 1359 LDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDH 1418

Query: 915  RP 916
             P
Sbjct: 1419 YP 1420

 Score =  145 bits (365), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 109/165 (66%), Gaps = 6/165 (3%)

Query: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392
           F    W  ++ GD++R+ + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++QA   
Sbjct: 389 FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448

Query: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN------RKIPLSPEQMILRGATL 446
           + ++  SR +   +  + SE P+++LY+Y+G L++ +      R  P++   M+LRG TL
Sbjct: 449 SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508

Query: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALF 491
           RNT W  G+V+FTG +TK+M NA  TP K++ + R +N  ++  F
Sbjct: 509 RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINF 553

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 102/230 (44%), Gaps = 33/230 (14%)

Query: 119 FQDEESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDSGSYEMNR 178
            +++E+T  D    E ++ QP  +  G + G F        ++ + N   +DS S EM R
Sbjct: 53  MEEKETTLADDTDIEISSIQPTPHLGGAKTGMF-------DDVALDNDDHNDS-SREMKR 104

Query: 179 YNAVTNNELDGRYAD----SRNRF------NIKILFNRYILRKNVGASDDGTPRE----- 223
               T   + G  +     SRN+       NIK  F+ +  R     +D  T R      
Sbjct: 105 LRMGTR-RVKGHKSQFGNMSRNKTLKWAKKNIKNPFDDFS-RDEEEENDRSTNRADQLRT 162

Query: 224 IYLN--------DRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAI 275
           +Y N        D   N    Y  N I TTKY   +F PK L  +F  +AN++FL    +
Sbjct: 163 VYHNLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIIL 222

Query: 276 QQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325
                   TN   +   L+V++I++A K+ IED +R   D E+NN++T I
Sbjct: 223 GAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHI 272

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  229 bits (583), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/373 (34%), Positives = 205/373 (54%), Gaps = 10/373 (2%)

Query: 549  KLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALVVKMVK 607
            K+ +       ++IDG +L  AL +D ++   L L K CKAV+CCRVSP QKA VVK+VK
Sbjct: 1101 KVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVK 1160

Query: 608  RKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGS 667
                 + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D A+GQFR+L +L+LVHG 
Sbjct: 1161 NTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGR 1220

Query: 668  WSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIG 727
            WSY+R++  I   FYKN    ++ FW+   N + G  + E   ++ +N+ FT  P   +G
Sbjct: 1221 WSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLG 1280

Query: 728  VFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV-YIGTMLFYRYGMA 786
            + DQ V+  +    PQLY++G     ++   FW ++ +  Y S +  ++  + +Y+ G+ 
Sbjct: 1281 ILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGI- 1339

Query: 787  LNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIFFPIY 844
            +  +G   DH  W + V+ ++I +V     ++ +Q  W  F+   I  S +    +  I+
Sbjct: 1340 VTQNGFGLDHRYW-VGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIW 1398

Query: 845  ASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQ 904
            +S       S E++    H YG   FW  +    +F L+  F    + R Y P+   +++
Sbjct: 1399 SSF----TSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIR 1454

Query: 905  EMQKFNISDNRPH 917
            E  K    D+ P 
Sbjct: 1455 ECWKRGDFDHYPE 1467

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 110/166 (66%), Gaps = 6/166 (3%)

Query: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392
           F +  W  +  GD++RV + + IPAD+I++SSS+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 438 FAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKC 497

Query: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI------PLSPEQMILRGATL 446
           +  + +SR +   K KV SE P+S+LY+Y+G L++ +R+       P++   ++LRG TL
Sbjct: 498 SHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTL 557

Query: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALFG 492
           RNT W  G+V+FTG +TK+M NA  TP K + + R +NL +   F 
Sbjct: 558 RNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFA 603

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 8/112 (7%)

Query: 222 REIYLN--------DRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTA 273
           R IY N        D   N    Y  N I TTKY   TF PK +  +F   AN++FL   
Sbjct: 217 RTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLI 276

Query: 274 AIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325
            +         N       L+V++++++FK++IED +R   D E+NN+ T I
Sbjct: 277 IMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHI 328

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  229 bits (583), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 136/396 (34%), Positives = 215/396 (54%), Gaps = 24/396 (6%)

Query: 544  ALKEHKLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALV 602
            A +EH L Q      A++IDG +L  AL  + +    L L K CKAV+CCRVSP QKA V
Sbjct: 1100 AKREHGLPQ---GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAV 1156

Query: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662
            VK+VK+    + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D A+GQFR++ +L+
Sbjct: 1157 VKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1216

Query: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722
            LVHG W Y+R++  I   FYKN    ++ FW+   N F G  + E   +++YN+ FT  P
Sbjct: 1217 LVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVP 1276

Query: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782
              ++ V DQ VS  +    PQLY++G   K ++   F  ++++G Y S + +    L Y 
Sbjct: 1277 VILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYH 1336

Query: 783  YGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFI-FWMIFF 841
              M +  +G   DH  + + V+ ++I +      +   Q+ ++  F   G FI   +  F
Sbjct: 1337 KNMVVTENGLGLDH-RYFVGVFVTAIAVTSCNFYVFMEQY-RWDWFC--GLFICLSLAVF 1392

Query: 842  PIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYH 901
              +  ++  ++ S E++      +    +W  L V  +F L+  F     R+++ P+   
Sbjct: 1393 YGWTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIE 1452

Query: 902  LVQEM----------QKFNISD-NRPHVQHFQNEIR 926
            +V+EM          Q ++ +D +RP +    NEIR
Sbjct: 1453 IVREMWLRGDFDLYPQGYDPTDPSRPRI----NEIR 1484

 Score =  145 bits (365), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 109/165 (66%), Gaps = 6/165 (3%)

Query: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392
           F +  W +++ GD++RV + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 438 FAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKC 497

Query: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEF------NNRKIPLSPEQMILRGATL 446
           +  +  SR +   K  V SE P+++LY+Y+G  ++      N R  P++   ++LRG TL
Sbjct: 498 SKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTL 557

Query: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALF 491
           RNT W  G+VIFTG +TK+M NA  TP K++ + R +N  ++  F
Sbjct: 558 RNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNF 602

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%)

Query: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVV 296
           Y  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+V+
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 297 LIVSAFKESIEDIKRANSDKELNNSKTEIYS 327
           +I++A K+ IED +R   D E+NN++T I S
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319

>Scas_576.8
          Length = 1591

 Score =  228 bits (582), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 200/366 (54%), Gaps = 11/366 (3%)

Query: 544  ALKEHKLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALV 602
            A K H   + +    A+VIDG++L  AL  + +    L L K CKAV+CCRVSP QKA V
Sbjct: 1073 AKKNHDFPRGD---FAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAV 1129

Query: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662
            VK+V      + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D A+GQFR+L +L+
Sbjct: 1130 VKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLV 1189

Query: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722
            LVHG WSY+R++  I   FYKN    +  FW+   N F G  + E   + +YN+ FT  P
Sbjct: 1190 LVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLP 1249

Query: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782
               +G+ DQ VS  +    PQLY+ G     ++   F  ++++G Y S + +      Y 
Sbjct: 1250 VIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYCLYH 1309

Query: 783  YGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIF 840
                ++ +G   DH  + + V  +S+ +V     ++ +Q  W  F+   I  S I  ++F
Sbjct: 1310 KNQIVSNNGLGLDHRFY-VGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCI--ILF 1366

Query: 841  FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY 900
            F  +  V+  +  S+E+F      YG+ +FW    V  V+ L+  F    +R+ + P   
Sbjct: 1367 F--WTGVWSSSLTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRKFFYPTDV 1424

Query: 901  HLVQEM 906
             +V+EM
Sbjct: 1425 EIVREM 1430

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 111/161 (68%), Gaps = 6/161 (3%)

Query: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392
           F +  W +++ GD++R+ + + IPAD+I++S+S+ +G CY+ET NLDGETNLK++++   
Sbjct: 409 FSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKC 468

Query: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI------PLSPEQMILRGATL 446
           +  + +SR +   K  V SE P+++LY+Y+G +++ + K       P++   ++LRG TL
Sbjct: 469 SHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTL 528

Query: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQI 487
           RNT W  G+V+FTG +TK+M N+ ATP K++ + R +NL +
Sbjct: 529 RNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSV 569

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 2/105 (1%)

Query: 221 PREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPH 280
           P+E+   D       +Y  N I TTKY+   F PK +  +F  +AN++FL    +     
Sbjct: 187 PKEMV--DEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQI 244

Query: 281 VSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325
              TN       L+V++I++A K++IED +R   D E+NN++T I
Sbjct: 245 FGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHI 289

>Scas_636.16
          Length = 1554

 Score =  228 bits (581), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 204/370 (55%), Gaps = 19/370 (5%)

Query: 544  ALKEHKLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALV 602
            A K+H   Q E    A++IDG++L  AL  D ++   L L K CKAV+CCRVSP QKA V
Sbjct: 1036 AKKDHSPPQGE---FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV 1092

Query: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662
            VK+VK     + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D A+GQFR++ +L+
Sbjct: 1093 VKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1152

Query: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722
            LVHG W Y+R++  I   FYKN    +  FW+   N F G  + E   +++YN+ FT  P
Sbjct: 1153 LVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLP 1212

Query: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782
               +G+ DQ VS+ +    PQLY+ G   + ++   F  ++ +G Y S + Y    L YR
Sbjct: 1213 VIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYR 1272

Query: 783  YGMALNMHGEVADHWSW------GIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIF 836
                +  +G   DH  +      GIAV + +  +++ +      +W  FT F    +F+ 
Sbjct: 1273 KTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQY-----RWDWFTTFF---AFLS 1324

