Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_505.275275239660.0
YAL023C (PMT2)75971029930.0
Kwal_26.710574074628980.0
CAGL0J08734g74274528180.0
KLLA0F15829g74169628070.0
ACR290W75570425880.0
Scas_643.2476976225470.0
YOR321W (PMT3)75370625260.0
CAGL0F00759g73470721310.0
Kwal_33.1547175571017820.0
KLLA0F21978g75769617140.0
YGR199W (PMT6)75977117010.0
CAGL0K00979g73070915760.0
Scas_408.1*3913659071e-115
KLLA0E01342g8386949261e-113
CAGL0L07216g8587149211e-112
YDL095W (PMT1)8177189101e-110
Kwal_23.36238767158861e-106
ADR279C8176888621e-103
KLLA0B03762g7727377831e-92
YDL093W (PMT5)7436727775e-92
Scas_442.13093116771e-82
ABL085W7577067061e-81
YJR143C (PMT4)7627096823e-78
CAGL0M00220g7657076823e-78
Scas_710.19197296878e-78
Scas_719.807627396631e-75
Kwal_47.167347927086502e-73
CAGL0L07172g7776655313e-57
Scas_30.11281174133e-47
Sklu_2215.66534813806e-38
Scas_329.12732123534e-37
AAL050W6573133122e-29
Kwal_33.143576574762722e-24
Scas_588.77267002614e-23
KLLA0C14828g6294802142e-17
YDR307W6623412089e-17
Scas_710.0d2711671564e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_505.2
         (752 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_505.2                                                           1532   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...  1157   0.0  
Kwal_26.7105                                                         1120   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...  1090   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...  1085   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...  1001   0.0  
Scas_643.24                                                           985   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...   977   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   825   0.0  
Kwal_33.15471                                                         691   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   664   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   659   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   611   0.0  
Scas_408.1*                                                           353   e-115
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   361   e-113
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   359   e-112
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   355   e-110
Kwal_23.3623                                                          345   e-106
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   336   e-103
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   306   1e-92
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   303   5e-92
Scas_442.1                                                            265   1e-82
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   276   1e-81
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   267   3e-78
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   267   3e-78
Scas_710.1                                                            269   8e-78
Scas_719.80                                                           259   1e-75
Kwal_47.16734                                                         254   2e-73
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   209   3e-57
Scas_30.1                                                             163   3e-47
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       150   6e-38
Scas_329.1                                                            140   4e-37
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   124   2e-29
Kwal_33.14357                                                         109   2e-24
Scas_588.7                                                            105   4e-23
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    87   2e-17
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    85   9e-17
Scas_710.0d                                                            65   4e-11

>Scas_505.2
          Length = 752

 Score = 1532 bits (3966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/752 (98%), Positives = 738/752 (98%)

Query: 1   MSSATGFKAREKDTEEVKARQDINIDTHXXXXXXXXXXXXXXVSTEKKESNTLLRVESII 60
           MSSATGFKAREKDTEEVKARQDINIDTH              VSTEKKESNTLLRVESII
Sbjct: 1   MSSATGFKAREKDTEEVKARQDINIDTHEEIIDEKEDLKKEIVSTEKKESNTLLRVESII 60

Query: 61  MPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY 120
           MPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY
Sbjct: 61  MPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY 120

Query: 121 LAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTIT 180
           LAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTIT
Sbjct: 121 LAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTIT 180

Query: 181 VLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCA 240
           VLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCA
Sbjct: 181 VLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCA 240

Query: 241 ISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFK 300
           ISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFK
Sbjct: 241 ISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFK 300

Query: 301 IHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYN 360
           IHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYN
Sbjct: 301 IHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYN 360

Query: 361 AYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKN 420
           AYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKN
Sbjct: 361 AYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKN 420

Query: 421 LHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNP 480
           LHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNP
Sbjct: 421 LHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNP 480

Query: 481 DMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKT 540
           DMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKT
Sbjct: 481 DMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKT 540

Query: 541 NFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLG 600
           NFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLG
Sbjct: 541 NFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLG 600

Query: 601 TPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPF 660
           TPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPF
Sbjct: 601 TPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPF 660

Query: 661 VIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFW 720
           VIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFW
Sbjct: 661 VIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFW 720

Query: 721 YFSPISFGMVGPMENYSYLNWFSTWNIAKESR 752
           YFSPISFGMVGPMENYSYLNWFSTWNIAKESR
Sbjct: 721 YFSPISFGMVGPMENYSYLNWFSTWNIAKESR 752

