Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_505.31364136468490.0
YAL024C (LTE1)1435146228290.0
CAGL0G06226g1318140423480.0
Kwal_26.70831400145021170.0
ACR292W1439149421070.0
KLLA0A04059g1366144020490.0
YLL016W (SDC25)10482201905e-14
CAGL0E03476g15642021843e-13
YLR310C (CDC25)15891791799e-13
Scas_621.1*13231741701e-11
Kwal_14.231315171751701e-11
Sklu_2189.415262081654e-11
KLLA0D09306g15371821432e-08
ADL038W15091791413e-08
Scas_604.1516762091352e-07
Kwal_33.1359814122161323e-07
CAGL0D06512g13082681153e-05
CAGL0B01287g12472181073e-04
KLLA0C03410g13601911038e-04
Scas_476.21330210960.006
Scas_682.13250143694.4
Sklu_2440.1882435705.6
KLLA0F11792g621123696.9
Scas_442.130992679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_505.3
         (1364 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_505.3                                                           2642   0.0  
YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exch...  1094   0.0  
CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces c...   909   0.0  
Kwal_26.7083                                                          820   0.0  
ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH] complement(...   816   0.0  
KLLA0A04059g complement(361328..365428) similar to sp|P07866 Sac...   793   0.0  
YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown...    78   5e-14
CAGL0E03476g complement(318956..323650) similar to sp|P04821 Sac...    75   3e-13
YLR310C (CDC25) [3699] chr12 complement(752226..756995) Guanine-...    74   9e-13
Scas_621.1*                                                            70   1e-11
Kwal_14.2313                                                           70   1e-11
Sklu_2189.4 YLR310C, Contig c2189 8340-12920                           68   4e-11
KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharo...    60   2e-08
ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W...    59   3e-08
Scas_604.15                                                            57   2e-07
Kwal_33.13598                                                          55   3e-07
CAGL0D06512g complement(617453..621379) some similarities with s...    49   3e-05
CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyce...    46   3e-04
KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030...    44   8e-04
Scas_476.2                                                             42   0.006
Scas_682.13                                                            31   4.4  
Sklu_2440.18 YDR416W, Contig c2440 29476-31950                         32   5.6  
KLLA0F11792g 1087802..1089667 similar to sgd|S0002456 Saccharomy...    31   6.9  
Scas_442.1                                                             30   9.4  

>Scas_505.3
          Length = 1364

 Score = 2642 bits (6849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1309/1364 (95%), Positives = 1309/1364 (95%)

Query: 1    MSQPMPELGIFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDY 60
            MSQPMPELGIFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDY
Sbjct: 1    MSQPMPELGIFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDY 60

Query: 61   TIFSDFFLIYRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLR 120
            TIFSDFFLIYRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLR
Sbjct: 61   TIFSDFFLIYRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLR 120

Query: 121  HSILNYFVQDFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIP 180
            HSILNYFVQDFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIP
Sbjct: 121  HSILNYFVQDFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIP 180

Query: 181  FNEPSSVDFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDN 240
            FNEPSSVDFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDN
Sbjct: 181  FNEPSSVDFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDN 240

Query: 241  FKLPESLDFNSNRTKQTASMMLYPNDNSNXXXXXXXXXXXXXXXTLINDNKNDIRKISHL 300
            FKLPESLDFNSNRTKQTASMMLYPNDNSN               TLINDNKNDIRKISHL
Sbjct: 241  FKLPESLDFNSNRTKQTASMMLYPNDNSNIPKIPIPKGKEPLKITLINDNKNDIRKISHL 300

Query: 301  SKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDETIEDNPRVKSTP 360
            SKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDETIEDNPRVKSTP
Sbjct: 301  SKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDETIEDNPRVKSTP 360

Query: 361  PPIQSSLLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPDMDNFVKYVISITS 420
            PPIQSSLLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPDMDNFVKYVISITS
Sbjct: 361  PPIQSSLLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPDMDNFVKYVISITS 420

Query: 421  LENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRGQANLNNNNLKSIG 480
            LENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRGQANLNNNNLKSIG
Sbjct: 421  LENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRGQANLNNNNLKSIG 480

Query: 481  LENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTKLKIVNSPSLSALE 540
            LENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTKLKIVNSPSLSALE
Sbjct: 481  LENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTKLKIVNSPSLSALE 540

Query: 541  RRMVMSSFPALNGKVSSSSKIGIEDELVINITPPRAKNDGPQRLVFHDDGSTLSLPQTPT 600
            RRMVMSSFPALNGKVSSSSKIGIEDELVINITPPRAKNDGPQRLVFHDDGSTLSLPQTPT
Sbjct: 541  RRMVMSSFPALNGKVSSSSKIGIEDELVINITPPRAKNDGPQRLVFHDDGSTLSLPQTPT 600

Query: 601  KSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVSTISYDXXXXXXXXXXXXXXXX 660
            KSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVSTISYD                
Sbjct: 601  KSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVSTISYDSLLSSKSFKHKSSRRS 660

Query: 661  NLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSLPSPTKSQGSPKATHIRQQHHLTP 720
            NLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSLPSPTKSQGSPKATHIRQQHHLTP
Sbjct: 661  NLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSLPSPTKSQGSPKATHIRQQHHLTP 720

Query: 721  PVSLSPTDPLKMEAEDHLSPLNKLTPQTAIRPASGRISILRKSLSITQARRNTYAGPPKA 780
            PVSLSPTDPLKMEAEDHLSPLNKLTPQTAIRPASGRISILRKSLSITQARRNTYAGPPKA
Sbjct: 721  PVSLSPTDPLKMEAEDHLSPLNKLTPQTAIRPASGRISILRKSLSITQARRNTYAGPPKA 780

Query: 781  DLLRDPDFIKKERSLIESEHXXXXXXXXXXXRTSLQSSVATDNLFNSRKNSPKKVTAENK 840
            DLLRDPDFIKKERSLIESEH           RTSLQSSVATDNLFNSRKNSPKKVTAENK
Sbjct: 781  DLLRDPDFIKKERSLIESEHQLQELQDDLLERTSLQSSVATDNLFNSRKNSPKKVTAENK 840

Query: 841  VRLSTTPXXXXXXXXXXXXXGNTSYNDPARDSMQFTNDKRIDLREVFHNGSVQNVISNDL 900
            VRLSTTP             GNTSYNDPARDSMQFTNDKRIDLREVFHNGSVQNVISNDL
Sbjct: 841  VRLSTTPSIYSILDDSSLSSGNTSYNDPARDSMQFTNDKRIDLREVFHNGSVQNVISNDL 900

Query: 901  SSDAISGLSELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNETFEEESES 960
            SSDAISGLSELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNETFEEESES
Sbjct: 901  SSDAISGLSELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNETFEEESES 960

Query: 961  IIDGIQEASDEGAMPNVDLDKEKLKDIADIPDDTGSGDPISIAMMKLEGTYKTNDDDNKT 1020
            IIDGIQEASDEGAMPNVDLDKEKLKDIADIPDDTGSGDPISIAMMKLEGTYKTNDDDNKT
Sbjct: 961  IIDGIQEASDEGAMPNVDLDKEKLKDIADIPDDTGSGDPISIAMMKLEGTYKTNDDDNKT 1020

Query: 1021 HEDSSSVQDLIKEVEMLNLKKLPTFPKSPLEKRKSLMIERRRQTIMNIPFTPQNSEEGLA 1080
            HEDSSSVQDLIKEVEMLNLKKLPTFPKSPLEKRKSLMIERRRQTIMNIPFTPQNSEEGLA
Sbjct: 1021 HEDSSSVQDLIKEVEMLNLKKLPTFPKSPLEKRKSLMIERRRQTIMNIPFTPQNSEEGLA 1080

Query: 1081 IEDKCVSPLQVQTLVMNYEVQDSSLQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEI 1140
            IEDKCVSPLQVQTLVMNYEVQDSSLQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEI
Sbjct: 1081 IEDKCVSPLQVQTLVMNYEVQDSSLQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEI 1140

Query: 1141 DWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKMR 1200
            DWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKMR
Sbjct: 1141 DWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKMR 1200

Query: 1201 RNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIP 1260
            RNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIP
Sbjct: 1201 RNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIP 1260

Query: 1261 SLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQI 1320
            SLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQI
Sbjct: 1261 SLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQI 1320

Query: 1321 VKNFIQRVQWAKFYNIEVDHELLSKCVYITSLTNKEIDELAALK 1364
            VKNFIQRVQWAKFYNIEVDHELLSKCVYITSLTNKEIDELAALK
Sbjct: 1321 VKNFIQRVQWAKFYNIEVDHELLSKCVYITSLTNKEIDELAALK 1364

>YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exchange
            factor, required for termination of M phase [4308 bp,
            1435 aa]
          Length = 1435

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1462 (45%), Positives = 888/1462 (60%), Gaps = 134/1462 (9%)