Query: 837  WMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYE 896
             +++F  +  ++  +  S E++      YG+ +FW    V  +F ++  F +  + +   
Sbjct: 1325 TIVYFG-WTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLY 1383

Query: 897  PESYHLVQEM 906
            P    +++EM
Sbjct: 1384 PSDVEIIREM 1393

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 116/194 (59%), Gaps = 11/194 (5%)

Query: 309 IKRANSDKELNNSKTEIYSEE-----NGDFIERRWIDIRAGDVIRVKSEEAIPADLIVIS 363
           ++++N D    N +  +         N  F    W ++R GD++R+ + + IPAD+I++S
Sbjct: 343 LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402

Query: 364 SSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNSSLYTYEG 423
           +S+ +G CY+ET NLDGE+NLK++Q+   T  + +SR +   K  V SE P+++LY Y+G
Sbjct: 403 TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462

Query: 424 TLEF------NNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKRT 477
            L++           P++   M+LRG TLRNT W  G+V+FTG +TK M NA  TP K++
Sbjct: 463 NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522

Query: 478 AVERVINLQIVALF 491
            + R +N  ++  F
Sbjct: 523 RISRELNFSVLINF 536

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%)

Query: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVV 296
           Y  N I TTKY   TF PK +  +F+ +AN++FL    +        TN       L+V+
Sbjct: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVI 227

Query: 297 LIVSAFKESIEDIKRANSDKELNNSKTEI 325
           +I++A K++IED +R   D E+NN++T I
Sbjct: 228 IILTAIKDAIEDSRRTLLDMEVNNTRTHI 256

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  214 bits (546), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 198/358 (55%), Gaps = 20/358 (5%)

Query: 560  LVIDGKSLSYALESDLEDYLLALGKIC---KAVVCCRVSPLQKALVVKMVKRKTSSLL-L 615
            +VIDG +L  A+  D    +    ++C    +VVCCR SP QKAL+V  ++    S++ L
Sbjct: 1108 IVIDGATL--AMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTL 1165

Query: 616  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISV 675
            AIGDGAND++MIQ+A +GVGI+G EG+QA+RSAD ++GQFRF+ KLLLVHG ++Y R + 
Sbjct: 1166 AIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAK 1225

Query: 676  AILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSS 735
             IL +FYK    Y+TQ  +     FSG S+ E W++S YN  FT  P   +G+F++ +  
Sbjct: 1226 FILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKP 1285

Query: 736  RLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV-YIGTMLFYRYGMALNMHGEVA 794
              L   P+LY +G+  K F+  IF  W+  G  ++ ++ ++  + +    ++ N      
Sbjct: 1286 VTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANALIITFLNIVAWGETSLSDNT----- 1340

Query: 795  DHWSWGIAVYTSSILIVLGKAALV---TNQWTKFTLFAIP-GSFIFWMIFFPIYASVFPY 850
              +  G   +++++ ++  KA  +      W  FT   +  G ++ W    PI       
Sbjct: 1341 -LYPLGFVNFSATVALINVKAQFIEMRNRNWLAFTSVILSCGGWLVWCCALPILNRSDGI 1399

Query: 851  ANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQEMQK 908
             +++   +G+  H     TFW T ++L V  ++ D V+K ++ M  P    +  E+++
Sbjct: 1400 YDVT---YGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQ 1454

 Score =  176 bits (445), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 163/313 (52%), Gaps = 51/313 (16%)

Query: 223 EIYLNDRTAN-----HAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQ 277
           +IY  DR  N     + + Y +N I++++Y I +F P+ L+ +FSK AN++F   A +Q 
Sbjct: 104 DIYPVDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQM 163

Query: 278 VPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI----YSEENGDF 333
           +P  S T  YTT+  L V + +S  +E+ +D +R   DKE NN  T++    +  E+ D 
Sbjct: 164 IPGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDL 223

Query: 334 -----------------------------------IERRWIDIRAGDVIRVKSEEAIPAD 358
                                              +E++W DIR GD + ++ ++ +PAD
Sbjct: 224 DLENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPAD 283

Query: 359 LIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRK-LNNFKGKVISEQPNSS 417
           +++++S       +IET  LDGETNLK K   PE  ++  S   L N   +V  E PN+ 
Sbjct: 284 ILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNND 343

Query: 418 LYTYEGTLEFNN-----RKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATAT 472
           LY +EG LE N+     +K PL P+ +I RG+ +RNT    G+VIFTG E+K+  NA   
Sbjct: 344 LYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRN 403

Query: 473 P-IKRTAVERVIN 484
           P  K   ++R IN
Sbjct: 404 PRTKAPKLQRKIN 416

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  211 bits (538), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 205/378 (54%), Gaps = 15/378 (3%)

Query: 537  NMRDKIMALKEHKLSQHEMNTLALVIDGKSLS-YALESDLEDYLLALGKICKAVVCCRVS 595
            N+  K+ AL E +L   ++    LVIDG SL+ +     +    + L     +V+CCR S
Sbjct: 1065 NLISKMTALGE-ELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRAS 1123

Query: 596  PLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQ 654
            P QKAL+V  ++ K   L+ LAIGDGAND++MIQ+A +GVGI+G EG+QA+RS+D ++ Q
Sbjct: 1124 PSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQ 1183

Query: 655  FRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYY 714
            FR+L KLL VHG ++Y R S  +L +FYK    Y+TQ  +     FSG S+ E W++S +
Sbjct: 1184 FRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMF 1243

Query: 715  NVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVY 774
            N  FT  P   IG+F++ +    L   P+LY +GQ+ + F+++IF  W++     S  V 
Sbjct: 1244 NTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGIS--VL 1301

Query: 775  IGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ---WTKFTLFAIP 831
            I  + F  +G        +   +  G+  +TS   ++  K   +  +   W  F    I 
Sbjct: 1302 ITFLNFEIWGFTAQSDNSI---YPIGVINFTSICFLINVKCQFIETRNRNWLAFASLLI- 1357

Query: 832  GSFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSG-TFWLTLIVLPVFALMRDFVWKY 890
             S I W+++  +   ++    I     G+  H +G   T+W + ++L +F +M D V + 
Sbjct: 1358 -SCIGWILWCCLLPGIYGENAIYDVLIGLY-HQFGRDITWWASCLILIMFPMMIDIVCQT 1415

Query: 891  YRRMYEPESYHLVQEMQK 908
            +R M  P    +  E+++
Sbjct: 1416 FRAMIWPTDGDIFAELEQ 1433

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 154/311 (49%), Gaps = 59/311 (18%)

Query: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVV 296
           Y DN I++++Y + +FLP+ L+ +FSK AN +FL  A +Q +P  S T  YTT+  L + 
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 297 LIVSAFKESIEDIKRANSDKELNNSKTE---------------IYSEEN----------G 331
           L +S  +E+ +D KR   DKE NN  T+               IYS  N           
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 332 DF--------------------------------IERRWIDIRAGDVIRVKSEEAIPADL 359
           DF                                 ++ W D++ G+ + + S++ +PAD+
Sbjct: 236 DFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADI 295

Query: 360 IVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRK-LNNFKGKVISEQPNSSL 418
           +++S+       ++ET  LDGETNLK K   PE A+ M S   L+        E PN+ L
Sbjct: 296 LLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDL 355

Query: 419 YTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATP-IKRT 477
           Y +EGT+E +    PL  + ++ RG+ LRNT  + G+VIFTG ETK+  NA   P  K  
Sbjct: 356 YNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTKAP 415

Query: 478 AVERVINLQIV 488
            ++  INL ++
Sbjct: 416 KLQGKINLIVL 426

>Kwal_23.3556
          Length = 1597

 Score =  204 bits (519), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/382 (32%), Positives = 208/382 (54%), Gaps = 21/382 (5%)

Query: 536  KNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESD--LEDYLLALGKICKAVVCCR 593
            +N+  K+ A+ + ++ +  +    +VIDG +L+   ES+  L    + L     +V+CCR
Sbjct: 1084 ENISSKLTAVSQ-EIERGNIAHCVVVIDGSTLT-TFESNPTLMSVFVELCTKTDSVICCR 1141

Query: 594  VSPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAV 652
             SP QKAL+V  ++     L+ LAIGDGAND++MIQ+A +GVGI+G EG+QA+RS+D ++
Sbjct: 1142 ASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSI 1201

Query: 653  GQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMS 712
             QFRFL KLLLVHG ++Y R +  +L +FYK    Y+TQ  +     FSG S+ E W++S
Sbjct: 1202 AQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLS 1261

Query: 713  YYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAV 772
             +N  FT  P   IG+F++ +    L   P+LY +G+  + F++R+F  W+     +S +
Sbjct: 1262 MFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLI 1321

Query: 773  VYIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVT----NQWTKFTLF 828
            +   T L ++     ++       +  G+  +T+ I +V  K  L+     N     +L 
Sbjct: 1322 I---TFLNWKIWAVSSLSDNTV--YPIGVINFTAIITLVNVKCQLLETHNRNVLAICSLV 1376

Query: 829  AIPGSFIFWMIFFP-IYASVFPYANISREYFGVVKHTYGSG-TFWLTLIVLPVFALMRDF 886
               G ++ W    P IY+    Y  ++  YF      +G+  TFW   +VL V  L+ D 
Sbjct: 1377 ISVGGWLLWCCLLPGIYSEDGMYDVLTGLYF-----QFGNDITFWCACLVLVVLPLIIDV 1431