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/710 (75%), Positives = 615/710 (86%), Gaps = 1/710 (0%)

Query: 44  STEKKES-NTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEF 102
           S EK  + ++LLR+ES++MP++FT LA+F RMYKIGIN+HVVWDEAHFGKFGSYYLRHEF
Sbjct: 49  SKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEF 108

Query: 103 YHDVHPPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYF 162
           YHDVHPPLGKMLVGLSGYLAGYNGS+DF SG  YPDY+DYVKMR+FNA+FSA+CVP+AYF
Sbjct: 109 YHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYF 168

Query: 163 TAKAIGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPF 222
           TAKAIGFS+PTVWL T+ VLFENSY+TLG+FILLDSMLLFFTV S+  FV+FHNQRSKPF
Sbjct: 169 TAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPF 228

Query: 223 SRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLA 282
           SRKWWKW+L+TG+S+GC ISVKMVGLFIIT+VGIYT+IDLW FL DK+MSWK YI HWLA
Sbjct: 229 SRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLA 288

Query: 283 RIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSI 342
           RI  LIIVPF +FL CFKIHFDLL+HSGTGDANM SLFQA L+GSDVG GPRD+A+GSS+
Sbjct: 289 RIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSV 348

Query: 343 ISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIE 402
           +SIKNQALGG+LLHSH   YP+GSNQQQVT Y YKDANNEWFF+R RG P + ENETDIE
Sbjct: 349 VSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIE 408

Query: 403 YVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGD 462
           Y+   + YRLVH  TG+NLHTHPV AP+S TQWEVSGYGD   GD++DNW+IEI+DQRGD
Sbjct: 409 YLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGD 468

Query: 463 EDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIET 522
           ED  KLH LTTSFRI N +M CYL+QTGN LPEWGF+Q EV C++NPF+RDKRTWWNIET
Sbjct: 469 EDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIET 528

Query: 523 NENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYW 582
           +EN+ LPPRP DF++PKTNF KDFI LNLAMMATNNALVPDP+KFD LASSAWQWPTL  
Sbjct: 529 HENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNV 588

Query: 583 GLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTF 642
           GLR+C WG+D  KYFLLGTPASTW SS+AV+  M  +V+LLIRWQRQY DL++P + N F
Sbjct: 589 GLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVF 648

Query: 643 MMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQI 702
           +MG FYPLLAWGLHY PFVIMSRVTYVHHYLPALYFALIILAY FDAGL+  +++K  +I
Sbjct: 649 LMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCGRI 708

Query: 703 LRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIAKESR 752
           +R V+Y      VIGCFWYFSPISFGM GP  N+ YLNWFSTW+IA +  
Sbjct: 709 MRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIADKQE 758

>Kwal_26.7105
          Length = 740

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/746 (70%), Positives = 613/746 (82%), Gaps = 7/746 (0%)

Query: 3   SATGFKAREKDTEEVKARQDINIDTHXXXXXXXXXXXXXXVSTEKKESNTLLRVESIIMP 62
           SATGF +R  D   +K R+   +D                +  +  E N LLR+ESI MP
Sbjct: 2   SATGFDSRISDGT-LKQRKVTTVDE------IPDIEVDDRIEEKSVEVNPLLRLESIAMP 54

Query: 63  LVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 122
           ++FT +  F RMYKIG+N+HVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++A
Sbjct: 55  MIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMA 114

Query: 123 GYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVL 182
           GYNGS+DF SG EYPDY+DYVKMRIFNA FSA+C+P+AYFTAKAIGFS+PTVWLFTI V+
Sbjct: 115 GYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVI 174

Query: 183 FENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAIS 242
           FENSY TLG+FILLDSMLLFFTV S  CFV FHNQRSKPFSRKWWKW+LLTG+S+GC IS
Sbjct: 175 FENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTIS 234

Query: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIH 302
           VKMVGLFIIT+VGIYT+I+LW  LGDK +S KAY GHWLARI+CLIIVPFL+FLACFK+H
Sbjct: 235 VKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVH 294

Query: 303 FDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAY 362
           FDLL+HSGTGDANM SLFQA L GSDVG GPRD+AVGSSI+SIKNQALGG+LLHSH   Y
Sbjct: 295 FDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGY 354

Query: 363 PEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKNLH 422
           PEGSNQQQVT Y +KD+NN W FDR R    + E ET+IE+V   S YRLVH  TGKNLH
Sbjct: 355 PEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLH 414