Query: 8    LGIFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTIFSDFF 67
            + IFS  DYYP PS++VI+Y    ++ + K V+ AD+ ALI +LSSP++ VDY   +DFF
Sbjct: 1    MEIFSQKDYYPTPSSNVISY---ESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFF 57

Query: 68   LIYRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHSILNYF 127
            LIYR+F++P +LH+LLI RFRWCI EI  N     +++++GEVAL+RTFVLLRHSILNYF
Sbjct: 58   LIYRNFITPQDLHDLLIYRFRWCIREITTNA-AKAKRRRIGEVALVRTFVLLRHSILNYF 116

Query: 128  VQDFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIPFNEPSSV 187
            VQDFLP+  LR  L+ FLND   +  P+I+S  I+NLK+ W+H +K  WENI  NEP  +
Sbjct: 117  VQDFLPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKL 176

Query: 188  DFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFKLPESL 247
            DF+ WL + +KD  Q+E   KRGSRLS YA Q  +SPDFRN+SVLSLY ++D F+LPE L
Sbjct: 177  DFDAWLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKL 236

Query: 248  DF-NSNRTKQTASMMLYPNDNSNXXXXXXXXXXXXXXXTLINDNKNDIRKISHLSKIAHM 306
               NS++ +++ SM+L+P DN++                   D  +  +KISHLSK+  +
Sbjct: 237  QSSNSSKNQRSPSMLLFP-DNTSNVYSKHRIAKEPSVDNESEDMSDSKQKISHLSKVTLV 295

Query: 307  STVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDE---TIEDNPRVKSTPPPI 363
            ST++K VDYP+S A+++I+PPTPAKKVEFILNSLYIPED +E   T++      S     
Sbjct: 296  STLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEQSGTLQGTSTTSSLDNNS 355

Query: 364  QSS---------LLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPDMDNFVKY 414
             S+         +L R AIGLLA+W +NH R+      K   S +     KP+MD FVKY
Sbjct: 356  NSNSRSNTSSMSVLHRSAIGLLAKWMKNHNRHDSSND-KKFMSAIKPANQKPEMDAFVKY 414

Query: 415  VISITSL-ENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRGQANLNN 473
            V+SI+SL   +      E  +  +SKFDILSARTIDEVE L+ L+N+L +KV+  +N N 
Sbjct: 415  VVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNNR 474

Query: 474  N-----------NLKSIGLENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTL 522
                        ++  I +     F+P  D  NFSAMDNLDLY+TVSS+AQSVISL+NTL
Sbjct: 475  GPTVNVDCERREHIHDIKILQQNSFKPSND--NFSAMDNLDLYQTVSSIAQSVISLTNTL 532

Query: 523  NKSTKLKIVN---SPSLSALERRMVMSSFPALNGKVSSSSKIGIEDELVINITPPRAKND 579
            NK  +    N   SPS  AL+RR V S   A   K+  S           + +  R   +
Sbjct: 533  NKQLQNNESNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDEN 592

Query: 580  GPQRLVFHDDGSTLSLP---QTPTKSNRKSNIRH--SSPLKNVLPNLNEVDLSDSVCSDD 634
            GPQRL+FH+   T S      TP + N   + +   SSPLKNVLP+L E     S  +D 
Sbjct: 593  GPQRLLFHETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLKE----SSPLNDS 648

Query: 635  ESFVSTISYDXXXXXXXXX--XXXXXXXNLYSRPLTFKNEEQTLKKKTASKNLREFTFET 692
                 +I+Y                   +   R +    +  TLK KT   NLREFTFE 
Sbjct: 649  REDTESITYSYDSELSSSSPPRDTVTKKSRKVRNIVNNTDSPTLKTKTGFLNLREFTFED 708

Query: 693  SKLSLPSPTKSQGSPKATHIR--QQHHLTPPVSLSPTDPLKMEAEDH-------LSPLNK 743
            +K      +   G  K    +  Q+        L  +     EA ++        S  N 
Sbjct: 709  TKSLDEKKSTIDGLEKNYDNKENQESEYESTKKLDNSLDASSEANNYDITTRKKHSSCNH 768

Query: 744  LTPQTAIRPASGRISILR-KSLSITQARRNTYAGPPKADLLRDPDFIKKERSLIESEHXX 802
               Q  +RPASGRISI R +S++IT         P K   + DP+   K  S+IE     
Sbjct: 769  KIKQAVVRPASGRISISRVQSIAIT---------PTKELSIVDPE-QNKSNSVIEEISEI 818

Query: 803  XXXXXXXXXRTSLQS-------SVATDNLFNSRKNSPKK--------------VTAENKV 841
                     +++L S       S++T  LF S +NSP K              V+  N++
Sbjct: 819  EPLNLEYNKKSALYSDTSSTVISISTSKLFESAQNSPLKQTQNPQREFPNGTSVSETNRI 878

Query: 842  RLSTTPXXXXXXXXXXX-XXGNTSYNDPARDSMQFTNDKRIDLREVFHNGSVQNVISNDL 900
            RLS  P              G+T         +   + + I+LRE +  G+ Q++ISN  
Sbjct: 879  RLSIAPTIESVVSDLNSITTGSTVETFETSRDLPVPHQRIINLREEYQRGN-QDIISNTS 937

Query: 901  SSDAISGL------SELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNETF 954
            S   +  +      ++L+    +  +NKY FSP++ + D+ SP K+VE LK+KFLKNE+ 
Sbjct: 938  SLHELKTIDLSDSNNDLESPSTHAKNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNES- 996

Query: 955  EEESESIIDG------------------IQEASDEGAMPNVDLDKEKLKDIADIPDDTGS 996
              E+ S I G                   + A+ E A     L+K+ L +IA++ DD+ +
Sbjct: 997  --ETNSNISGSVLTMDDIDINDTSSARNTRRANSESAFTG-SLNKKNLNEIANMLDDSIN 1053

Query: 997  GDPISIAMMKLEGTYKT--NDDDNKTHEDSSSVQ--DLIKEVEMLNLKKLPTFPKSPLEK 1052
             DPI++A+MKLEGTY+      +N    D+  ++   L  EVEMLNL  LP+F  SP EK
Sbjct: 1054 DDPITVALMKLEGTYEKIPEKPENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEK 1113

Query: 1053 RKSLMIERRRQTIMNIPFTPQNSE-EGL-----------AIEDKCVSPLQVQTLVMNYEV 1100
            RKSL+IERRRQTIMNIPFTP  SE EG            A  D  V   Q+Q L+  Y +
Sbjct: 1114 RKSLLIERRRQTIMNIPFTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRI 1173

Query: 1101 QDSSLQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSW 1160
             DS L ISNNE H+PFILMYDS S+A+QMTLIEKE+L EIDWKDLL+LK++++G  V SW
Sbjct: 1174 HDSRLMISNNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISW 1233

Query: 1161 LQLLIQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNY 1220
            LQLL++NETLSG+DLAI+RFNLTVDWI+SEI LT+  KM+RN IQRFIHVA +CR FQN+
Sbjct: 1234 LQLLVRNETLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNF 1293

Query: 1221 NTLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKK 1280
            NTLMEIILALSS VVQKFTDAWRLIEPGD+L WEELK IPSLDRNYSTIRNLLNS++P  
Sbjct: 1294 NTLMEIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLV 1353

Query: 1281 GCIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQIVKNFIQRVQWAKFYNIEVDH 1340
            GC+PFIVVYLSDLS N+EK++WI++ KVVNY+KF+T+VQIVKNFIQRVQW+KFY  +V+H
Sbjct: 1354 GCVPFIVVYLSDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFYTFKVNH 1413

Query: 1341 ELLSKCVYITSLTNKEIDELAA 1362
            ELLSKCVYI++LT +EI+EL+ 
Sbjct: 1414 ELLSKCVYISTLTQEEINELST 1435

>CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces
            cerevisiae YAL024c LTE1, start by similarity
          Length = 1318

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1404 (41%), Positives = 820/1404 (58%), Gaps = 139/1404 (9%)

Query: 8    LGIFSADDYYPVPSTSVITYNESRTNKIRKT-VSKADIIALITYLSSPIDPVDYTIFSDF 66
            + IFS  DYYP+PS  VI Y      K  K  V +ADI ++I +LSSP+D VDY  FSDF
Sbjct: 1    MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDF 60

Query: 67   FLIYRDFLSPNELHELLILRFRWCILEI--LENKNVDVEKQKVGEVALIRTFVLLRHSIL 124
            FL YR+FL+P EL++ LILRF+WC+ EI   +++     + ++G+VALIRTFVLLRH IL
Sbjct: 61   FLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGIL 120

Query: 125  NYFVQDFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIPFNEP 184
            N+F  DFL + +LR  L++F N+++ ++  +++   +++LK+AW+H+ K  W+N+ FNEP
Sbjct: 121  NHFADDFLLNENLRLRLISFFNEDI-KSDMKVIVSCLISLKKAWLHAMKLNWDNVLFNEP 179