Query: 887  VWKYYRRMYEPESYHLVQEMQK 908
            V+K  + M  P    +  E+++
Sbjct: 1432 VFKTVKIMIFPSDSEISMELEQ 1453

 Score =  179 bits (453), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/333 (32%), Positives = 169/333 (50%), Gaps = 64/333 (19%)

Query: 218 DGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQ 277
           DG  +   L D  +     Y  N I++++Y I TFLP+ L+ +FS+ AN +F   A +Q 
Sbjct: 91  DGGSQTAKLTDERSGKP--YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQM 148

Query: 278 VPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNN----------------- 320
           +P  S T  YTT+  L++ + +S  +E+ +D +R   D+E N+                 
Sbjct: 149 IPGWSTTGTYTTIVPLLIFMGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFS 208

Query: 321 ---------------------------SKTEIYSEENGDF--------------IERRWI 339
                                      S  E  + +N D               +E++W 
Sbjct: 209 RPNSLYSLPQWQQSATSTSMLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWK 268

Query: 340 DIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDS 399
           DI+ GD + ++ +E +PAD++V++ S+ +  C++ET  LDGETNLK KQ   E +E+M +
Sbjct: 269 DIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKT 328

Query: 400 RK-LNNFKGKVISEQPNSSLYTYEGTLEF--NNRKIPLSPEQMILRGATLRNTSWMFGLV 456
              L  FK KV  E PN  L+ +EG LE    NRK+ + P+ +I RG+ +RNTS   G+V
Sbjct: 329 AAGLTEFKAKVTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMV 388

Query: 457 IFTGHETKLMRNATATP-IKRTAVERVINLQIV 488
           +FTG ETK+  NA   P IK   ++R INL ++
Sbjct: 389 VFTGEETKIRMNAIKNPRIKAPKLQRAINLIVL 421

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  203 bits (517), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 208/385 (54%), Gaps = 23/385 (5%)

Query: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKIC---KAVV 590
            T +N+  K+ A+ + ++    +    +VIDG ++  A+      Y+    ++C    +V+
Sbjct: 1143 TDENIISKMNAVSQ-EVDSGNIAHCVVVIDGATM--AMFEGNPTYMSVFVELCTKTDSVI 1199

Query: 591  CCRVSPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD 649
            CCR SP QKAL+V  ++    +L+ LAIGDGAND++MIQ+A +GVGI+G EG+QA+R +D
Sbjct: 1200 CCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSD 1259

Query: 650  IAVGQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESW 709
             ++GQFRFL KLL VHG ++Y R S  +L +FYK    Y TQ  +     FSG S+ E W
Sbjct: 1260 YSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPW 1319

Query: 710  TMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYH 769
            ++S +N  FT  P   IG+F++ +    L   P+LY  G+  + F+  IF  W++    +
Sbjct: 1320 SLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTN 1379

Query: 770  SAVVYIGTMLFYRYGMALNMHGEVADH--WSWGIAVYTSSILIVLGKAALV---TNQWTK 824
            S ++    ++   +GM+      ++D+  +  G+  +T+ + ++  K+  V      W  
Sbjct: 1380 SLIITFLNVVM--WGMS-----SLSDNTMYPLGLINFTAIVALINVKSQFVEMHNRNWLA 1432

Query: 825  FTLFAIP-GSFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALM 883
            FT   +  G ++ W    PI  +     +++   +G   H     TFW T +VL +  + 
Sbjct: 1433 FTSVVLSCGGWLVWCCALPILNNTDQIYDVA---YGFYNHFGKDITFWCTSLVLALLPIT 1489

Query: 884  RDFVWKYYRRMYEPESYHLVQEMQK 908
             D V+K ++ M  P    +  E+++
Sbjct: 1490 LDIVYKTFKVMIWPSDSDIFAELEQ 1514

 Score =  165 bits (417), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 162/338 (47%), Gaps = 70/338 (20%)

Query: 219 GTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQV 278
            T R+ +L D   N    Y DN I++++Y   +FLP+ L+ +FSK AN +F   A +Q +
Sbjct: 122 ATKRDGHLIDERFNKP--YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMI 179

Query: 279 PHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELN------------NSKTEIY 326
           P  S T  YTT+  L V + +S  +E+ +D +R   DKE N            N   E+Y
Sbjct: 180 PGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVY 239

Query: 327 S------------------EEN-----------GDFI-------------------ERRW 338
           +                  E N           G F+                   +++W
Sbjct: 240 TLPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKW 299

Query: 339 IDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMD 398
             +R GD + +  ++ +PADL++++       C++ET  LDGETNLK KQ  PE  ++  
Sbjct: 300 EKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTK 359

Query: 399 SRK-LNNFKGKVISEQPNSSLYTYEGTLEFNNR------KIPLSPEQMILRGATLRNTSW 451
           +   L N   +V  E PN  LY +EG LE  N       K PL P+ +I RG+ LRNT  
Sbjct: 360 AASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQN 419

Query: 452 MFGLVIFTGHETKLMRNATATP-IKRTAVERVINLQIV 488
           + G+VIF+G ETK+  NA   P  K   ++R IN+ IV
Sbjct: 420 VVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIV 457

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  186 bits (472), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 117/346 (33%), Positives = 180/346 (52%), Gaps = 19/346 (5%)

Query: 536  KNMRDKIMALKEHKLSQHEMNTLALVIDGKSLS-YALESDLEDYLLALGKICKAVVCCRV 594
            +NM  KI  + + ++    +    +VIDG +L+ +     L    + L     +V+CCR 
Sbjct: 1065 ENMASKITTITQ-EIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRS 1123

Query: 595  SPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653
            SP QKAL+V  +++    L+ LAIGDGAND++MIQ+A +GV I+G EG+QA+RS+D ++ 
Sbjct: 1124 SPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIA 1183

Query: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713
            QFR+L KLLLVHG ++Y R S  +L +FYK    Y+TQ  F     FSG S  E W ++ 
Sbjct: 1184 QFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTV 1243

Query: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773
            +N  FT  P   IG+F++ + S  L   P+LY  G+Q + F++ IF  W+      S ++
Sbjct: 1244 FNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVII 1303

Query: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALV---TNQWTKFTLFAI 830
                   +    +L    +    +  G+  YT+ +++V  K  L+      W  F  F I
Sbjct: 1304 CFTNWQCW----SLTAQSD-NTLYPIGLINYTAVVVLVNVKCQLLEMANRNWLAFASFFI 1358

Query: 831  P-GSFIFWMIFFP-IYASVFPYANISREYFGVVKHTYGSG-TFWLT 873
                ++ W +  P IY     Y      Y     H +G   TFW T
Sbjct: 1359 SVCGWLCWCLLLPAIYKETLVYDVREGLY-----HQFGPDITFWAT 1399

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 150/289 (51%), Gaps = 37/289 (12%)

Query: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVV 296
           Y  N I++++Y++ +FLP+ L  +FSK  N +F   A +Q VP+ S T +YTT+  L + 
Sbjct: 110 YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIF 169

Query: 297 LIVSAFKESIEDIKRANSDKELNNSKTEIYSE----ENGD-------------------- 332
           + +S  +E  ED +R   D+E NN   ++ ++    E GD                    
Sbjct: 170 MGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQ 229

Query: 333 ------FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKI 386
                  +E++W D+  G+ + +  ++ +PADL ++++      CY+ET  LDGETNLK 
Sbjct: 230 ANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKC 289

Query: 387 KQARPETA-EMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEF-----NNRKIPLSPEQMI 440
           K   P+ A +   +  L  F+G    E PN  LY +EG +E        +   +  + ++
Sbjct: 290 KHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGLDNVL 349

Query: 441 LRGATLRNTSWMFGLVIFTGHETKLMRNATATP-IKRTAVERVINLQIV 488
            RG+ +RNT  + G+V+FTG ETK+  NA   P IK   ++  INL ++
Sbjct: 350 FRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVL 398

>Scas_669.3
          Length = 1638

 Score =  185 bits (469), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 186/348 (53%), Gaps = 22/348 (6%)

Query: 560  LVIDGKSLS-YALESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLL-LAI 617
            ++IDG +L+ +     L    + L     +V+CCR SP QK+L+V  ++    +L+ LAI
Sbjct: 1142 IIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAI 1201

Query: 618  GDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAI 677
            GDGAND++MIQ+A +G+GI G EG+QA+R+AD ++ QFRF+ KLLLVHG ++Y R +  I
Sbjct: 1202 GDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFILKLLLVHGRYNYIRTAKFI 1261

Query: 678  LYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRL 737
            L +F+K    Y+TQ  F     FSG S+ E W++S +N  FT  P   IG+F++ +    
Sbjct: 1262 LCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMT 1321

Query: 738  LERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVA--D 795
            L   P+LY +G+  + F++ IF  W++    ++ ++    ++ +         GE A  D
Sbjct: 1322 LLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNIIIW---------GETALSD 1372

Query: 796  H--WSWGIAVYTSSILIVLGKAALV---TNQWTKFTLFAIP-GSFIFWMIFFPIYASVFP 849
            H  +  G+  +T+ + +V  K   +      W  FT   +  G ++ W    PI      
Sbjct: 1373 HTMYPLGVINFTAIVALVNVKCQFIEMNNRNWVVFTSVILSCGGWLVWCCALPILNRSDV 1432

Query: 850  YANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEP 897
              ++    +G   H     T+W +  VL V  +  D V++ ++ M  P
Sbjct: 1433 IYDVP---YGFFYHFGKDITWWCSCFVLAVLPITIDIVYQTFKTMIWP 1477