Query: 423 THPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNPDM 482
           THP+ API+ ++WEVSGYG AE GD +D+W++E+V Q G ED+++LHPLT+SFRI N ++
Sbjct: 415 THPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAEL 474

Query: 483 DCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNF 542
            CYL+QTG HLPEWGF+Q EVAC++NPF+RDKRTWWN+ET+ N+ LP RPADFK+PK NF
Sbjct: 475 GCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINF 534

Query: 543 FKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTP 602
            K+FI LNLAMMATNNALVPDP+K D LASSAWQWPTL  G+R+C WG+D VKYFL+G+P
Sbjct: 535 IKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSP 594

Query: 603 ASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVI 662
           ASTW S++AVVG M  +V+LL+RWQRQY DL D  D N FMMG FYPLL WGLHY PFVI
Sbjct: 595 ASTWLSTIAVVGFMGLVVLLLLRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVI 654

Query: 663 MSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYF 722
           MSRVTYVHHYLPALYFAL+IL+Y+F+AGLK L KTK  Q+ R +IY+     VI  F+YF
Sbjct: 655 MSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYF 714

Query: 723 SPISFGMVGPMENYSYLNWFSTWNIA 748
           SPISFG+ GP  NY++LNWF +W I 
Sbjct: 715 SPISFGLSGPSSNYAHLNWFKSWTIT 740

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/745 (67%), Positives = 603/745 (80%), Gaps = 6/745 (0%)

Query: 3   SATGFKAREKDTEEVKARQDINIDTHXXXXXXXXXXXXXXVSTEKKESNTLLRVESIIMP 62
           S+TGF+  EK   E+KAR+  ++D                +   K   + LL++E+ +MP
Sbjct: 2   SSTGFQGSEKSDAELKARKQTSVDD----VLIEEKEDTSKLKDAKVSQSPLLQLEAYLMP 57

Query: 63  LVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 122
           LVFTGLA+F+RMY+IGIN +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA
Sbjct: 58  LVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 117

Query: 123 GYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVL 182
           GYNGSFDF SG EYP+YVD+VKMR+FNA+FSAMCVP+AYFTAKAIGFS+P VWLFT  VL
Sbjct: 118 GYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVL 177

Query: 183 FENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAIS 242
           FENSY+TLG+FILLDSMLLFFTV S   FV+FHNQRS+PFSRKWWKW+LLTG+++GC IS
Sbjct: 178 FENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTIS 237

Query: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIH 302
           VKMVGLF+IT+VGIYT+IDL   L +K MSWK+Y GHWLARI+ LI VP  VF+ CFK+H
Sbjct: 238 VKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLH 297

Query: 303 FDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAY 362
           FDLL HSGTGDANM SLFQA L+GSDVG GPRDVA+GSS +SIKNQAL GALLHSH   Y
Sbjct: 298 FDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTY 356

Query: 363 PEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKNLH 422
           PEGSNQQQVTAYSYKDANN W F R R E  +  NETDIEYV+  + YRLVH  T KNLH
Sbjct: 357 PEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLH 416

Query: 423 THPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNPDM 482
           TH + AP+    WEVSGYG+   GD++D W++EIVDQ+G E+ T++HPLTTSFR+ N ++
Sbjct: 417 THSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKEL 476

Query: 483 DCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNF 542
           DCYL+QTGNHLPEWGF+Q E++CV++PFRRDKRTWWN+E++EN+ L P P +FK+P + F
Sbjct: 477 DCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKL-PTPEEFKYPGSGF 535

Query: 543 FKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTP 602
            KDFI LNLAMMATNNALVP+ +KFD LASSAW+WPTL+ GLR+C WG++  KYFLLGTP
Sbjct: 536 LKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTP 595

Query: 603 ASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVI 662
            +TW SS+AV+  M+  VVLL+RWQRQY+D  +  D N F+MG FYP+L WGLH+ PFVI
Sbjct: 596 VTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVI 655

Query: 663 MSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYF 722
           MSRVTYVHHYLPALYFALIIL Y+ DA  K   K+K   I+R+V++  +  +V+GCFWYF
Sbjct: 656 MSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYF 715

Query: 723 SPISFGMVGPMENYSYLNWFSTWNI 747
           SPISFGM GP  NY YL W  TW+I
Sbjct: 716 SPISFGMTGPAINYHYLKWVKTWHI 740

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/696 (71%), Positives = 585/696 (84%)

Query: 53  LLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGK 112
           LL++ESI+MP++FTGLA FIRMYKIG NDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGK
Sbjct: 45  LLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGK 104