Query: 185  SSVDFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFKLP 244
            +   + +W+ ++IKDV Q++   KR SR S + IQ  S+PD RNRS+LS+Y S DNF   
Sbjct: 180  AFSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKS-DNFD-- 236

Query: 245  ESLDFNSNRTKQ--TASMMLYPNDNSNXXXXXXXXXXXXXXXTLI---NDNKNDIRKISH 299
              +  NSN+  +  T S +L+  D+SN                 I   N   +++ +   
Sbjct: 237  HMVQSNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTSELDRKDV 296

Query: 300  LSKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPED-NDETIED--NPRV 356
            +S +  MS +I+D     S  +N+IIP TPAKKVE ILN++Y P+    E I++  N   
Sbjct: 297  MSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQESLNQDT 356

Query: 357  KSTPPPIQSSLLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPIS-----KPDMDNF 411
             ST    Q S   +G + LLARWK+NH         K     +  P+      + ++DNF
Sbjct: 357  SST----QKSF-PKGIMSLLARWKKNH---------KIADPKIRKPVGFTNKREAELDNF 402

Query: 412  VKYVISITSLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKV----RG 467
            VKYVISI+SL N K      +N+ + SKFDILSARTIDEVEYL  LE++L  ++    + 
Sbjct: 403  VKYVISISSLTN-KEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKT 461

Query: 468  QANLNNNNLKSIGLENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTK 527
               L+N+    + + N +      D+   SAMDNLDL++TV+ +A+SVISL+N++NK   
Sbjct: 462  TRTLSNDEFNDVNVPNNI------DSKQISAMDNLDLFRTVNGVARSVISLTNSVNK--- 512

Query: 528  LKIVNSPSLSALERRMVMSSFPALNGKVSSSSKIGIEDELVINI----TPPRAKNDGPQR 583
              + N    S L+RR V SS P    +  S S  G+ +   +      +   A++D PQ+
Sbjct: 513  --LNNLSDHSVLDRRRVKSSMPNFYNRERSLS--GLSNYAGLQFYDASSEMSAEDDKPQK 568

Query: 584  LVFHDDGSTLS--LPQTPTKSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVSTI 641
            LVFHD    L   L QT TK    SN   SSPLK VLPNL E    DS+ S D    S +
Sbjct: 569  LVFHDGVDELKNHLTQTFTKPGSISN---SSPLKKVLPNLFEHPSVDSLASGDA--CSYV 623

Query: 642  SYDXXXXXXXXXXXXXXXXNLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSLPSPT 701
            +YD                   SR   +  E   LKKK A  NLREFTFE SK  + + T
Sbjct: 624  TYDSQLSQMGTVKKSMKDET--SRYSNY--EGPVLKKKVAYDNLREFTFEDSKEIIKNDT 679

Query: 702  KSQ----GSPKATHIRQQHHLTPPVSLSPTDPLKMEAEDHLSPLNKLTPQTAIRPASGRI 757
             S      SP          +TP +S+ P  P    +  H     K   ++ I PASGRI
Sbjct: 680  SSLIDILNSP----------VTPDLSILPQTPTGKGSVQHKK---KEKSESIISPASGRI 726

Query: 758  SILRKSLSITQARRNTYAGPPKADLLRDPDFIKKERSLIESEHXXXXXXXXXXXRTSLQS 817
            SI +          +    P    L  D +++K + SL ++E                  
Sbjct: 727  SIAKS--------HHMSLSPNLTKLKEDDEYVKGDNSLGQAEDELIRLEK---------- 768

Query: 818  SVATDNLFNSRKNSPKKVTAEN--KVRLSTTPXXXXXXXXXXXXXG-NTSYNDPARDSMQ 874
                 NL +S+  +   V A N      S+TP               N   +D   +S +
Sbjct: 769  -----NLRDSKLENYNTVVAGNLGAGSGSSTPLGDSPTNVFELPSSINMVESDMDTESFE 823

Query: 875  FTNDKR--IDLREVF-------HNGSVQNVISNDLSSDAISGLSELKDNGINGVSNKYLF 925
             + ++R   +LRE +          S + V SN+  S   S +S         ++NKYLF
Sbjct: 824  SSFEQRQPTNLREQYFKSIGSPETASPRKVNSNNAYSQVSSQMSP-------SLANKYLF 876

Query: 926  SPEEDNTDLISPGKDVEVLKNKFLKNETFEEESE----SIIDGIQEASDEGAMPNVDLDK 981
            SP+ ++ D+ SP K+VE LK++FLK       S     SI   +        M   D DK
Sbjct: 877  SPDNESLDIASPVKNVEDLKSRFLKGNNQSASSSQIGASINTSVTATPKNNDMFGSDFDK 936

Query: 982  EKLKDIADIPDDTGSGDPISIAMMKLEGTYKTNDDDNKTHEDSSSVQDLIKEVEMLNLKK 1041
              LK+I    ++  S DP+ +AMMKLEGT+K N   N T   S    DL KEV++LN+  
Sbjct: 937  NGLKNIMTASEEKLSKDPVELAMMKLEGTFKKNKSGNNTGYSS----DLEKEVDILNIAN 992

Query: 1042 LPTFPKSPLEKRKSLMIERRRQTIMNI--PFTPQNS-EEGLAIEDKCVSPLQVQTLVMNY 1098
            LP    +P +KRKSLM++RRRQT+ NI     P N+ +EG   +++ ++  ++ +L+  Y
Sbjct: 993  LPEMNANPSDKRKSLMLDRRRQTMFNIGPSIYPSNTNDEGY--DEESITDDKIWSLIAQY 1050

Query: 1099 EVQDSSLQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVT 1158
             + D +L   N+ +H+PFILMY+SK +A+Q TLIE+E+LSEIDWKDLL++K+ YKG  +T
Sbjct: 1051 HIDDENLLAKNHANHVPFILMYESKDVAQQFTLIEREILSEIDWKDLLDIKLLYKGPNLT 1110

Query: 1159 SWLQLLIQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQ 1218
            SWLQLLIQN+  +G+DLA+ARFNLTVDW +SEI LT D+KMRRNTI+RFIHVA++CR+ Q
Sbjct: 1111 SWLQLLIQNQEFTGIDLAVARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAEHCRKLQ 1170

Query: 1219 NYNTLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDP 1278
            N+NT+M+IILAL+S+VVQKFT+AWRLIEPGDMLLWE+L+ IP+LD NY  +R ++ ++DP
Sbjct: 1171 NFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTMMKTVDP 1230

Query: 1279 KKGCIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQIVKNFIQRVQWAKFYNIEV 1338
             KGCIPFIVVYLSDL++NSEK  WIV+++VVNY KF T VQIVKNFIQ+VQW+ FY+I  
Sbjct: 1231 LKGCIPFIVVYLSDLTINSEKNTWIVEKRVVNYSKFSTCVQIVKNFIQKVQWSSFYDIIP 1290

Query: 1339 DHELLSKCVYITSLTNKEIDELAA 1362
              ELLSKC+YI+SL+  EI+ L A
Sbjct: 1291 IQELLSKCIYISSLSQDEIEHLTA 1314

>Kwal_26.7083
          Length = 1400

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1450 (39%), Positives = 798/1450 (55%), Gaps = 171/1450 (11%)

Query: 10   IFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTIFSDFFLI 69
            +FS  +YYP PS   ++Y +   N +   + K D+ ALI  L+SP+DP+DY   +DFFL 
Sbjct: 16   VFSEREYYPTPSAEKMSYLKRGANTL---IIKTDLHALIIKLTSPLDPIDYPFLADFFLS 72

Query: 70   YRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHSILNYFVQ 129
            YR FL+PNEL  LL  R +W   E L+    D E+QK+G+V  +RTFV++RH ILNYF Q
Sbjct: 73   YRKFLAPNELLRLLESRLQWAFNESLQ---ADKERQKIGQVTSVRTFVVIRHWILNYFAQ 129

Query: 130  DFLPDSHLRYMLLNFLND---NVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIPF-NEPS 185
            DFL D  LR   ++ +N       + +P+ + G +V++K++W+   K  WE++ F N PS
Sbjct: 130  DFLADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFENSPS 189

Query: 186  SVDFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFKLPE 245
            +VD  EWL F+I+D+       + G RLS YA+Q   +PDFRNRSVLSLY   +NF+LPE
Sbjct: 190  NVD--EWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLPE 247

Query: 246  -SLDFN---SNRTKQ-TASMMLYPNDNSNXXXXXXXXXXXXXXXTLINDNKNDIRKISHL 300
             S   N     + KQ TASM L+P DN                 +            S  
Sbjct: 248  NSAQINRRLGAKIKQRTASMFLFPQDNLPSARLKASSESSEPANS----------HSSGH 297