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/317 (31%), Positives = 163/317 (51%), Gaps = 55/317 (17%)

Query: 224 IYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSP 283
           + +++RT++    Y +N+I++++Y I +F PK L+ +FSK AN++F   A +Q +P  S 
Sbjct: 130 LLIDERTSSV---YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWST 186

Query: 284 TNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEE-------------- 329
           T  YTT+  L + + +S  +E+ +D +R   DKE NN    I ++E              
Sbjct: 187 TGTYTTIVPLCIFMGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPS 246

Query: 330 ---------------------NGDFIERR---------WIDIRAGDVIRVKSEEAIPADL 359
                                N  F+E R         W ++  GD + +K +  +PAD+
Sbjct: 247 RQNIDNLSNDSNTDYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADI 306

Query: 360 IVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRK-LNNFKGKVISEQPNSSL 418
           +V++S      C++ET  LDGETNLK+KQ  PE  ++  S   L N    +  E PNS L
Sbjct: 307 LVLTSDGDNNECFVETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDL 366

Query: 419 YTYEGTLEFNN------RKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATAT 472
           Y +EG LE  +      +K P+ P+ +  RG+ +RNT  + G+VI+TG ETK+  NA   
Sbjct: 367 YNFEGNLELTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNN 426

Query: 473 P-IKRTAVERVINLQIV 488
           P  K   +++ IN+ I 
Sbjct: 427 PRTKAPKLQKNINIIIT 443

>Kwal_23.5789
          Length = 1133

 Score =  148 bits (373), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 109/376 (28%), Positives = 175/376 (46%), Gaps = 29/376 (7%)

Query: 533  HTRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCC 592
            HT   +     AL   +L +   N+  L+IDG+SL   LE   + +   +  +  AV+ C
Sbjct: 779  HTVTKVNKPEGALTHLELLKINTNS-CLLIDGESLGLYLEYYRQQFFEIVVNL-PAVIAC 836

Query: 593  RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAV 652
            R +P QKA V   ++  T   +  IGDG NDVSMIQ+A VGVGI G EG QA+ +AD ++
Sbjct: 837  RCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSI 896

Query: 653  GQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMS 712
             QF  L KLLL HG  SY+R +    +  ++   + + Q  +  ++ F   ++ + W M 
Sbjct: 897  TQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMV 956

Query: 713  YYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAV 772
             Y   +T+ P F +   D  +   L + YP+LYK    GK  S + F+ W+V   +   V
Sbjct: 957  GYATCYTMAPVFSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015

Query: 773  VYIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ---WTKFTLFA 829
            +             L+      D   +   V  S  +++L +  +V  +   W K  + +
Sbjct: 1016 I-----------QGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVS 1064

Query: 830  IPGSFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWK 889
               +F+ ++   P+    F    +SR  +      YG     L+L ++PV+A       K
Sbjct: 1065 EVVTFLIFVGSVPLLEEYFDLTYMSRPEY------YGKLAIILSLSIIPVWAA------K 1112

Query: 890  YYRRMYEPESYHLVQE 905
               R   P SY  VQ+
Sbjct: 1113 ALHRRLNPPSYAKVQQ 1128

 Score =  118 bits (296), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 136/269 (50%), Gaps = 7/269 (2%)

Query: 217 DDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQ 276
           D    REI+ +       + Y  N IS  KYN  TF+PK L+++F  + NL+FL  A  Q
Sbjct: 136 DQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQ 195

Query: 277 QVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIER 336
            +P +      + +  L  VL V+  KE+++DI+R   D+E NN   E+ S+     +  
Sbjct: 196 AIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQ--LVPS 253

Query: 337 RWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEM 396
           +  D++ GD+I++      PADL+++ SSEP G  +I+T  LDGET+ K++ A P T  +
Sbjct: 254 K--DLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHL 311

Query: 397 MDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN-RKIPLSPEQMILRGATLRNTSWMFGL 455
                L  ++  + +  P  S+  + G L F   +  PLS +  +       +       
Sbjct: 312 SQDDLL--YRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIAC 369

Query: 456 VIFTGHETKLMRNATATPIKRTAVERVIN 484
           V++TG +T+   N + + +K   +E  IN
Sbjct: 370 VVYTGADTRQAMNTSMSSVKTGLLELEIN 398

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  145 bits (365), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 170/354 (48%), Gaps = 36/354 (10%)

Query: 559  ALVIDGKSLSYAL---ESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLL 615
             L+IDG+SL   L   E +  D ++ L      V+ CR +P QKA V  ++++ T   + 
Sbjct: 823  CLLIDGESLGMFLKHYEQEFFDVVVHL----PTVIACRCTPQQKADVALVIRKMTGKRVC 878

Query: 616  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISV 675
             IGDG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L +LLL HG  SY+R + 
Sbjct: 879  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAK 938

Query: 676  AILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSS 735
               +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 939  LAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIEE 997

Query: 736  RLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVAD 795
             L + YP+LYK   +GK  S + F+ W++   +  +V+ + +  F            +  
Sbjct: 998  SLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSL---------LDT 1048

Query: 796  HWSWGIAV-YTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANIS 854
             ++  +A+ +T+ ++  L   AL    W K  L     + +F+++  P     F      
Sbjct: 1049 DFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLG--- 1105

Query: 855  REYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVW---KYYRRMYEPESYHLVQE 905
              Y   V +  G     L ++++ +F      VW     YRR++ P SY  VQE
Sbjct: 1106 --YMTTVNYYAG----LLVILLISIFP-----VWTAKAIYRRLH-PPSYAKVQE 1147

 Score =  120 bits (302), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/270 (30%), Positives = 139/270 (51%), Gaps = 7/270 (2%)

Query: 216 SDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAI 275
           SD    REI+ +         Y  N +S  KYN  TF+P  L+++F  + NL+FL  A  
Sbjct: 149 SDQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALS 208

Query: 276 QQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIE 335
           Q VP +      + +  L  VL V+  KE+I+DI+R   D+E NN    + +      I 
Sbjct: 209 QAVPALRIGYLSSYIVPLAFVLTVTMAKEAIDDIQRRRRDRESNNELYHVITRNRS--IP 266

Query: 336 RRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAE 395
            +  D++ GD+I+V   + IPADL+++ SSEP G  +I+T  LDGET+ K++ A P T  
Sbjct: 267 SK--DLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQN 324

Query: 396 MMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI-PLSPEQMILRGATLRNTSWMFG 454
           + ++  +N     + +  P  S++ + G + + +    PLS +  +     L ++ +   
Sbjct: 325 LSENDLINRI--SITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIA 382

Query: 455 LVIFTGHETKLMRNATATPIKRTAVERVIN 484
            V++TG +T+   N T   +K   +E  IN
Sbjct: 383 CVVYTGRDTRQAMNTTTAKVKTGLLELEIN 412

>Scas_704.38
          Length = 1161

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 160/348 (45%), Gaps = 24/348 (6%)

Query: 559  ALVIDGKSLSYALESDLEDYLLALGKIC-KAVVCCRVSPLQKALVVKMVKRKTSSLLLAI 617
             L+IDG+SL   L     ++   +  IC   VV CR +P QKA V  +++  T   +  I
Sbjct: 833  CLLIDGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQKADVALVIREFTGKRVCCI 890

Query: 618  GDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAI 677
            GDG NDVSMIQ A VGVGI G EG QA+ +AD ++ +F  L +LLL HG  SY+R +   
Sbjct: 891  GDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLA 950

Query: 678  LYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRL 737
             +  ++   + + Q  +   + F    + + + M  Y   +T+ P F +   D  +   L
Sbjct: 951  QFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDHDIEESL 1009

Query: 738  LERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADHW 797
             + YP+LYK   +GK  S + F+ W     +   V+   + +F    + ++    VA   
Sbjct: 1010 TKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSL-LEVDFTKMVA--- 1065

Query: 798  SWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISREY 857
                  +T+ IL  L   AL    W K  +F    +F+ ++I  P     F    +    
Sbjct: 1066 ----IGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLR 1121

Query: 858  FGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQE 905
            F      YG   F L + V PV+A       K   R   P SY  VQE
Sbjct: 1122 F------YGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 141/275 (51%), Gaps = 9/275 (3%)

Query: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271
           +V   D    REI+ +         Y  N IS  KYN  TF+P  L+++F  + NL+FL 
Sbjct: 155 SVELDDRHMEREIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLV 214

Query: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEEN- 330
            A  Q +P +      + V  L  VL V+  KE+++DI+R   D   N S +E+Y   N 
Sbjct: 215 VALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRD---NESNSELYHVLNQ 271

Query: 331 GDFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQAR 390
              +  +  D++ GD+I++   + +PADL+++ SSEP G  +I+T  LDGET+ K++ A 
Sbjct: 272 SKLVPSK--DLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAP 329

Query: 391 PETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI-PLSPEQMILRGATLRNT 449
             T  + +   +N  K  + +  P  +++ + G + + +    PLS +  +     L +T
Sbjct: 330 ALTQNLTEPDLMN--KVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLAST 387

Query: 450 SWMFGLVIFTGHETKLMRNATATPIKRTAVERVIN 484
            +  G V++TG +T+   N T   +K   +E  IN
Sbjct: 388 GFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEIN 422

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  139 bits (349), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 162/350 (46%), Gaps = 28/350 (8%)

Query: 559  ALVIDGKSLSYAL---ESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLL 615
             L+IDG+SL   L   + +  D ++ L     AV+ CR +P QKA V  +++  T   + 
Sbjct: 815  CLLIDGESLGMFLTYYKQEFFDIVVDL----PAVIACRCTPQQKADVALLIREITGKRVC 870