Query: 113 MLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIP 172
           MLVG SGYLAGYNGS+DF SG +YP+Y+D+VKMR+FNA FSA+CVPVAYFTAK+IGFS+P
Sbjct: 105 MLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLP 164

Query: 173 TVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLL 232
           TVWLFT  VLFENSYTTLG+FILLDSMLLFFTVLS  CFV FHN RSKPF++KWWKW+  
Sbjct: 165 TVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFY 224

Query: 233 TGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPF 292
           TG S+GC ISVKMVGL IIT+VGIYT++DLWN L D  MS K Y  HW +R + LI+VPF
Sbjct: 225 TGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPF 284

Query: 293 LVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGG 352
            VFLACFKIHFDLL+HSGTGDANM SLFQANLIGSDVG GPRDVA+GSS I+IKNQALGG
Sbjct: 285 AVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGG 344

Query: 353 ALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRL 412
            LLHSH   YPEGS QQQVT Y +KD+NN W FDR R    Y +NET+ E+V   ++YRL
Sbjct: 345 GLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRL 404

Query: 413 VHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLT 472
           VH  TG+NLHTHP RAP+ +  WEVSGYGDA+ GD +D+W+IEIVDQ+G ED+TKLHPLT
Sbjct: 405 VHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGPEDETKLHPLT 464

Query: 473 TSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRP 532
           +SFR+ N +M CYLSQTGN LP+WGF+Q EVACV+NPF+RDKRTWWNIETN N+ LPPRP
Sbjct: 465 SSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRP 524

Query: 533 ADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGED 592
            +FK+PKT+F KDFI LNLAMMATNNALVP+ EK D LASSAWQWPTL  G+R+C WGE 
Sbjct: 525 ENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQ 584

Query: 593 VVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLA 652
            +KYFL+G+PASTW S++AV+  MV + V LIRWQRQYSDL +P+D+N F+MG  YPLLA
Sbjct: 585 NIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLA 644

Query: 653 WGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAY 712
           WGLH+ PF+IMSRVTYVHHYLPALYFAL++LAY+F+  +K   K+K  +++R  IY +  
Sbjct: 645 WGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYLFEISMKKWNKSKCGKVMRYTIYGSYM 704

Query: 713 VTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
             VI  F+YF+PISFGM GP  +Y YLNW STW I+
Sbjct: 705 AIVIYGFYYFAPISFGMSGPSTDYEYLNWLSTWTIS 740

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/704 (66%), Positives = 561/704 (79%), Gaps = 2/704 (0%)

Query: 47  KKESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDV 106
           ++E N L ++E+ +MP++FT LA++ RM+KIG N+ VVWDEAHFGKFGSYYLRHEFYHDV
Sbjct: 52  QQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDV 111

Query: 107 HPPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKA 166
           HPPLGKMLVGLSGY+AGYNGS+DF SG EYP+Y+DYVKMR+FNA FSAMC PVAYFT KA
Sbjct: 112 HPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKA 171

Query: 167 IGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKW 226
           IGFS+PTVWLF+I V+FENSY TLG+FILLDSMLLFFTV S+  FV+FHN+R +PF RKW
Sbjct: 172 IGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKW 231

Query: 227 WKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIIC 286
           WKW+   G+S+GC ISVKMVGLFII+VVGIYT++DLWN L +  MS   + GH+ AR +C
Sbjct: 232 WKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALC 291

Query: 287 LIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIK 346
           LI+VPF+VFL CFK+HF+ L+ SGTGDA M SLFQA L GS VG GPRD+AVGSS++SIK
Sbjct: 292 LIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIK 351

Query: 347 NQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLG 406
           NQALGG LLHSH   YP GS+QQQVT Y + D+NN W FDR RG P +  NET+ E+V  
Sbjct: 352 NQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQD 411

Query: 407 DSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKT 466
              YRLVH  TG+NLHTHP+ AP+S T WEVSGYGDA+ GD +DNW+IE V Q  DEDK+
Sbjct: 412 GRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKS 471

Query: 467 KLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNEND 526
            LH ++TSFRI N +M CYL+QTG  LPEWGF+Q EVAC+ NPF+RDKRTWWNIETN N+
Sbjct: 472 VLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNE 531

Query: 527 VLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRI 586
            LPP P DFK+PKT+FFKDF+ LNLAMMATNNALVPDP+K D LASSAWQWPTL  G+R+
Sbjct: 532 RLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRL 591

Query: 587 CSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGA 646
           CSW +DV KYFL+G+PASTW S+ AV    +  V  L++WQRQ    Q   D N F+MG 
Sbjct: 592 CSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGG 651