Query: 301  SKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDETIEDNPRVKSTP 360
            SK      V+KD+ YPTSP+++++IPPTPAKKVEFIL S Y+P D+     D    K+  
Sbjct: 298  SKSESGPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEADPANAKTDK 357

Query: 361  PPIQSSL-LQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPDMDNFVKYVISIT 419
                ++    +G +GLL++WK+NH   S   K  +      +P ++ +++N +K V SIT
Sbjct: 358  VKKHNNHSYNKGMVGLLSKWKKNHNLRSENHKAHS-----ESPKNQ-EIENLIKLVFSIT 411

Query: 420  SLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRGQANLNNNNLKSI 479
            SLE+ K   S +  + ++SKFDILSARTIDEVEY +++EN+L  K+R +  L N   + I
Sbjct: 412  SLEH-KQDQSEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLFN--FERI 468

Query: 480  GLENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTKLKIVNSPSLSAL 539
              EN     P       SAMDNL+LYKTVSS+A SVISLS TL     +    SPS +A 
Sbjct: 469  HHENPQTQSPEA----VSAMDNLNLYKTVSSIASSVISLSKTLQYHHAV----SPSAAAQ 520

Query: 540  ERRMVMSSFPALNGKVSSSSKIGIEDELVI-NITPPRAKNDGPQRLVFHDDGSTLSLPQ- 597
            ERR V S+         ++S +   D L+  +I  P   NDGP++LVFH       + + 
Sbjct: 521  ERRRVKSAEVFFR----NNSVLNFTDALLTRDIKTPATGNDGPRKLVFHGPMGMERIRKE 576

Query: 598  --------TPTKSNRKSNIRHSSPLKNVLPNLNEVDLSD-SVCSDDESF-VSTISYDXXX 647
                    TPTK+   S   HS+P      N  EV+  D S  S  +   +S++  +   
Sbjct: 577  EFRFHHYKTPTKTGLTS---HSTPSVMQSVNTKEVNTEDRSRYSPTKGIRISSVITEVDD 633

Query: 648  XXXXXXXXXXXXXNLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSLPSPTKSQGSP 707
                         ++ S  L   + E  LK+K   KNLREF FE      P  T  Q   
Sbjct: 634  TFSKHENSMNSAQSVNSVSL---DTELPLKRKEGLKNLREFNFEEVA-DHPEVTDQQ--- 686

Query: 708  KATHIRQQHHLTPPVSLSPTDPLKMEAEDH-------------LSPLNKLTPQTAIR--- 751
            + T  ++         LS  D L+ +AED                 + + TP +++    
Sbjct: 687  EVTDQQELGEGENGERLSSAD-LQNDAEDDNASFFTTFDDVSVRESIKRFTPASSVAQKS 745

Query: 752  -PASGRISILR-KSLSITQARRNTYAG----------------------------PPKAD 781
              +SGRISI + +  S++Q R +   G                                 
Sbjct: 746  VTSSGRISIRKSRGQSVSQPRTSVLGGLIVQEGAFSRLDEELLNNEEEMKNLEERTSALV 805

Query: 782  LLRDPDFIKKERSLIESEHXXXXXXXXXXXRTSLQSSVATDNLFNSRKNSPKKVTAENKV 841
            L    D  +KERS  E E            R S  +SV+T  LF S+ NSP K+  +  +
Sbjct: 806  LSAKEDEKEKERSDCEEE-------DAADDRASNATSVSTQLLFTSQNNSPNKMDLKELL 858

Query: 842  RLSTTPXXXXXXXXXXXXXGNTSYNDPARDSMQFTNDKRIDLREVFHNGSVQNVISNDLS 901
                 P              ++  +  +  S Q TN     L         + V++  + 
Sbjct: 859  DNDRFPPGNKLIRLSSIPSMHSIVSGDSFSSFQTTNT--FGLHSTNSKTGARAVVTPSMD 916

Query: 902  SDAISGLSE--LKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFL------KNET 953
            ++  SG  +  L   G +  +NKYLFSP+ D+ D  SP K++E LKNKF+          
Sbjct: 917  AE-FSGPKDSLLGPEGDDREANKYLFSPDSDSLDFASPEKNMEDLKNKFISPIVSEAPSL 975

Query: 954  FEEESESIIDGIQEASDEGA----------MPN-------------VDLDKEKLKDIADI 990
             EE++    D  QE     +          +P+                +  +L   A +
Sbjct: 976  NEEQTSREFDDDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFAKL 1035

Query: 991  PDDTGSGDPISIAMMKLEGTYKTNDDDNKTHEDSSSVQDLIKEVEMLNLKKLPTFPKSPL 1050
             D++  GDP+++A+MKLEGT+ + ++  K   D+        ++E L  ++L        
Sbjct: 1036 TDESLHGDPVNVALMKLEGTF-SKENKEKGENDA--------DIEKLKERRLTGLGS--- 1083

Query: 1051 EKRKSLMIERRRQTIMNIPFTPQNSEEGLAIEDKCVSPLQVQTLVMNYEVQDSSLQISNN 1110
             +R+S +IE+RRQ    IP TP++ E+    E+   + L++  L+ NY++QD  L +SN 
Sbjct: 1084 RERRSFLIEKRRQIKSEIPLTPRSKEKVKQEEEVRATDLEITELLENYKIQDKRLNVSNA 1143

Query: 1111 EHHIPFILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETL 1170
            + H+PFILMYDS+SIAEQ+TL+E+E+L+EIDWKDLL+LK++ +  +VTSWLQLL+QNE L
Sbjct: 1144 QQHVPFILMYDSRSIAEQLTLVEREILNEIDWKDLLDLKLKREVPSVTSWLQLLLQNERL 1203

Query: 1171 SGVDLAIARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILAL 1230
            SG+DLAIARFNLTVDWI+SEI +T D K+RRNTIQR IHVA++C+ FQNYNTLM+IILAL
Sbjct: 1204 SGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILAL 1263

Query: 1231 SSIVVQKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYL 1290
            SS+VVQ + DAWRLIEPGD+L WE LK++PSL++NY  IR LLN ++P KGCIPFIVVYL
Sbjct: 1264 SSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYL 1323

Query: 1291 SDLSLNSEKRNWIVDRKVVNYHKFETSVQIVKNFIQRVQWAKFYNIEVDHELLSKCVYIT 1350
            SDL+LN+EK NWIV  +V+NY KF+T+VQIVKNFIQR QW+KFY   V+ ELLSKCVYI+
Sbjct: 1324 SDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKCVYIS 1383

Query: 1351 SLTNKEIDEL 1360
             LT  EI+ L
Sbjct: 1384 CLTQNEINHL 1393

>ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH]
            complement(891524..895843) [4320 bp, 1439 aa]
          Length = 1439

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/1494 (38%), Positives = 819/1494 (54%), Gaps = 197/1494 (13%)

Query: 5    MPELG--IFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTI 62
            M E G  +FSA DYYP PS  VITY      +    +  AD+ AL+  L+SP+D V+Y +
Sbjct: 8    MAESGRAVFSAADYYPAPSGRVITYAAGGRGR---QIMAADVTALVAALTSPVDGVEYEL 64

Query: 63   FSDFFLIYRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHS 122
            F+DFFL+YR+FL    L ELL  RF W + EI   +    + + VGE+ L+RTFVLLRH 
Sbjct: 65   FADFFLVYRNFLEARRLLELLEARFDWSLGEIGAGR---AKARVVGEITLVRTFVLLRHW 121

Query: 123  ILNYFVQDFLPDSHLRYMLLNFLND---NVYQTSPRIVSGSIVNLKRAWIHSAKQTWENI 179
            ++NYF QDFLPD  LR   L F+N        T P+IV+  +V+LK+ W ++ +  W+++
Sbjct: 122  VINYFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDL 181

Query: 180  PFN---EPSSVDFNEWLLFEIKDVIQM--EEQLKRGSRLSEYAIQGSSSPDFRNRSVLSL 234
                  E  S D   WL F+I DV Q+  E  L+R SRLS YA Q S++P FRN SVLSL
Sbjct: 182  DLEREFELRSAD--AWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSL 239

Query: 235  YNSTDNFKLP-ESLDFNSNRT----KQTASMMLYPNDNSNXXXXXXXXXXXXXXXTLIND 289
            Y   DNF+LP  + D+N  +     K+TASM LYP D+ N                  + 
Sbjct: 240  YRPKDNFQLPVRNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHS 299

Query: 290  NKNDIRKISHLSKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDET 349
            +   +RKISH+SK+ ++S VIK+V YPTSPA+    PPTP+KK+EF +NS Y+P    E 
Sbjct: 300  H---VRKISHISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAEC 356

Query: 350  IEDNPRVKSTPPPIQSSLLQRGAIGLLARWKRNH-TRNSRKEKIKTTQSGVNTPISKPDM 408
              + P  +  P   +S    R   GLL++W+ NH +R+   ++  T +         P M
Sbjct: 357  SRE-PSAQKKP---RSPNGYRAVTGLLSKWRMNHLSRHKACDRTSTVE---------PAM 403