Query: 616  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISV 675
             IGDG NDVSMIQ A VGVGI G EG QA+ +AD +V QF  L KLLL HG  SY+R + 
Sbjct: 871  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAK 930

Query: 676  AILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSS 735
               +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 931  LAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 989

Query: 736  RLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVAD 795
             L + YP+LYK    G   S + F+ W++   +    +  G   ++     ++    VA 
Sbjct: 990  SLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQ-GISQYFTSLDEVDFKKLVA- 1047

Query: 796  HWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISR 855
                    +T+ ++  L   AL    W K  +     +F+ +++  P  +  F    +S+
Sbjct: 1048 ------LSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQ 1101

Query: 856  EYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQE 905
              F      Y    F L + V PV+A       K   R   P +Y  VQ+
Sbjct: 1102 LPF------YAKLIFILAVSVFPVWAA------KAIHRKINPPNYAKVQQ 1139

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 140/274 (51%), Gaps = 7/274 (2%)

Query: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271
           ++  +D    REI+ +         Y  N IS  KYN  TF+P  L+++F  + NL+FL 
Sbjct: 141 SIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLL 200

Query: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENG 331
            A  Q +P +      + +  L  VL+V+  KE+++DI+R   DKE NN   E+ ++   
Sbjct: 201 VALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNK--A 258

Query: 332 DFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARP 391
             +  +  D++ GD+I++     IPADL+++ SSEP G  +I+T  LDGET+ K++ A  
Sbjct: 259 QLVPSK--DLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACS 316

Query: 392 ETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI-PLSPEQMILRGATLRNTS 450
            T  +     LN  K  + +  P  S++ + G L + +     LS +  +     L +  
Sbjct: 317 LTQNLSTDDLLN--KISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVG 374

Query: 451 WMFGLVIFTGHETKLMRNATATPIKRTAVERVIN 484
              G V++TG +T+   N T + +K   +E  IN
Sbjct: 375 SCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEIN 408

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  136 bits (343), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/349 (28%), Positives = 167/349 (47%), Gaps = 26/349 (7%)

Query: 559  ALVIDGKSLSYALESDLEDYLLALGKIC-KAVVCCRVSPLQKALVVKMVKRKTSSLLLAI 617
             L+IDG SL+  +     ++   +  IC   V+ CR +P QKA V  +++  T   +  I
Sbjct: 838  CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGKRVCCI 895

Query: 618  GDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAI 677
            GDG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L KLLL HG  SY+R +   
Sbjct: 896  GDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLS 955

Query: 678  LYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRL 737
             +  ++   + + Q  +  ++     ++ + W M  Y   +T+ P F +   D  +   L
Sbjct: 956  QFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESL 1014

Query: 738  LERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADHW 797
             + YP+LYK   +G+  S + F+ W++   +  AV+   + LF   G         ++ +
Sbjct: 1015 TKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVG---------SEVF 1065

Query: 798  SWGIAV-YTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISRE 856
               +A+ +T+ ++  L   AL    W K    +   +F  +++  P+    F   ++   
Sbjct: 1066 KKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLAL 1125

Query: 857  YFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQE 905
             F      +   T  LT+ + PV+A       K   R  +P S+  VQ+
Sbjct: 1126 PF------FIQLTIILTVSIFPVWAA------KTIHRRLKPPSHAKVQQ 1162

 Score =  126 bits (316), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 141/273 (51%), Gaps = 6/273 (2%)

Query: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271
           ++  +D    REI+L+         Y  N IS  KYN  TFLP  L+++F  + NL+FL 
Sbjct: 163 SIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLL 222

Query: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENG 331
            +  Q +P +      + +  L  VL+V+  KE+++DI+R   D+E NN   E+ +  N 
Sbjct: 223 VSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLN--NS 280

Query: 332 DFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARP 391
             +  +  ++R GD++++  +  IPAD+I++ SSEP G  +++T  LDGET+ K++ A  
Sbjct: 281 QLVPSK--NLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPS 338

Query: 392 ETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSW 451
            T  +     L   K  + +  P  S++ + G L +     PLS +  +     L ++  
Sbjct: 339 LTQNLTQDEMLT--KVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGT 396

Query: 452 MFGLVIFTGHETKLMRNATATPIKRTAVERVIN 484
               VI+TG +T+   N + + +K   +E  IN
Sbjct: 397 CVACVIYTGTDTRQAMNTSKSSVKTGLLELEIN 429

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 169/350 (48%), Gaps = 28/350 (8%)

Query: 559  ALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIG 618
             L+IDG+SL   L+   +++   +  +   V+ CR +P QKA V  +++  T   +  IG
Sbjct: 816  CLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIG 874

Query: 619  DGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAIL 678
            DG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L +LLL HG  SY+R +    
Sbjct: 875  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQ 934

Query: 679  YSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLL 738
            +  ++   + + Q  F   + F   ++ + W M  Y   +T+ P F +   D  +   L 
Sbjct: 935  FVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLT 993

Query: 739  ERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADHWS 798
            + YP+LYK   +GK  S + F+ W+   FY   V+          G +          ++
Sbjct: 994  KMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVI---------QGFSQTFTSLAEIDFT 1044

Query: 799  WGIAV-YTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISREY 857
              +A+ +T+ I   L   AL    W K  +       I  ++   IY    P+     EY
Sbjct: 1045 KMVAIGFTALIFNELIMVALEIYTWNKTMI-------ITEIVTLAIYVFSVPFLG---EY 1094

Query: 858  FGVVKHTYGSGTFWLT-LIVLPVFALMRDFVWK-YYRRMYEPESYHLVQE 905
            F +    Y S   ++T LI++ V ++   ++ K  YRR+  P SY  VQE
Sbjct: 1095 FDL---KYISTLKFITELILILVVSIFPVWLTKAIYRRLNLP-SYAKVQE 1140

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 139/274 (50%), Gaps = 7/274 (2%)

Query: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271
           +V   D+ T RE++           +  N +S  KYN  TFLP  L+++F  + NL+FL 
Sbjct: 139 SVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLL 198

Query: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENG 331
            A  Q +P +      + V  L  VL V+  KE+ +DI+R   D+E   S  E+Y E  G
Sbjct: 199 VALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRE---SNMELY-EVLG 254

Query: 332 DFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARP 391
                   D++ GD+I++     +PADLI++ SSEP G  +I+T  LDGET+ K++ A  
Sbjct: 255 RPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACT 314

Query: 392 ETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKIP-LSPEQMILRGATLRNTS 450
            T  + +   L   K  + +  P  S++++ G + + +     L+ +  +     L ++ 
Sbjct: 315 LTQNLNEDDLLE--KITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSG 372

Query: 451 WMFGLVIFTGHETKLMRNATATPIKRTAVERVIN 484
           +  G VI+TG +T+   N T+  +K   +E  IN
Sbjct: 373 FCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEIN 406

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  134 bits (338), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 140/300 (46%), Gaps = 10/300 (3%)

Query: 559  ALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIG 618
             L+IDG+SL   L+   +++   +  +   VV CR +P QKA V   +++ T   +  IG
Sbjct: 820  CLLIDGESLGLYLQYFPDEFFDIVVNL-PTVVACRCTPQQKADVAVFIRQATGKRVCCIG 878

Query: 619  DGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAIL 678
            DG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L KLLL HG  SY+  +    
Sbjct: 879  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQ 938

Query: 679  YSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLL 738
            +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +   L 
Sbjct: 939  FVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLT 997

Query: 739  ERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADHWS 798
              YP+LYK    GK  S + F+ W+    +   V+ + +  F     +LN     +D   
Sbjct: 998  TLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFF----TSLND----SDFTK 1049

Query: 799  WGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISREYF 858
                 +T+ +L  L    L  N W K        + + ++   P     F  + +S   F
Sbjct: 1050 MVAISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKF 1109

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 139/269 (51%), Gaps = 7/269 (2%)

Query: 217 DDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQ 276
           D    REI+           Y  N IS  KYN  TF+P  L+++F  + NL+FL  A  Q
Sbjct: 153 DHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQ 212

Query: 277 QVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIER 336
            +P +      + +  L  VL V+  KE+++DI R   D+E NN   E+ ++     I  
Sbjct: 213 AIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPS 270

Query: 337 RWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEM 396
           +  D++ GD+I++K    +PAD++V+ ++EP G  +I+T  LDGET+ K++ A   T  +
Sbjct: 271 K--DLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSL 328

Query: 397 MDSRKLNNFKGKVISEQPNSSLYTYEGTLEF-NNRKIPLSPEQMILRGATLRNTSWMFGL 455
            ++  LNN    + +  P  S++ + G + + ++   PLS +  +     L +++     
Sbjct: 329 TENDLLNNI--TITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICC 386

Query: 456 VIFTGHETKLMRNATATPIKRTAVERVIN 484
           +++TG ET+   N T +  K   +E  IN
Sbjct: 387 IVYTGRETRQALNTTKSKAKTGLLELEIN 415

>Scas_89.1
          Length = 271

 Score = 97.4 bits (241), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 82/146 (56%), Gaps = 7/146 (4%)

Query: 559 ALVIDGKSLSYAL---ESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLL 615
            L+IDG+SL   L   + +  D ++ L     AV+ CR +P QKA V  +++  T   + 
Sbjct: 118 CLLIDGESLGMFLTYYKQEFFDIVVDL----PAVIACRCTPQQKADVALLIREITGKRVC 173