Query: 647 FYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKST--QILR 704
            YPLL WGLHY PF +M RVTYVHHYLPALYFAL+ILAYVF+A L+   +++ +  +IL 
Sbjct: 652 IYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILV 711

Query: 705 IVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
            V+Y   Y T+I  F+YF PI+ GM GP  NY +LNW  TW+IA
Sbjct: 712 YVVYAVYYCTIICGFYYFYPITVGMEGPSSNYKHLNWLKTWSIA 755

>Scas_643.24
          Length = 769

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/762 (62%), Positives = 578/762 (75%), Gaps = 17/762 (2%)

Query: 2   SSATGFKAREKDTEEVKARQDINIDTHXXXXXXXXXXXXXXVSTEKK----ESNTLLRVE 57
           ++ +GF+ + K+  ++K RQ  +                   + +K+    E + L +VE
Sbjct: 6   AAVSGFEPK-KEASDLKVRQHNSSAATSKAAKDSASIDEKDENVKKQQPPSEESPLCKVE 64

Query: 58  SIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL 117
           + +MP+VFTGL+ F RMYKIG+N+HVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL
Sbjct: 65  AWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL 124

Query: 118 SGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLF 177
           SGYLAGYNGS+DF SG EYPDY+DYVKMR+F A FS++CVP+AY TAKAIGFSIP VWLF
Sbjct: 125 SGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLF 184

Query: 178 TITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSM 237
           T  VLFENSY TLG+FILLDSML FFTV S+M F++FH QR  PFS KWW  + L G ++
Sbjct: 185 TCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNL 244

Query: 238 GCAISVKMVGLFIITVVGIYTIIDLWNFL-------GDKTMSWKAYIGHWLARIICLIIV 290
           GCAISVKMVGLFIIT+VGIYT+ DLW  L         K  +WK Y  HW+ARI+CLII+
Sbjct: 245 GCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIII 304

Query: 291 PFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQAL 350
           PFLVFL CF+IHF LL+HSGTGDANM SLFQA L GSDVG GPRDVA+GSS +SIKNQAL
Sbjct: 305 PFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQAL 364

Query: 351 GGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDR---PRGEPFYHENETDIEYVLGD 407
           GGALLHSH   +P+GSNQQQVT Y+Y D NN WFFDR   P  +P+ +E ETDIEYV   
Sbjct: 365 GGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVG 424

Query: 408 SQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDA-EQGDSRDNWLIEIVDQRGDEDKT 466
           ++YRLVH  T KNLH   + AP+S   WEV+G+G   E GD  DNW+IE+++Q GDEDK+
Sbjct: 425 NEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKS 484

Query: 467 KLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNEND 526
            +HPLTT+F I +  + CYL+QT   LPEWGF+Q E+ C     + DKRTWWN+E++EN+
Sbjct: 485 MIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHENE 544

Query: 527 VLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRI 586
            LP   A F +PKTNFFKDF+ LN  MMATNNALVPD +K+D LAS+AWQWPTL  GLR+
Sbjct: 545 KLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLRL 604

Query: 587 CSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGA 646
           C W +D VKYFLLG+PASTW S+++V+ LM++IVVL  RWQRQ ++  + K LNTFMMGA
Sbjct: 605 CGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMGA 664

Query: 647 FYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIV 706
           FYPLLAWGLH+ PFVIM+RVTYVHHYLPALYFAL++LAY F+A ++    T +  I  I 
Sbjct: 665 FYPLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFEAIIRRPKGTLAKYITYIT 724

Query: 707 IYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
           + L  +  VIG F+YFSPISFGM GP +NY YL+W S W I+
Sbjct: 725 LVL-YFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKIS 765

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/706 (65%), Positives = 556/706 (78%), Gaps = 2/706 (0%)

Query: 48  KESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVH 107
           K  + +  +++I+MP++FT L +F RMYKIG N+HVVWDEAHFGKFGSYYLRHEFYHDVH
Sbjct: 47  KNESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVH 106

Query: 108 PPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAI 167
           PPLGKMLVGLSGYLAGYNGS+DF SG  YPDY+DYVKMR+F A FS++CVP+AYFT +AI
Sbjct: 107 PPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAI 166

Query: 168 GFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWW 227
           GFS  +VWLFTI V+FENSY TLGKFILLDSMLLFFTV SY C   FH  R  PFS +WW
Sbjct: 167 GFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWW 226