Query: 409  DNFVKYVISITSLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKV--- 465
            DN +KYV SI+SLE+ K     E  ++  SKFDILSARTI+EVE+LI++ENE+ QKV   
Sbjct: 404  DNLIKYVFSISSLESPKGDIQEE-REISPSKFDILSARTIEEVEHLITVENEVLQKVTAH 462

Query: 466  RGQANLNNNNLKSIG---LENTMPF---EPPKDTANFSAMDNLDLYKTVSSLAQSVISLS 519
             G+  + +++ +      L N  P     P  +   +S +DNL+LY+TVS++A SVI L+
Sbjct: 463  EGKVPITSSSAREARFPPLLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLT 522

Query: 520  NTLN-KSTKL-------KIVNSPSLSALE---RRMVMSSFPALNGKVSSSSKIGIE---- 564
             T + + TK+             SLSA      RM++S     +G  +S + + +     
Sbjct: 523  RTASQRQTKVTLPPPPPLRQRPTSLSAFRGSSSRMLLSDSLRRDGYQNSKASLHLRPLAS 582

Query: 565  -DELVINITPPRAKNDGPQRLVFHDDGSTLSLPQTPT-KSNRKSNIRHSSPLKNVLPNLN 622
             DE   N      +   P +++FH    T +L +TPT K      +  +SP  +++    
Sbjct: 583  ADE---NAEGSSVQASNPPQVIFH----THALIKTPTDKVFDAKAVEDTSPKTSLV---- 631

Query: 623  EVDLSDSVCSDDESFVSTISYDXXXXXXXXXXXXXXXXNLYSRPLTFKNEEQTLKKKTAS 682
               ++D+      S+ STI+YD                       T    +  L +KT  
Sbjct: 632  STQVTDA---RPPSYESTITYDSDLQDITMRDYNTSNQTENHNDGTLDTNQPILNRKTNH 688

Query: 683  KNLREFTFETS-----------------------------KLSLPSPTKSQGSPKATHIR 713
             NLREF FE S                              +S P PT  + +   TH +
Sbjct: 689  SNLREFLFEASTSGSPAAHTTQEPTDESTGRLGACPTVMRSISEPIPTVMRSNNGDTHTK 748

Query: 714  Q------QHH-------------LTPPVSLSPT-DPL-KMEAEDHLS-PLNKLTPQTAIR 751
                   Q H             L+PP+++  + D L +      +S P N +T   ++ 
Sbjct: 749  AKPEFNIQSHDDTFSRKPMRPSLLSPPINIRGSFDTLHRKNVPAPISVPPNPVTKNASVS 808

Query: 752  PASGRISILRKSLSITQ-ARRNTYAGPPKADLLRDPDFIKKERSLIESEHXXXXXXXXXX 810
            PASGRISI++KS + T    R+       A + +   F K+E SL   E+          
Sbjct: 809  PASGRISIIKKSGNRTSPTTRSPLLDTTSAFMEKTDSFAKQEASLNALENDLQAILITTG 868

Query: 811  XRTSL------QSSVATDNLFNSRKNSPKKVTA--------ENKVRLSTTPXXXXXXXXX 856
             R+S        S++AT+ L  S + SP+K T         ++     T P         
Sbjct: 869  RRSSTFSKSGTDSTIATNVLLESIQTSPQKNTHLMTNISEDDSASNTDTKPMEFSSVGIE 928

Query: 857  XXXXGNTSYND----PARDSMQFTNDKRIDLREVFHNGSVQNV----ISNDLSSDAISGL 908
                 ++S+ D    PA  S    N          ++G    +      +  +S   S L
Sbjct: 929  SSASNSSSFADALCEPANRSSPSHNP---------YSGQCTTIEDRYRRSRFASQPDSLL 979

Query: 909  SELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNE-------TFEEESESI 961
              + +NG     NKY+FSP E   D  SP KD+E LK KF+  +         + +   I
Sbjct: 980  GYINENG-----NKYIFSPGETAED-ASPKKDMETLKTKFMTTKEPPVCPSGNDADLALI 1033

Query: 962  IDGIQEASDEGAMPNVD-LDKEKLKDIAD--IPDDTGSG------DPISIAMMKLEGTYK 1012
            I  ++E +     P+ + ++ E   D A+   P  T S       DP+++A+MKLEGT+ 
Sbjct: 1034 ISKLKETN-----PSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFA 1088

Query: 1013 --TNDDDNKTHEDSSSVQDLIKEVEMLNLKKLPTFPKS-PLEKRKSLMIERRRQTIMNIP 1069
                +D+  +  +S     L KEVE L+ +K   FP S  + KR+S+ IERRR T+ +I 
Sbjct: 1089 KPAKEDNTASKLNSPRSSVLAKEVEKLDFQKW-RFPSSKTMNKRQSMFIERRR-TMTDI- 1145

Query: 1070 FTPQNSEEGLAIEDKCVSPLQVQTLVMNYEVQDSSLQISNNEHHIPFILMYDSKSIAEQM 1129
            F+    +     +   +S  +++ L+  Y++QD  L I N EHH+PFILMYDS SIA+QM
Sbjct: 1146 FSSATEDTSSEEQSPKLSDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCSIAKQM 1205

Query: 1130 TLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVDWIVS 1189
            TLIE+E+++EIDWKDLL+L ++     VTSWLQLL+ NE LSG+DLAIARFNLTVDWI+S
Sbjct: 1206 TLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDWIIS 1265

Query: 1190 EITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLIEPGD 1249
            E+ +T D+K+RRN IQR IHVA++CR +QNYNT+MEI+LAL+S+VVQKFT +WRLIEP D
Sbjct: 1266 ELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPAD 1325

Query: 1250 MLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVDRKVV 1309
            ML WE LK IPSLDRNY  +RNLLNS+DP KGCIPF+VVYLSDL+LNSEKR+WIV  ++V
Sbjct: 1326 MLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIVPNEIV 1385

Query: 1310 NYHKFETSVQIVKNFIQRVQWAKFYNIEVDHELLSKCVYITSLTNKEIDELAAL 1363
            NY+KF+T+VQIVKNFIQRVQWA+FY+I  D +LLSKCVYI++L+++EI  L + 
Sbjct: 1386 NYNKFQTNVQIVKNFIQRVQWARFYDIRADEDLLSKCVYISALSHEEIGYLTSF 1439

>KLLA0A04059g complement(361328..365428) similar to sp|P07866
            Saccharomyces cerevisiae YAL024c LTE1 GDP/GTP exchange
            factor, start by similarity
          Length = 1366

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/1440 (38%), Positives = 802/1440 (55%), Gaps = 181/1440 (12%)

Query: 10   IFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTIFSDFFLI 69
            +FS  + YPVPS SV+T  + R   +R  + K  + AL+  LSSP+D VDY++ +DFFL+
Sbjct: 15   LFSRPELYPVPSESVLTV-DLRDGTVR--ILKCTLPALLVQLSSPLDKVDYSMLTDFFLV 71

Query: 70   YRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHSILNYFVQ 129
            YR+F+S  +L +L+  RF+W I   L   +   +++   EV L+R FVL+RH + NYF Q
Sbjct: 72   YRNFMSSQKLLDLIQERFQWAI--DLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQ 129

Query: 130  DFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIP--FNEPSSV 187
            DF+ D+ LR   L F+N   Y    R +   I++LK+ W+ + +  WE++     E + V
Sbjct: 130  DFVVDTSLRRQFLQFING--YSPVDRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVV 187

Query: 188  DFNEWLLFEIKDV-----IQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFK 242
              ++WL +EI+DV      +  E   +G RLS  A+Q  ++P  RN S+LSL ++ +   
Sbjct: 188  SRDDWLKWEIEDVPSGSSSETGEGSTKGKRLSFIALQNINNPVLRNESLLSLLHTREKIP 247

Query: 243  LPESLD----FNSNRTKQ-TASMMLYPNDNSNXXXXXXXXXXXXXXXTL-------INDN 290
            LP+  +      S R KQ T SM+L+P + SN                        I D 
Sbjct: 248  LPQQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDP 307

Query: 291  KN--DIRKI-SHLSKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDND 347
            KN  D + I   LS++ ++S ++KD++YP++P+++  +PPTPAK +EFIL + Y+  D  
Sbjct: 308  KNSKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETD-- 365

Query: 348  ETIEDNPRVKSTPPPIQSSLLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPD 407
               E +    ST     ++   +G +GLL++WK NH R       K T + V  P   P 
Sbjct: 366  -LPEQSNGSDSTNTVNGNNTNHKGILGLLSKWKLNHQR-------KPTVNPVQNP---PR 414

Query: 408  MDNFVKYVISITSLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRG 467
            ++N +KYV SI+SL+N   HA+  + D ++S FDILSARTIDEVEYL+S+E++L  K+  
Sbjct: 415  VENLIKYVFSISSLDN---HANP-LPDSLSSMFDILSARTIDEVEYLVSVESDLLAKLEA 470

Query: 468  QANLNNNNLKSIGLENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTK 527
                     K +  E +       ++ ++S +DNL+LYKTVSS+A SVISLS TLN  T 
Sbjct: 471  ---------KKLTTEISKLETNEDESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTN 521

Query: 528  LKIVN--SPSLSALERRMVMSSFPALNGKVSSSSKIGIEDELVINITPPRAKNDGPQRLV 585
                +  SPS SALER+ + +S P L     ++S+  I + L+    P    N  P+RLV
Sbjct: 522  KSTTHLLSPSTSALERKNIRNSAPMLYSY--NNSRYSITNALMG--LPNTNDNSSPKRLV 577

Query: 586  FHDDGSTLSLPQTPTKSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVSTISYDX 645
            FHD         +PTK          + L N L N+ E +       + +S  S ++YD 
Sbjct: 578  FHDPTRN-----SPTKK---------AILANNLNNIGEYN------GERDSITSIVTYDS 617

Query: 646  XXXXXXXXXXXXXXXNLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSLPSPTKSQG 705
                              S    F     TLK+K    +LR F FE S  S    + S  
Sbjct: 618  AFSDISSSGNILSQHKGSSN--IFMESAPTLKRKLNVNDLRRFNFEKSD-STDDRSCSPQ 674

Query: 706  SPKATHIRQQHHLTPPVSLSPTDPLKMEAEDHLSPLNKLTPQTA------------IRPA 753
            + +AT        +     +  D  + E ED  S +      T+             RP 
Sbjct: 675  NREATETSATSMESDANDNAIQDEYENENEDIASLITAYEESTSEIDTQCQNNAQIRRPT 734

Query: 754  SGRISILRK-SLSITQARRNTYAGPPKADLLRDPDFIKKERSLIESEHXXXXXXXXXX-- 810
            SGRISI R  S++   + R+     P   +L +  FI+++++L  ++             
Sbjct: 735  SGRISITRNYSVASPNSLRSILPKSPL--ILGNEVFIERDKALAANQDIISELEETTSLL 792

Query: 811  ----------XRTSL-----QSSVATDNLFNSRKNSPKK-VTAENKV------------- 841
                       R S+       S++T+ LF+S + SP+K V  E  V             
Sbjct: 793  LNDNDRKFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTP 852

Query: 842  --------RLSTTPXXXXXXXXXXXXXGNTSYNDPARDSMQFTNDKRIDLREVFHNGSVQ 893
                    +LS TP              + +      +  Q T      LRE +H   ++
Sbjct: 853  VLCKQPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTT-----LREKYH---LE 904

Query: 894  NVISNDLSSDAISGLSELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNET 953
               +ND+  + +  L        N  +NKYLFSP+ D+ D  SP K+++ LK +F+   T
Sbjct: 905  KQATNDIFEEDVENL--------NPENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQST 956

Query: 954  FEEES---ESIIDGIQEASDEGAMPNVDLDKEKLKDIADIPDDTG--SGDPISIAMMKLE 1008
             E+ S   E I     E  D G      +DK+KL+DI +  DDT   S DP+++A+MKLE
Sbjct: 957  DEQTSLDEEEIATQDNENKDHG------IDKKKLEDIMNGIDDTADTSMDPVNLALMKLE 1010

Query: 1009 GTYKTNDDDNKTHEDSSSV--QDLIKEVEMLNLKKLPTFPKSPLEKRKSLMIERRRQTIM 1066
            GTY   D   K  +D S     +L +EVE   + +    P+S   KR+S+ I+RRR T+ 
Sbjct: 1011 GTY---DKGEKEIDDKSPSINSELAREVENFQIVQTAALPESA-RKRQSMFIQRRRNTM- 1065

Query: 1067 NIPFTPQNSEEGLAIEDKCVSPL-----QVQTLVMNYEVQDSSLQISNNEHHIPFILMYD 1121
             I F+ ++S   L  +D   + L     Q++ L+  Y + DS L+I N E HIPFILMYD
Sbjct: 1066 -IDFSVRDS---LIDKDSSCTRLENTDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYD 1121

Query: 1122 SKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFN 1181
            SKS+A Q+TLIEKE+LSE+DWKDLL+L +  +    TSWLQLL+QNE LSG+DLAIARFN
Sbjct: 1122 SKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFN 1181

Query: 1182 LTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDA 1241
            LTVDWI+SEI +T+D+++RRNTIQRFIH+A++C+E QNYNTLMEIILAL+SIVVQKFT+ 
Sbjct: 1182 LTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTET 1241

Query: 1242 WRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRN 1301
            WRL+EPGD+L WE LK IPSL++NYS IR L++ ++P  GCIPFIVVYLSDLSLN EKR 
Sbjct: 1242 WRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRT 1301

Query: 1302 WIVDRKVVNYHKFETSVQIVKNFIQRVQWAKFYNIEVDHELLSKCVYITSLTNKEIDELA 1361
            WIV  +V+NY+KF+T+VQIVKNF+Q++QW+KFYNI++DHELLSKCVYITSL++ EI+ ++
Sbjct: 1302 WIVHDEVLNYNKFQTNVQIVKNFVQKMQWSKFYNIDIDHELLSKCVYITSLSHDEINSIS 1361

>YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown
            function [3147 bp, 1048 aa]
          Length = 1048

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 104/220 (47%), Gaps = 21/220 (9%)

Query: 1117 ILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLA 1176
            IL  D    A Q+T++E E+  EI   D L  KI +K K   S+           G++  
Sbjct: 744  ILAVDPVLFATQLTILEHEIYCEITIFDCLQ-KI-WKNKYTKSY-------GASPGLNEF 794

Query: 1177 IARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQ 1236
            I+  N   ++I   +    D   R   +  FI +A+YCR+F N++++  II AL S  + 
Sbjct: 795  ISFANKLTNFISYSVVKEADKSKRAKLLSHFIFIAEYCRKFNNFSSMTAIISALYSSPIY 854

Query: 1237 KFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSL- 1295
            +    W+ + P    L + L  +    +N+   RN L SL     C+PF  VYLSDL+  
Sbjct: 855  RLEKTWQAVIPQTRDLLQSLNKLMDPKKNFINYRNELKSLHSAP-CVPFFGVYLSDLTFT 913

Query: 1296 NSEKRNWIV----------DRKVVNYHKFETSVQIVKNFI 1325
            +S   +++V          ++K +N++K    V I++  I
Sbjct: 914  DSGNPDYLVLEHGLKGVHDEKKYINFNKRSRLVDILQEII 953

>CAGL0E03476g complement(318956..323650) similar to sp|P04821
            Saccharomyces cerevisiae YLR310c CDC25 GDP/GTP exchange
            factor for RAS1P and RAS2P, start by similarity
          Length = 1564

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 89/202 (44%), Gaps = 13/202 (6%)

Query: 1126 AEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVD 1185
            A Q+TLIE +L   I   + L+           +W            +   IA  N   +
Sbjct: 1284 AAQLTLIEHDLYLRITMFECLD----------RAWGNKYCDMGGSPNITRFIANANSLTN 1333

Query: 1186 WIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLI 1245
            ++   I    DV+ R   IQ FI VAQ+C+E  N++++  I+ AL S  + +    W L+
Sbjct: 1334 YVSFTIVKHADVQKRAKLIQYFITVAQHCKELNNFSSMTAIVSALYSSPIYRLKQTWNLV 1393

Query: 1246 EPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVD 1305
                  + + L  +    RN+   R LL S+     C+PF  VYLSDL+      +  +D
Sbjct: 1394 PTETKEVLDNLNSLMDSKRNFIKYRELLRSVK-DVACVPFFGVYLSDLTFTFAGNSDYLD 1452

Query: 1306 RK--VVNYHKFETSVQIVKNFI 1325
             K  ++N+ K      I++  +
Sbjct: 1453 GKTDIINFGKRSKIANIIEGIL 1474

>YLR310C (CDC25) [3699] chr12 complement(752226..756995)
            Guanine-nucleotide exchange protein for Ras1p and Ras2p,
            has an SH3 domain [4770 bp, 1589 aa]
          Length = 1589

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 80/179 (44%), Gaps = 11/179 (6%)

Query: 1117 ILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLA 1176
            +L  D  + A Q+T++E +L   I   + L+           +W            +   
Sbjct: 1301 LLDIDPYTYATQLTVLEHDLYLRITMFECLD----------RAWGTKYCNMGGSPNITKF 1350

Query: 1177 IARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQ 1236
            IA  N   +++   I    DVK R    Q F+ VAQ+C+E  N++++  I+ AL S  + 
Sbjct: 1351 IANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIY 1410

Query: 1237 KFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSL 1295
            +    W L+      L + L ++    RN+   R LL S+     C+PF  VYLSDL+ 
Sbjct: 1411 RLKKTWDLVSTESKDLLKNLNNLMDSKRNFVKYRELLRSV-TDVACVPFFGVYLSDLTF 1468