Query: 616 AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISV 675
            IGDG NDVSMIQ A VGVGI G EG QA+ +AD +V QF  L KLLL HG  SY+R + 
Sbjct: 174 CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAK 233

Query: 676 AILYSFYKNTALYMTQFWFVFANAFS 701
              +  ++   + + Q  +   +  S
Sbjct: 234 LAQFVIHRGLIISVCQAVYSVCSKLS 259

>Kwal_56.23467
          Length = 280

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 102/240 (42%), Gaps = 28/240 (11%)

Query: 759 FWGWIVNGFYHSAVVYIGTML-FYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAAL 817
           FW ++V+G Y S + +    L +Y+ GM ++ +G   DH  W + +   SI  V     +
Sbjct: 10  FWLYMVDGLYQSVISFFFPFLAYYKTGM-VSPNGLGLDHRYW-VGILVGSIASVSCNLYI 67

Query: 818 VTNQ--WTKF-TLFAIPGSFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTL 874
           + +Q  W  F TLF      + +      +  ++     S E++    H YGS  +W   
Sbjct: 68  LIHQFRWDWFSTLFIALSCLVVYG-----WTGIWSTFTTSGEFYKSAAHVYGSPIYWAIF 122

Query: 875 IVLPVFALMRDFVWKYYRRMYEPESYHLVQEM----------QKFNISD-NRPHVQHFQN 923
            V  +F L+  F +  +++M+ P+   +++E           + ++ +D NRP +     
Sbjct: 123 FVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKADT 182

Query: 924 EIRKVRQVQRMKKQRGFAFSQSEEGGQDKIIRMYDTTQKRGVYGELHDANPFSNNNAENI 983
           ++   R V+        A + +  G +D +     T +    + E  D NP   +   NI
Sbjct: 183 KLHP-RYVEE-GSDYAHAITTANHGSRDTVY----TEEIPMTFMEADDNNPEPFHPRSNI 236

>Kwal_23.3160
          Length = 1100

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 73/340 (21%), Positives = 128/340 (37%), Gaps = 50/340 (14%)

Query: 589  VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
            +V  R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 734  LVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDA 791

Query: 649  -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIM 706
             DI +    F   L  V  G      I   +L    +N A      + +    F  +  +
Sbjct: 792  SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QALYLMIGLCFLDEDRL 848

Query: 707  ESWTMSYYNVFFTV-----FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWG 761
              + +S   V + +     FP   +G+  +  +  ++E+ PQ  K G     F+  I   
Sbjct: 849  SVFPLSPVEVLWIIVVTSCFPAMGLGL--EKSAPDIMEKEPQDSKAG----IFTWEIILD 902

Query: 762  WIVNGFYHSAVVYIGTMLFYRYG-----MALNM------------HGEVAD----HW--- 797
             ++ G + +A   +   +   YG     + +N             HG  A      W   
Sbjct: 903  MLIYGTWMAACC-LACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCAL 961

Query: 798  --SWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISR 855
              +W +     S   +  +      QW K         F+FW + F  + SVFP   I  
Sbjct: 962  ILAWEVIDMRRSFFKMQPETDTPYTQWMKDIW---SNQFLFWSVIFG-FVSVFPVVYIPV 1017

Query: 856  EYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMY 895
                V KH  G G  W   +   +   +   ++KY++R Y
Sbjct: 1018 INKDVFKHK-GIGYEWGLAVAYTIAFWIGAELYKYFKRCY 1056

>Scas_665.30
          Length = 1439

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 576 EDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 635
           EDY+  +  + K  +  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+ 
Sbjct: 917 EDYINTV--LLKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGIS 973

Query: 636 ISGMEGMQAA 645
           +S  E   AA
Sbjct: 974 LSEAEASVAA 983

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEGMQA 644
           V  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVG+ +      G++ +Q 
Sbjct: 789 VYARVSPAQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEEGLKKLQE 847

Query: 645 AR 646
            R
Sbjct: 848 QR 849

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 80/346 (23%), Positives = 130/346 (37%), Gaps = 62/346 (17%)

Query: 589  VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
            +V  R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 723  LVIARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDA 780

Query: 649  -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIM 706
             DI +    F   L  V  G      I   +L     N A      + +    F  +  +
Sbjct: 781  SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVA---QAIYLMLGLTFLDEDKL 837

Query: 707  ESWTMSYYNVFFTV-----FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWG 761
              + +S   V + +      P   +G+  +  +  ++E+ P   K G     F+  +   
Sbjct: 838  SVFPLSPVEVLWIIVVTSCLPAMGLGL--EKAAPDIMEKPPNDSKAG----IFTWEVIVD 891

Query: 762  WIVNGFYHSAVVYIGTM--LFYRYGMALNMHGEVADHWSWGIAVYTSSILIVL-GKAA-L 817
             IV G    AV  +G    + Y+ G     HG +  + +     Y+ S   V  G+AA  
Sbjct: 892  MIVYGLVM-AVCCLGCFVSIIYKDG-----HGNLGTNCN---VEYSDSCKSVFSGRAATF 942

Query: 818  VTNQWTKFTL-----------FAI----------------PGSFIFWMIFFPIYASVFPY 850
             T  W    L           FA+                   F+FW + F  + SVFP 
Sbjct: 943  ATMTWCALILAWEVIDMRRSFFAMKPETDTPYTQVFKDIWSNKFLFWSVIFG-FTSVFPV 1001

Query: 851  ANISREYFGVVKHTYGSGTFW-LTLIVLPVFALMRDFVWKYYRRMY 895
              I      V  H  G G  W +      VF L+ +F WK+ +R Y
Sbjct: 1002 VYIPVINTKVFLH-IGIGYEWGIAFAFSLVFWLVAEF-WKFAKRRY 1045

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 23/149 (15%)

Query: 585  ICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 644
            + K  +  R+SP +K  +V+ +++   ++    GDGAND   ++AA VG+ +S  E   A
Sbjct: 1134 LLKGSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAEASVA 1192

Query: 645  A----RSADIA-------------VGQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTAL 687
            A    +  DI              V  F   + + L     + Q IS+ ILYS   N   
Sbjct: 1193 APFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYS---AIQFISITILYSRGSNLGD 1249

Query: 688  YMTQFWFVFANAFSGQSIMESWTMSYYNV 716
            +  QF ++        ++  SW+  Y+ +
Sbjct: 1250 F--QFLYIDLLLIIPIAVTMSWSKPYHEL 1276

>Scas_583.14*
          Length = 875

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           V  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVGV +  + G + + +A
Sbjct: 442 VYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVAL--LNGTEESMTA 497

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 585 ICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 636
           I  A +  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVGV +
Sbjct: 781 IRHAWIYARVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAHVGVAL 831

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 16/71 (22%)

Query: 337 RWIDIRAGD--------VIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQ 388
           +W++++  +        V+R   + A+P DLI++     +G C +  A L GE+   +K+
Sbjct: 261 KWVEMQTNELLPMDVVSVVRTAEDSALPCDLILV-----DGTCIVNEAMLSGESTPLLKE 315

Query: 389 A---RPETAEM 396
           +   RP   E+
Sbjct: 316 SIRLRPGNEEL 326

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 93/209 (44%), Gaps = 38/209 (18%)

Query: 537  NMRDKIM---ALKEHKL------SQHEMN-TLALVIDGKSLSYALESDL-EDYLLALGKI 585
            N  DKI+    LK  KL      S  E N TLA+  D   L +  E+++ E+YL  +  +
Sbjct: 1097 NEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEI--L 1154

Query: 586  CKAVVCCRVSPLQK-ALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 644
              + +  R+SP +K  L++++  +K    +   GDGAND   ++AA VG+ +S  E   A
Sbjct: 1155 LNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212

Query: 645  A----------------RSADIA-VGQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTAL 687
            A                R    A V  F   + + L     + Q I++ ILYS   N   
Sbjct: 1213 APFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYS---AIQFITITILYSRGSNLGD 1269

Query: 688  YMTQFWFVFANAFSGQSIMESWTMSYYNV 716
            +  QF ++        +I  SW+ SY  +
Sbjct: 1270 F--QFLYIDLLLIVPIAICMSWSKSYEKI 1296

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 636
           V  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVG+ +
Sbjct: 788 VYARVSPSQKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQAHVGIAL 833

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 578 YLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGIS 637
           Y   L  I K  V  R SP  K ++V+ +K K   ++   GDG ND   ++ A VG  + 
Sbjct: 825 YKKMLRVIPKLRVLARSSPEDKRILVETLK-KMGEVVAVTGDGTNDAPALKLADVGFSM- 882

Query: 638 GMEGMQAARSA 648
           G+ G + AR A
Sbjct: 883 GISGTEVAREA 893

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 5/44 (11%)

Query: 340 DIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETN 383
           D+  GDVI +++ + +PAD ++IS     G C  + + L GE++
Sbjct: 256 DLLVGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESD 294

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEGMQA 644
           +  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVG+ +       ++ +Q 
Sbjct: 786 IYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEDSLKKLQE 844

Query: 645 ARSAD 649
            R  D
Sbjct: 845 QRKID 849

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 77/205 (37%), Gaps = 54/205 (26%)

Query: 218 DGTPR------EIYLNDRTANHAFNYGDNHISTTKYNIATFL---------PKFLFQEFS 262
           DG+P+         LN    +H   YG+N        I TFL         P F+FQ F 
Sbjct: 151 DGSPKIAEFQNSKGLNGDLTHHKRLYGENSFDIP---IPTFLELFKEHAVAPFFIFQLFC 207