Query: 228 KWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICL 287
            W+ LTGL++GCAISVKMVGLFII+VVGIYTI +LWN L D+++SWK Y+ HWLARI  L
Sbjct: 227 LWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGL 286

Query: 288 IIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKN 347
           II+P  VFL CFKIHFDLL++SG GD+ M SLFQA+L G+ VG GPRDVA+GSSIISIKN
Sbjct: 287 IIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKN 346

Query: 348 QALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRG-EPFYHENETDIEYVLG 406
           QALGGALLHSH   +PEGS QQQVT Y Y DANNEWFF R RG EP+       IE+V G
Sbjct: 347 QALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKG 406

Query: 407 DSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKT 466
              YRL+H  TGKNLHTH V APIS +++EVS YGD + GD +DNW+IEIV+Q G+ED T
Sbjct: 407 GEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPT 466

Query: 467 KLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNEND 526
            LHPL+TSFRI N  + CYL+Q+G HLPEWGF+Q EV C+++  +RDKRTWWNIET+EN+
Sbjct: 467 LLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENE 526

Query: 527 VLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRI 586
            L P+  DF +PKT+FF++F+QLN AMMATNNALVP+PEKFD +ASSAWQWPTL  G+R+
Sbjct: 527 RL-PQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRL 585

Query: 587 CSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGA 646
           C W E  +KYFLLG+PAS W SS+AV  L+++++ L ++WQRQ   L DP + + F+M A
Sbjct: 586 CEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAA 645

Query: 647 FYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIV 706
           FYPLLAW LHY PFV+MSRV Y HHYLP LYFAL+IL+Y FD   K      + + LR+ 
Sbjct: 646 FYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLG 705

Query: 707 IYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIAKESR 752
            Y+     VI  F+YFSP SFGM GP+++Y+YL W  TW I ++ R
Sbjct: 706 AYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVEDIR 751

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/707 (56%), Positives = 510/707 (72%), Gaps = 4/707 (0%)

Query: 44  STEKKESNTL--LRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHE 101
           + E+K SN    LR+E + MP+VFT LA+ +R+Y++ +   V WDEAHFGKFGSYYLRH 
Sbjct: 30  NKEQKASNKQFWLRLERVAMPIVFTLLALLVRLYRLDVVKKVTWDEAHFGKFGSYYLRHT 89

Query: 102 FYHDVHPPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAY 161
           FYHDVHPPLGKMLVG SGYLAGYNGS+DF SG  YPDYV +VKMRIF  A SA+CVP+ Y
Sbjct: 90  FYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVPMTY 149

Query: 162 FTAKAIGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKP 221
           F AKAIGFS+PTVWL TI VL ENSYTTLGK ILLDS+LLFFTV ++MCF  FH+   KP
Sbjct: 150 FAAKAIGFSLPTVWLTTILVLCENSYTTLGKLILLDSLLLFFTVATFMCFQKFHSYHRKP 209

Query: 222 FSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWL 281
           FS +W  W+ LTG SMGCAISVKMVGLF+IT+VGI+TI++LW  LGDK ++WK Y  HW+
Sbjct: 210 FSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYANHWI 269

Query: 282 ARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSS 341
           ARIICLI+ PFL+F  CFKIHF LL  SG GD  M   FQA L G+++G GPRDV++GS+
Sbjct: 270 ARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSIGST 329

Query: 342 IISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDI 401
            I+++N    GA LHSH+  YPEGS Q+QVT Y+Y D NN+W   RP G+P +H N+T+ 
Sbjct: 330 -ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVNDTEH 388

Query: 402 EYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRG 461
           E +      RLVH  TG NLH+H V AP++   +EVSGYG+   GD +D+W++EI+   G
Sbjct: 389 EAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIKDDG 448

Query: 462 DEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIE 521
           +EDK  +HP+TT  R  +  ++CYL+Q+  HLPEWGF Q EV C++ P + D +T W ++
Sbjct: 449 NEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVD 508

Query: 522 TNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLY 581
           T+ +  L   P +F +P+ +F+ DF +LN  MMATNNAL    +K D L S +W+WPTLY
Sbjct: 509 THTHPNLEA-PENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTLY 567

Query: 582 WGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNT 641
             LRI SW E+  +Y LLG+PASTW S++AV+ L+  ++  +++W RQ    Q+  D   
Sbjct: 568 RSLRINSWNENDTRYLLLGSPASTWPSTVAVLFLVFALLYKVLKWNRQMQIFQNEHDEEL 627