>Scas_621.1*
          Length = 1323

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 82/174 (47%), Gaps = 15/174 (8%)

Query: 1124 SIAEQMTLIEKELLSEIDWKDLLN--LKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFN 1181
            ++A+Q++L+E EL  +I   + L      +Y G   +  + + I               N
Sbjct: 1086 TMAQQLSLLEHELYCQITIFECLERVWGKKYGGFGGSPNITIFINGAN-----------N 1134

Query: 1182 LTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDA 1241
            LT +++   I    ++  R   I  FI VAQYCR+  N++++  II AL S  V +    
Sbjct: 1135 LT-NFVSYTIVSNANISRRIQIITYFIAVAQYCRDINNFSSMTAIISALYSSPVYRLKKT 1193

Query: 1242 WRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSL 1295
            W L+      L  EL  +    +N+   R LL S+  +  C+PF  VYLSDL+ 
Sbjct: 1194 WHLVPESSKALLRELNTLMDSTKNFIRYRQLLKSVR-QVVCVPFFGVYLSDLTF 1246

>Kwal_14.2313
          Length = 1517

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 86/175 (49%), Gaps = 6/175 (3%)

Query: 1177 IARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQ 1236
            I+  N   +++   I    + K R    Q FI VA++C E  N++++  I+ AL S  + 
Sbjct: 1284 ISSANSLTNYVSFAIVKQTNTKKRARVTQHFISVAEHCYELNNFSSMTAIVSALYSSPIF 1343

Query: 1237 KFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLN 1296
            +   +W L+      + E L  +    +N++T RN L ++     C+PF  VYLSDL+  
Sbjct: 1344 RLKKSWALVPEESQKVLENLNTLMDPAKNFATYRNWLKTIQ-DTACVPFFGVYLSDLTFI 1402

Query: 1297 SEKRNWIVDR--KVVNYHKFETSVQIVKNF--IQRVQWAKFYNIEVDHELLSKCV 1347
            +E     + R  +++N+ K    V+I+K     Q +++ KF   +     + +C+
Sbjct: 1403 AEGNPNYLHRSSEIINFSKRVRIVEILKEIASYQSIRY-KFKRYDDVQAFIGECM 1456

>Sklu_2189.4 YLR310C, Contig c2189 8340-12920
          Length = 1526

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 92/208 (44%), Gaps = 13/208 (6%)

Query: 1117 ILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLA 1176
            +L  DS   A+Q+T+ E  L  +I   + L+           +W            +   
Sbjct: 1239 LLDIDSLDYAKQLTIKEHSLFYKISPFECLD----------RTWGNKYCNMGGSKNITEF 1288

Query: 1177 IARFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQ 1236
            I+  N   +++   I    D+K R   IQ FI+VA +C E  N+++L  II AL S  + 
Sbjct: 1289 ISNSNHLTNYVSFMIVKQTDIKKRIQLIQFFINVAAHCHELNNFSSLTAIISALYSSPIY 1348

Query: 1237 KFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLN 1296
            +    W  +      L EEL  +    +N+   R LL S+     C+PF  VYLSDL+  
Sbjct: 1349 RLKRTWAAVPEEYKKLLEELNTLMDSAKNFIRYRQLLKSIGDFP-CVPFFGVYLSDLTFT 1407

Query: 1297 SEKRNWIVDRK--VVNYHKFETSVQIVK 1322
            +      + R   +VN+ K    ++I+K
Sbjct: 1408 ANGNPDFLHRNTVLVNFGKRVRILEILK 1435

>KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharomyces
            cerevisiae YLR310c CDC25 GDP/GTP exchange factor for
            RAS1P and RAS2P, hypothetical start
          Length = 1537

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 84/182 (46%), Gaps = 19/182 (10%)

Query: 1120 YDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIAR 1179
            +D  + A+Q+TL E  L S ID  + L+   +  GK V  +           G    I+ 
Sbjct: 1266 FDPITFAQQLTLEEHILYSAIDQFECLD---RIWGKKVCDF-----------GGSANISN 1311

Query: 1180 F----NLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVV 1235
            F    N   D++   I    D+K R   +Q FI V++ C   +N++++  I+ AL S  +
Sbjct: 1312 FITSSNHLTDFVSYTIVKETDLKKRAQILQFFIQVSEQCYNLKNFSSMTAIVSALYSSPI 1371

Query: 1236 QKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSL 1295
             +    +  +    +   ++L  +    RN+   R+LL ++     C+PF  VYLSDL+ 
Sbjct: 1372 FRLKKTFDRLPKHILNSLDKLNTLMDSTRNFFRYRDLLKTVH-DVPCVPFFGVYLSDLTF 1430

Query: 1296 NS 1297
             +
Sbjct: 1431 TA 1432

>ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W -
            SH] complement(623312..627841) [4530 bp, 1509 aa]
          Length = 1509

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 78/179 (43%), Gaps = 15/179 (8%)

Query: 1121 DSKSIAEQMTLIEKELLSEIDWKDLLN--LKIQYKGKAVTSWLQLLIQNETLSGVDLAIA 1178
            ++   A+Q+T+ E  L  +I   + L+   K +Y     +  +   IQN           
Sbjct: 1232 EASVFAKQLTIKENLLYCKIHLFECLDRTWKTRYCDFGGSPNISSFIQNS---------- 1281

Query: 1179 RFNLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKF 1238
              N   +++   I    D+K R   +Q FI VA+ CR   N++++  I  A+ S  + + 
Sbjct: 1282 --NHLTNYVSYMIVKQTDLKRRVQIVQYFIDVAETCRALNNFSSMTAITSAMLSSSIYRL 1339

Query: 1239 TDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNS 1297
               W ++        + +  +    +N+   R LL SL     C+PF  VYLSDL+  +
Sbjct: 1340 KRTWAMVHDNYKESLDRMNALMDSAKNFRKYRELLESLG-DCPCVPFFGVYLSDLTFTA 1397

>Scas_604.15
          Length = 1676

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 93/209 (44%), Gaps = 27/209 (12%)

Query: 1126 AEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVD 1185
            A+Q+T+ E EL  EI   + L+           +W            +   I   N   +
Sbjct: 1374 AQQLTIREHELYLEITMFECLD----------RAWGSKYCNMGGSRNISKFIMNANSLTN 1423

Query: 1186 WIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLI 1245
            ++   I    DVK R   IQ FI VA++C++  N++++  I+ AL S  + +    W  I
Sbjct: 1424 FVSYTIVRHMDVKKRSKLIQYFITVAEHCKDLNNFSSMTAIVSALYSSPIFRLKKTWSKI 1483

Query: 1246 EPGDMLLWEELKHIPSL---DRNYSTIRNLLNSLD--PKKGCIPFIVVYLSDLSL----N 1296
                + + + LK + SL    RN+   R  L  +   P+   IPF  +YLSDL+     N
Sbjct: 1484 P---VEIKKSLKKLNSLMDSKRNFIKYRESLKLVKDVPR---IPFFGIYLSDLTFTFVGN 1537

Query: 1297 SEKRNWIVDRKVVNYHKFETSVQIVKNFI 1325
             E  +   D  ++N+ K    V I+++ +
Sbjct: 1538 PEFLHGTTD--IINFSKRSRIVDIIEDIL 1564

>Kwal_33.13598
          Length = 1412

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 99/216 (45%), Gaps = 29/216 (13%)

Query: 1125 IAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTV 1184
            +A+Q++LIE  L   +   +L+N     K K +++             V+  I   NL  
Sbjct: 1126 VAKQLSLIESTLYLAVGPGELMNQNFIPKKKHLSAS----------PDVERIIDFANLLS 1175

Query: 1185 DWIVSEITLTR-DVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWR 1243
            ++++  I  ++  +K+R + +  ++++A     F+N+NT+  I+ AL S ++ +    W 
Sbjct: 1176 NYVIESIVASKLTLKVRASRLTAWLNIALSALYFRNFNTVATIMTALQSHILSRVELVWE 1235

Query: 1244 LIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLD-----PKKG-------CIPFIVVYLS 1291
             I    + L++ L  I   D+NYS  R  L  L      P+ G        +PF  ++L 
Sbjct: 1236 NISEKYLELYKYLSKIIHPDKNYSIYRLKLRELATGFSIPESGGNRSPIPIVPFFALFLQ 1295

Query: 1292 DLSLNSEKRNWIVD------RKVVNYHKFETSVQIV 1321
            DL+   E  +   D       K++N  KF  + +I+
Sbjct: 1296 DLTFIHEGIHDFRDPSSFRPNKLINIDKFFRTTKII 1331

>CAGL0D06512g complement(617453..621379) some similarities with
            sp|P04821 Saccharomyces cerevisiae YLR310c CDC25 or
            sp|P14771 Saccharomyces cerevisiae YLL016w SDC25,
            hypothetical start
          Length = 1308