Query: 263 KYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSK 322
               LF                  Y+     M+V +     E+    +R  + KE     
Sbjct: 208 VALWLF-------------DDLWYYSLFNLFMIVAM-----EATSVFQRLTTLKEFRTMG 249

Query: 323 TEIYSEENGDFIERRWIDIRAG--------DVIRVKSEEAIPADLIVISSSEPEGLCYIE 374
            + Y+     F + +W++++           + R   + AIP DL++I     +G C + 
Sbjct: 250 IKPYAINV--FRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLI-----DGSCIVN 302

Query: 375 TANLDGETNLKIKQA---RPETAEM 396
            A L GE+   +K++   RP   ++
Sbjct: 303 EAMLSGESTPLLKESIKLRPANDQL 327

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 58/113 (51%), Gaps = 9/113 (7%)

Query: 293 LMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSE 352
           + VV++VSA  +  ++++ A  +K+  N K  +   +    I    + +  GDVI +++ 
Sbjct: 164 VFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIHHVLV--GDVISLQTG 221

Query: 353 EAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNF 405
           + +PAD ++IS     G C  + +++ GE+N    Q  P    + D +K N+ 
Sbjct: 222 DVVPADCVMIS-----GKCEADESSITGESN--TIQKFPVDNSLRDFKKFNSI 267

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           V  R SP  K L+V+ +K     ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 813 VLARSSPEDKRLLVETLK-GMGDVVAVTGDGTNDAPALKLADVGFSM-GISGTEVAREA 869

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 576  EDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 635
            +DY+  +  + K  +  R+SP +K  +V+ +++   ++    GDGAND   ++AA++G+ 
Sbjct: 1114 DDYISTV--LMKGSIYARMSPDEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGIS 1170

Query: 636  ISGMEGMQAA 645
            +S  E   AA
Sbjct: 1171 LSEAEASVAA 1180

>Kwal_26.8333
          Length = 422

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 35/85 (41%)

Query: 687 LYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYK 746
           +Y T   F F N  SG S+   +      +  +VF P  +G   Q V  + +      +K
Sbjct: 169 MYTTSSAFHFGNPASGSSVSHLYANVMKQIGLSVFVPLFVGQILQNVFPKQVSWCLSTFK 228

Query: 747 LGQQGKFFSVRIFWGWIVNGFYHSA 771
           LG+ G F  + I W      FY  A
Sbjct: 229 LGKVGSFCLILIMWSSFSTAFYQKA 253

>Kwal_47.17547
          Length = 1240

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 71/172 (41%), Gaps = 29/172 (16%)

Query: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAI------------QQVPHVSPT 284
           YGDN I   K      L    FQ+      +  L  AA+            Q   H +  
Sbjct: 85  YGDNRIPQRKPKSFLQLAWIAFQD----RIMILLTVAAVVSFALGLYEVLGQPPEHDAEG 140

Query: 285 NRYTTVG-----TLMVVLIVSAFKESIEDIKRANSDKELNNSKT--EIYSEENGDFIERR 337
            + T V       +M+ ++V     S  D ++     +LN+ K   E+    NGD     
Sbjct: 141 KKITKVDWVEGVAIMIAVLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLIS 200

Query: 338 WIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQA 389
             DI  GD++ +++ + +PAD I++     +G C  + + L GE+   IK+A
Sbjct: 201 IHDILVGDILSLQTGDVVPADCILV-----KGSCECDESALTGESA-TIKKA 246

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           V  R SP  K ++V+ +K K   ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 800 VLARSSPEDKRILVETLK-KMGDVVAVTGDGTNDAPALKLADVGFSM-GIAGTEVAREA 856

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 8/99 (8%)

Query: 550 LSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRK 609
           LS   +N  A  ++G +     +S+ +  L  L       V  R SP  K ++V+ +K +
Sbjct: 734 LSSKSLNDSACAMEGPAFRKLSDSERKRILPKLR------VLARSSPEDKKILVRALK-E 786

Query: 610 TSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
              ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 787 MGEVVAVTGDGTNDAPALKLADVGFSM-GITGTEVAREA 824

>Scas_297.1
          Length = 800

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           V  R SP  K L+V+ +K     ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 51  VMARSSPEDKRLLVETLK-GMGDVVAVTGDGTNDAPALKLADVGFSM-GISGTEVAREA 107

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 33/51 (64%), Gaps = 6/51 (11%)

Query: 340 DIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQAR 390
           ++  GD+I +++ + IPAD +++     EG C ++ +++ GE++  IK+ +
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESD-TIKKVK 659

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 85/203 (41%), Gaps = 19/203 (9%)

Query: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           +V  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 723 LVIARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKDA 780

Query: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAF---SGQ 703
            DI +    F   L  V  G      I   +L    +N A      + +   AF    G+
Sbjct: 781 SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QALYLIVGLAFQDKEGK 837

Query: 704 SI--MESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWG 761
           S+  +    + +  V  + FP   +G+  +  +  L++R P   K G     F+  I   
Sbjct: 838 SVFPLAPVEVLWIIVVTSCFPAMGLGL--EKAAHDLMDRPPNDSKAG----IFTWEIIVD 891

Query: 762 WIVNGFYHSAVVYIGTMLFYRYG 784
             V G + +A   + T +   YG
Sbjct: 892 MFVYGVWMAASC-MATFVTIIYG 913

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 10/93 (10%)

Query: 290 VGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRV 349
           +G  +++ ++  +K S    K  N+ + L++    +    N + ++    D+  GD++ V
Sbjct: 97  IGINVIIGLIQEYKAS----KTMNALRALSSPNAHVIRNGNSEVVDST--DVVPGDLVVV 150

Query: 350 KSEEAIPADLIVISSSEPEGLCYIETANLDGET 382
           K  + IPADL ++S    E     + A L GE+
Sbjct: 151 KVGDTIPADLRLVSQQNFE----TDEALLTGES 179

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 100/249 (40%), Gaps = 29/249 (11%)

Query: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           +V  R +P  K  +++ + R+ S      GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 717 LVIARCAPQTKVRMIEALHRR-SKFCAMTGDGVNDSPSLKIANVGIAM-GINGSDVAKDA 774

Query: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNT--ALY-MTQFWFVFANAFSGQ 703
            DI +    F   L  V  G      I   +L    +N   ALY M    FV    FS  
Sbjct: 775 SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVF 834

Query: 704 SIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWI 763
            +     + +  V  + FP   +G+  +  S  ++E+ P+  K        +V   W  I
Sbjct: 835 PLSPVEVL-WIIVVTSCFPAMGLGL--EKASVDVMEKPPKDAK--------AVVFTWEVI 883

Query: 764 VNGFYHSAVVYIGTMLFY---RYGMA-LNMHGEVADHWSWGIAVYTSSILIVLGK-AALV 818
           ++   +  ++    M  +    YG    N+  +  D      A+  +  L+  G+ AA  
Sbjct: 884 IDMLVYGVIMAACCMACFVTVLYGTGDGNLGSDCND------ALGETCHLVFRGRAAAFA 937

Query: 819 TNQWTKFTL 827
           T  W    L
Sbjct: 938 TMTWCALIL 946

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 102/251 (40%), Gaps = 33/251 (13%)

Query: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           +V  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   ++ A
Sbjct: 728 LVIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEA 785

Query: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNT--ALYMTQFWFVFANAFSGQS 704
            DI +    F   L  V  G      I   +L    +N   ALY+     VF +  +G+S
Sbjct: 786 SDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLI-IGLVFRDE-NGKS 843

Query: 705 I--MESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIF-WG 761
           +  +    + +  V  + FP   +G+  +  +  L++R P   ++G         IF W 
Sbjct: 844 VFPLSPVEVLWIIVVTSCFPAMGLGL--EKAAPDLMDRPPHDSEVG---------IFTWE 892

Query: 762 WIVNGFYHSAVVYIGTMLFYR---YGMALNMHGEVADHWSWGIAVYTSSILIVL--GKAA 816
            I++ F +  ++    M  +    YG+     G   D        Y SS   V     AA
Sbjct: 893 VIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCD------GTYNSSCRDVYRSRSAA 946

Query: 817 LVTNQWTKFTL 827
             T  W    L
Sbjct: 947 FATMTWCALIL 957

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 102/251 (40%), Gaps = 33/251 (13%)

Query: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           +V  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   ++ A
Sbjct: 728 LVIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEA 785

Query: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNT--ALYMTQFWFVFANAFSGQS 704
            DI +    F   L  V  G      I   +L    +N   ALY+     VF +  +G+S
Sbjct: 786 SDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLI-IGLVFRDE-NGKS 843

Query: 705 I--MESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIF-WG 761
           +  +    + +  V  + FP   +G+  +  +  L++R P   ++G         IF W 
Sbjct: 844 VFPLSPVEVLWIIVVTSCFPAMGLGL--EKAAPDLMDRPPHDSEVG---------IFTWE 892

Query: 762 WIVNGFYHSAVVYIGTMLFYR---YGMALNMHGEVADHWSWGIAVYTSSILIVL--GKAA 816
            I++ F +  ++    M  +    YG+     G   D        Y SS   V     AA
Sbjct: 893 VIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCD------GTYNSSCRDVYRSRSAA 946

Query: 817 LVTNQWTKFTL 827
             T  W    L
Sbjct: 947 FATMTWCALIL 957

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 47/108 (43%), Gaps = 16/108 (14%)

Query: 287 YTTVGTLMVVLIVSAFKESIED---IKRANSDKELNNSKTEIYSEENGDFIERRWIDIRA 343
           + T G +  V+ V+     +++    K  NS K L++    +      + I  +  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 344 GDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARP 391
           GD+  VK  + IPADL +           IET N D + +L   ++ P
Sbjct: 149 GDICLVKVGDTIPADLRL-----------IETKNFDTDESLLTGESLP 185