Query: 642 FMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQ 701
           F+ G  YPLL W LH+ PFVIM RV YVHHYLPALYFAL +LAY+FDAGL++  KTK+ +
Sbjct: 628 FIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTKTQR 687

Query: 702 ILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
           I++  IY      VIG F  F+P S+GM G +ENY +LNW   W++ 
Sbjct: 688 IIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYKHLNWMKNWDVV 734

>Kwal_33.15471
          Length = 755

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/710 (49%), Positives = 458/710 (64%), Gaps = 25/710 (3%)

Query: 51  NTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPL 110
           N LL+V  +I+    T L+ ++R  KI  ND VVWDEAHFGKFGSYY+++EFYHDVHPPL
Sbjct: 58  NVLLQVTGVIL---LTILSFYVRFNKIDANDEVVWDEAHFGKFGSYYIKNEFYHDVHPPL 114

Query: 111 GKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFS 170
           GKML+ LS YLAG+NG F F SGA YP  ++Y  MR FNA F A+C P+   TAK +GFS
Sbjct: 115 GKMLIALSQYLAGFNGDFAFDSGAPYPSGMNYKFMRQFNATFGALCAPIMLLTAKNLGFS 174

Query: 171 IPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWM 230
               +   + V  E S+  L KFILLDSMLLFFT  ++ C    H  R++PF+R+W  WM
Sbjct: 175 NLGSYFLGMMVALELSFVALSKFILLDSMLLFFTATTFHCITELHKVRNRPFTRRWSLWM 234

Query: 231 LLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIV 290
           LL GLS+GC  SVK VGLFI  + GIYT++DL+++  DK +S  +Y  HWL RII LI++
Sbjct: 235 LLLGLSVGCVCSVKWVGLFITVIAGIYTVVDLFSYHYDKELSRLSYYKHWLVRIIDLIVI 294

Query: 291 PFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQAL 350
           PFLV+L CFKIHF +L  SGTGDA  ++LFQ NL G+ +  GPR+VA GS  ++I++  L
Sbjct: 295 PFLVYLFCFKIHFAILHKSGTGDAATNTLFQVNLDGNKIEIGPRNVAFGSE-VTIRSHGL 353

Query: 351 GGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGD--- 407
              LLHSH   YP GS Q QVT Y + D NN W    PR E      E  ++ V  D   
Sbjct: 354 SPNLLHSHVQLYPFGSGQHQVTGYGHSDDNNNWVIKYPR-EGGLKAAENGLQDVQSDLLT 412

Query: 408 --SQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGD--- 462
             S+ RLVH  TG NLH+H + A +S   +EVSGYGD E GD +D+W++EIV Q      
Sbjct: 413 EGSEIRLVHKNTGANLHSHEIPAHVSKGSFEVSGYGDEEIGDIKDDWVVEIVQQLDSDNS 472

Query: 463 ----EDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWW 518
               ED + LHP++TSFR+ +  + CYL+ TG   P WGFKQ E+ C     +RDK TWW
Sbjct: 473 SFPKEDPSLLHPISTSFRLRHKYLGCYLATTGLAYPAWGFKQAEIVCKHTWMKRDKSTWW 532

Query: 519 NIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWP 578
           NIE + N  L  +   +  PK+ F+ DFI +N AM ++NNALVPD +K+D LAS AWQWP
Sbjct: 533 NIEDHWNPNL-EKSEGYVPPKSKFWPDFILINFAMASSNNALVPDEDKYDSLASEAWQWP 591

Query: 579 TLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKD 638
           TL+ GLR+CSW  D VKYFLLG+P  TW S+L++   ++ ++ L  +WQRQ  +L    +
Sbjct: 592 TLHVGLRMCSWSNDTVKYFLLGSPFQTWLSTLSLFIFVLILLRLAFKWQRQTVNLTG-NE 650

Query: 639 LNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTK 698
           L+   M    P LAW LHY PFV+M RVTYVHHY+PALYFA+++  +V +  L       
Sbjct: 651 LSEISMQGVLPFLAWLLHYLPFVLMGRVTYVHHYVPALYFAILVFGFVLETCL------P 704

Query: 699 STQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
               L  ++Y A Y   I  +  FSPI+ G+ GP  N+ YL W +TW I+
Sbjct: 705 KRYFLNYIVYTALYAGCIYIYVLFSPIAQGIDGPAHNFKYLQWLNTWKIS 754

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/696 (47%), Positives = 453/696 (65%), Gaps = 17/696 (2%)