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 109/268 (40%), Gaps = 22/268 (8%)

Query: 1087 SPLQVQTLVMNYEVQDSSLQISNNEHHIPF-------ILMYDSKSIAEQMTLIEKELLSE 1139
            S L+  T ++ Y      +  SN  H   F       IL   ++++A+Q+ LIE+ L  +
Sbjct: 951  SLLEPSTEILEYNNDLKRIGFSNLVHDAKFTANVYESILDIPAENVAQQLALIEENLYEK 1010

Query: 1140 IDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVDWIVSEITLTRDVKM 1199
            I   D L+            W            +   I+  N    ++  +I        
Sbjct: 1011 ITIFDCLD----------RVWGCKQCDFGGSKNISEFISFANSITKYVSYKILQYDTAAK 1060

Query: 1200 RRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHI 1259
            R   I  FI VA+   E  N++++  II  + +  V +  ++W+L+         EL  +
Sbjct: 1061 RGQAIGYFIKVARISYEINNFSSMTAIISGIYASPVNRLHESWKLVSRELQNTLRELDDL 1120

Query: 1260 PSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVD--RKVVNYHKFETS 1317
                +N+   R  L ++   + CIPF  VYLSDL          VD  R  VN+ K    
Sbjct: 1121 MISTKNFLKYRLTLKNVG-NRPCIPFFGVYLSDLLFTHNGNPDYVDKSRGTVNFTKRFRI 1179

Query: 1318 VQIVKNFI--QRVQWAKFYNIEVDHELL 1343
              I++     ++V++    ++++ H ++
Sbjct: 1180 FDIIQEIFHYKKVKYEYKADLDIIHHIM 1207

>CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyces
            lactis, hypothetical start
          Length = 1247

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 95/218 (43%), Gaps = 37/218 (16%)

Query: 1125 IAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLA-IARF-NL 1182
            +A+Q+T++E  L   +   D++N K                 N T++  ++A I  F N 
Sbjct: 969  VAKQLTILESLLFMRLTPFDIVNYK----------------ANSTITSSNVAAITSFTNQ 1012

Query: 1183 TVDWIVSEITLTRDVKMRRNTI-QRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDA 1241
               ++++ I   R     R TI + ++ +A      +N+N++  I+ A+ +  + + T  
Sbjct: 1013 LSQYVMNGILTPRINDATRTTILKAWLRIALSALYLRNFNSVASIMTAIQNHSITRLTGV 1072

Query: 1242 WRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSL--DPKKGCI----------PFIVVY 1289
            W+ +   D LL+E L  I   + N+   R  L  +  D  +G I          PF  ++
Sbjct: 1073 WQQLSRKDTLLYEYLSRIIHPNHNFKVYRQKLKKIIDDSSQGSIIPVKSHVPVVPFFNLF 1132

Query: 1290 LSDLSL----NSEKRNWIVDR--KVVNYHKFETSVQIV 1321
            L D++     NS  RN    R  K +N  KF    +IV
Sbjct: 1133 LQDITFIHEGNSTFRNPDSFRPNKPINVDKFYRITKIV 1170

>KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030
            Candida albicans, hypothetical start
          Length = 1360

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 30/191 (15%)

Query: 1125 IAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLS---GVDLAIARFN 1181
            +++Q++LIE  +  +I   +LL  K +Y  K           N  LS    V+  I   N
Sbjct: 1076 VSKQISLIESTIFLKITPPELL--KCKYSSK-----------NPDLSKSPNVNSIITLTN 1122

Query: 1182 LTVDWIVSEITLTR-DVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTD 1240
            L  ++++  I +    +K R   I+ ++ +A     F+N+N L  I+  L S V+ + + 
Sbjct: 1123 LLSNYVLESILMPGIPLKKRALRIKSWLRIALSSLYFRNFNALASIMTTLQSYVISRLSM 1182

Query: 1241 AWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKG-------------CIPFIV 1287
             W ++   D+ L+E L  I   + NY   R  +  L  +                +PF  
Sbjct: 1183 LWGMLSNEDVELFEYLSKIIHPNNNYKVYRKKIEKLVTESSSSSGLLSSKSVLPVVPFFN 1242

Query: 1288 VYLSDLSLNSE 1298
            ++L DL+   E
Sbjct: 1243 LFLQDLTFIDE 1253

>Scas_476.2
          Length = 1330

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 91/210 (43%), Gaps = 36/210 (17%)

Query: 1105 LQISNNEHHIPFILMYDSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLL 1164
            LQI N       ++ +++   A+Q+TL+E  L  E+   +L+N     K K +       
Sbjct: 1035 LQIKN-------LVSFNALEAAKQLTLLESTLYMEVQPFELINENFLQKKKLLN------ 1081

Query: 1165 IQNETLS-GVDLAIARFNLTVDWIVSEI-TLTRDVKMRRNTIQRFIHVAQYCREFQNYNT 1222
                 LS  ++  +   N   ++++  I T    +  R + ++ ++ +A     F+NYN+
Sbjct: 1082 -----LSPNINATLNFTNQFTNYVLESILTPNLSIPKRCSRLKGWLRIALSTLYFRNYNS 1136

Query: 1223 LMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKG- 1281
            L  I++AL S  + +    W  +   D+ L++ L  I   + NY   R  L  L  K G 
Sbjct: 1137 LASIMIALQSHSLSRLYFLWEDLTEKDIKLYDFLCQIIHPNNNYRVYREKLRIL--KSGN 1194

Query: 1282 -------------CIPFIVVYLSDLSLNSE 1298
                          +PF  ++L DL+  +E
Sbjct: 1195 NQAPLSLSKSPLPIVPFFNLFLQDLTFINE 1224

>Scas_682.13
          Length = 250

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 56/143 (39%), Gaps = 13/143 (9%)

Query: 1220 YNTLMEIILALSSIVVQKFTDAWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLN---SL 1276
            + TL E + AL+S   Q    +  L+ P D     + K IP      + I+         
Sbjct: 52   FTTLTEALQALTSAATQLHGISSELVNPMD-----DDKDIPIALHTVTPIKQAAKKKAER 106

Query: 1277 DPKKGCIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHKFETSVQIVK-----NFIQRVQWA 1331
            DP     P  V +     +  E R+      +      E + +I K     N  ++ +W 
Sbjct: 107  DPNAPKKPLTVFFAYSAYVRQELRDERQRNGLPPLSSTEITQEISKKWKELNDTEKEKWK 166

Query: 1332 KFYNIEVDHELLSKCVYITSLTN 1354
            + YNIE++H  + K  Y+ +  N
Sbjct: 167  QAYNIELEHYQVEKQKYLEAKKN 189

>Sklu_2440.18 YDR416W, Contig c2440 29476-31950
          Length = 824

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 311 KDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPED 345
           KDVDY +S  + R IP  P +++E I+N +++ +D
Sbjct: 190 KDVDYWSSHLLLRYIPVCPNEELEDIINLIFMTKD 224

>KLLA0F11792g 1087802..1089667 similar to sgd|S0002456 Saccharomyces
            cerevisiae YDR049w, hypothetical start
          Length = 621

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 1073 QNSEEGLAIEDKCVSPLQVQTLVMNYEVQDSSLQISNNEHHIPFILMYDSKSIAEQMTLI 1132
            Q++E+ ++   K  +PL +  +  N    + +LQ S+  HH P +L Y S    + M L+
Sbjct: 417  QHTEKLISFIQKSKAPLLISYIKKNNLDVNITLQPSSEYHHTPTMLHYASSHGLKHMVLV 476

Query: 1133 EKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLT---VDWIVS 1189
               LLS +     +   +   GK  T+W    + ++T+      +AR+NL     DW  S
Sbjct: 477  ---LLSTLKADPTITNNV---GK--TAW---DLASDTMVKETFQLARYNLGESFTDWEQS 525

Query: 1190 EIT 1192
             ++
Sbjct: 526  HVS 528

>Scas_442.1
          Length = 309

 Score = 30.4 bits (67), Expect = 9.4,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 20/92 (21%)

Query: 91  ILEI---LENKNVDVEKQKVGEVALIRTFVLLRHSILNYFVQDFLPDSHLRYMLLNFLND 147
           ILEI   +++ N D  K+    V  + TF  LRH +L  +    L  + L Y    F   
Sbjct: 13  ILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCY----LASTGLAYPSWGFQQA 68

Query: 148 NVYQTSPRIVSGSIVNLKRAWIHSAKQTWENI 179
            +               K++W H  K TW N+
Sbjct: 69  EIV-------------CKKSWSHRDKATWWNV 87

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 46,093,865
Number of extensions: 2149160
Number of successful extensions: 6687
Number of sequences better than 10.0: 104
Number of HSP's gapped: 6903
Number of HSP's successfully gapped: 114
Length of query: 1364
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1250
Effective length of database: 12,649,657
Effective search space: 15812071250
Effective search space used: 15812071250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)