>Kwal_26.9207
          Length = 1469

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 585  ICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 644
            + K+ +  R+SP +K  +V  ++     ++   GDGAND   ++AA VGV +S  E   A
Sbjct: 1151 LLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVA 1209

Query: 645  A 645
            A
Sbjct: 1210 A 1210

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 102/251 (40%), Gaps = 33/251 (13%)

Query: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           +V  R SP  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   ++ A
Sbjct: 728 LVIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVSKEA 785

Query: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNT--ALYMTQFWFVFANAFSGQS 704
            DI +    F   L  V  G      I   +L    +N   ALY+     VF +  +G+S
Sbjct: 786 SDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLI-IGLVFRDE-NGKS 843

Query: 705 I--MESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIF-WG 761
           +  +    + +  V  + FP   +G+  +  +  L++R P   ++G         IF W 
Sbjct: 844 VFPLSPVEVLWIIVVTSCFPAMGLGL--EKAAPDLMDRPPNDSEVG---------IFTWE 892

Query: 762 WIVNGFYHSAVVYIGTMLFYR---YGMALNMHGEVADHWSWGIAVYTSSILIVL--GKAA 816
            I++ F +  ++    M  +    YG+     G   D        Y SS   V     AA
Sbjct: 893 VIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCD------GTYNSSCRDVYRSRSAA 946

Query: 817 LVTNQWTKFTL 827
             T  W    L
Sbjct: 947 FATMTWCALIL 957

>Scas_569.0d
          Length = 468

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 79/193 (40%), Gaps = 24/193 (12%)

Query: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           +V  R SP  K  +++ + R+        GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 103 LVIARCSPQTKVRMIEALHRR-DKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVAKDA 160

Query: 649 -DIAVGQFRFLKKL-LLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIM 706
            DI +    F   L  +  G      I   +L    +N A      + +   AF  +   
Sbjct: 161 SDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENVA---QALYLICGLAFQDKEGK 217

Query: 707 ESWTMSYYNVFFTV-----FPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIF-W 760
             + ++   V + +     FP   +G+  +  +  L++R P   K G         IF W
Sbjct: 218 SVFPLAPVEVLWIIVVTSCFPAMGLGL--EKAAPDLMDRPPNDSKSG---------IFTW 266

Query: 761 GWIVNGFYHSAVV 773
             IV+ F +  ++
Sbjct: 267 EIIVDMFVYGIIM 279

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 585  ICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 644
            + K  +  R+SP +K  +V+ ++     +    GDGAND   ++AA +G+ +S  E   A
Sbjct: 1131 LLKTSIYARMSPDEKHELVERLQSIGYQVGFC-GDGANDCGALKAADIGISLSEAEASVA 1189

Query: 645  A 645
            A
Sbjct: 1190 A 1190

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query: 311 RANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGL 370
           R N  KE     TE+    NGD       D+  GD++ +++ + +P D I++     EG 
Sbjct: 175 RLNRKKE----DTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILV-----EGK 225

Query: 371 CYIETANLDGETN 383
           C  + + + GE++
Sbjct: 226 CECDESGITGESD 238

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 587 KAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR 646
           K  V  R SP  K + V ++K K + ++   GDG ND   +  A VG  + G+ G   AR
Sbjct: 786 KLKVLARSSPEDKRIFVDILK-KMNEVVAVTGDGTNDAPALTLADVGFSM-GISGTGVAR 843

Query: 647 SA 648
            A
Sbjct: 844 EA 845

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 34/185 (18%), Positives = 76/185 (41%), Gaps = 12/185 (6%)

Query: 593 RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAV 652
           R +P  K  +V+ ++++   ++   GDG ND   ++ A +GV +  M    A  ++D+ +
Sbjct: 662 RATPEHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720

Query: 653 GQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTM 711
               F   L  +  G   +  I   + +    + A          A AF  Q+ + +  +
Sbjct: 721 TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQI 777

Query: 712 SYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVN-GFYHS 770
            + N+     P   +GV  + V   ++ + P+     +  K  + ++    ++N  F   
Sbjct: 778 LWINILMDGPPAQSLGV--EPVDHEVMRKPPR----KRSDKILTPQVMRRLLINAAFIIG 831

Query: 771 AVVYI 775
             +Y+
Sbjct: 832 GTIYV 836

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 47/120 (39%), Gaps = 34/120 (28%)

Query: 344 GDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLN 403
           GD++R K  + IPAD+ +I + +      I+ +NL GET    K A+    E        
Sbjct: 182 GDLVRFKIGDRIPADVRIIEAVD----LSIDESNLTGETEPLHKDAQTIDPE-------- 229

Query: 404 NFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHET 463
                                 E++NR +P+S    I    TL       G+VI TG  T
Sbjct: 230 ----------------------EYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNT 267

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 561 VIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDG 620
           V+ G  +S   E +L         I K  +  R +P  K  +VK + RK   ++   GDG
Sbjct: 625 VMTGDKVSELTEDELSKV------IDKVNIFARATPENKLNIVKAL-RKRGDIVAMTGDG 677

Query: 621 ANDVSMIQAAHVGVGISGMEGMQAAR 646
            ND   ++ A +G+ + G+ G   A+
Sbjct: 678 VNDAPALKLADIGIAM-GISGTDVAK 702

>Kwal_14.1498
          Length = 939

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 85/202 (42%), Gaps = 17/202 (8%)

Query: 593 RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAV 652
           R +P  K  +V+ ++++   ++   GDG ND   ++ A +GV +  M    A  ++D+ +
Sbjct: 644 RATPEHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 702

Query: 653 GQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTM 711
               F   L  +  G   +  I   + +    + A          A AF   + + +  +
Sbjct: 703 TDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALS---LVAIATAFKLPNPLNAMQI 759

Query: 712 SYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSA 771
            + N+     P   +GV  + V   ++++ P+     +  K  +  +F   +      +A
Sbjct: 760 LWINILMDGPPAQSLGV--EPVDHEVMKKPPR----KRADKILTKAVFQRLL----QSAA 809

Query: 772 VVYIGTMLFYRYGMALNMHGEV 793
           ++ IGT+  +   MA +  GEV
Sbjct: 810 LIIIGTIYVFIKEMAED--GEV 829

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 7/118 (5%)

Query: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           +V  R +P  K  +++ + R+     +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 717 LVIARCAPQTKVRMIEALHRRNRFCAMT-GDGVNDSPSLKIANVGIAM-GINGSDVAKDA 774

Query: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNT--ALY-MTQFWFVFANAFS 701
            DI +    F   L  V  G      I   +L    +N   ALY M    F+    FS
Sbjct: 775 SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFS 832

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 593 RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           R +P  K  +V+ ++R+   ++   GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 656 RATPEHKLNIVRALRRR-GDVVAMTGDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709

>Kwal_23.5035
          Length = 744

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 48/100 (48%), Gaps = 7/100 (7%)

Query: 870 FWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQEMQKFNISDNRPHVQH-FQNEIRKV 928
            W TL+V   F  + ++  KY +   +  S HL ++  + +  +NR ++++ + ++ +  
Sbjct: 303 LWRTLLVTENFITVEEY-HKYSQGPQQLNSGHLHEDFFRLHFMENRAYLKNWYDSKFKPH 361

Query: 929 RQVQRMKKQRGFAFSQSEE-----GGQDKIIRMYDTTQKR 963
           R   R    +     Q E+     G  DK+IR+YD   ++
Sbjct: 362 RTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEK 401

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 594 VSPLQKALVVKMVKRKTSSLLLAI-GDGANDVSMIQAAHVGVGIS-GMEGMQAARSADIA 651
           VSP  K  +VK ++ K  +  +A+ GDG ND   +  + +G+ IS G E   A  +ADI 
Sbjct: 812 VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE--IAIEAADIV 869

Query: 652 V 652
           +
Sbjct: 870 I 870

>Scas_707.48*
          Length = 741

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 593 RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
           R +P  K  +V+ + RK   ++   GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 648 RATPEHKLNIVRAL-RKRGDVVAMTGDGVNDAPALKLADIGVSMGRM-GTDVAKEA 701

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD 649
           V  R +P  K  +V+ ++++   ++   GDG ND   ++ A +GV +  M    A  ++D
Sbjct: 640 VFARATPEHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASD 698

Query: 650 IAV 652
           + +
Sbjct: 699 MVL 701

>Kwal_47.17522
          Length = 899

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 592 CRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648
             V P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 589 AEVFPQHKYSVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

>Scas_608.3
          Length = 229

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 876 VLPVFALMRDFVWKYYR----RMYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQV 931
           V P+ + ++D ++ Y+      ++E  + +++  + KF I DN    +H  + + +  + 
Sbjct: 14  VCPI-SFVQDVLFPYFTAQVPHLHESINPNIIDILSKFEIEDNNELTRHILDLVSRDVKD 72

Query: 932 QRMKKQRGFAFSQSEEGGQDK 952
             +K+ +G+ ++Q  E G+ K
Sbjct: 73  PLLKQLQGYVWAQGYETGEIK 93

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,354,434
Number of extensions: 1491344
Number of successful extensions: 4619
Number of sequences better than 10.0: 93
Number of HSP's gapped: 4658
Number of HSP's successfully gapped: 147
Length of query: 1025
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 913
Effective length of database: 12,718,893
Effective search space: 11612349309
Effective search space used: 11612349309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)