Query: 63  LVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 122
           L+ T ++  +R YKI  ++ VVWDEAHFGKFGSYYL+HEFYHDVHPPLGKML+GL  YLA
Sbjct: 66  LLLTLVSFVLRFYKIDRSNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGLGEYLA 125

Query: 123 GYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVL 182
           G++G+FDFSS + YPD V++  MR FNA FS++C P+A++ A+ + FS+PTV+L  + V 
Sbjct: 126 GFDGNFDFSSNSSYPDEVNFKIMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLVALMVC 185

Query: 183 FENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAIS 242
           FE+SY  LGKF+LLDSMLLFFTVL++ C    +  R    + KW  W+L TG S+GC  S
Sbjct: 186 FEHSYIVLGKFVLLDSMLLFFTVLTFYCLSQLYRLRECQLTVKWLAWILATGFSIGCVCS 245

Query: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIH 302
           VK VGL I  +VGIYT+ +L+    D+++S   Y+GHW+ RI  LI+ P ++++  FKIH
Sbjct: 246 VKWVGLLITALVGIYTVSELYCLHCDRSLSKTKYLGHWIVRISALIVFPLILYMVFFKIH 305

Query: 303 FDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAY 362
           F LL  +GTGD++  SLFQANL G+ +   PRD+A GS  IS+++  L   LLHSH   Y
Sbjct: 306 FTLLYKTGTGDSSTHSLFQANLEGAQIKPSPRDIAFGSC-ISLRSHGLSPGLLHSHPQTY 364

Query: 363 PEGSNQQQVTAYSYKDANNEWF--FDRPRGEPFYHEN--ETDIEYVLGDSQYRLVHHKTG 418
           P+GSNQ+QVT YSY+D NN W   + R  G+    E     +I ++      RLVH KT 
Sbjct: 365 PDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEERVYSDNILFLKDGDLLRLVHEKTK 424

Query: 419 KNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQ--RGD---EDKTKLHPLTT 473
            NLHTH + + +S   +EVSGYG+   GD +D+W+IE+V+Q   G+   E+K  +HPLTT
Sbjct: 425 NNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWIIEVVEQLPTGNNTMENKALIHPLTT 484

Query: 474 SFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPA 533
           SFR+ N ++ CYL+ TG   P WG+ Q E+ C     +RDK TWWN+E + N  L     
Sbjct: 485 SFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYPWNQRDKSTWWNVEDHINSNLHIDQT 544

Query: 534 DFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDV 593
            F  P T F+ DF+ +N AM A+NNAL+PD +K+D +AS  W+WP LY GLR+C+W +  
Sbjct: 545 -FTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDRIASEPWEWPILYKGLRMCNWNDKT 603

Query: 594 VKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAW 653
           VKY+LLG+P +TW S+ A+  L++ + + L R+QRQ   L + K  N F        + W
Sbjct: 604 VKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQSLQLNEKKAWNLFACAGL-SFIGW 662

Query: 654 GLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYV 713
            LHYAPF IM RVTY+HHY+PAL+FA++  AYV D  L       S + L++V Y + Y 
Sbjct: 663 LLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDFAL-----ANSNRYLKVVAYSSLYA 717

Query: 714 TVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIAK 749
                +WYF+P   GM  P   Y  L    +W++  
Sbjct: 718 GCTFTYWYFAPFCQGMPEPNLTYVNLELLPSWDVTN 753

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/771 (45%), Positives = 480/771 (62%), Gaps = 40/771 (5%)

Query: 2   SSATGFKAREKDTEEVKAR------------QDINIDTHXXXXXXXXXXXXXXVSTEKKE 49
           +  TGF + + + E ++ R            QD  +D                  T+K E
Sbjct: 4   AKGTGFSSIDTEDENLRERYVNQPKANASDIQDEQLDCFEQLEEKH--------RTKKNE 55

Query: 50  SNTLLRV-ESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHP 108
             T L++   +I PL+ T  + ++R   I  N++VVWDEAHFGKFGSYY++HE+YHDVHP
Sbjct: 56  EYTALKILRDVIGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHP 115

Query: 109 PLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIG 168
           PLGKML+ LS ++AG++G FDFSS   YP+ V++  MR FNA F A+C PVA+FTAK +G
Sbjct: 116 PLGKMLIALSEWMAGFDGQFDFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMG 175

Query: 169 FSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWK 228
           F+  TV+L    V  E+SY  L KFILLDSMLLFF++ ++ C +  +  R +  ++KW  
Sbjct: 176 FNYFTVYLIATMVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSL 235

Query: 229 WMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLI 288
           WMLLTGLS+GC  SVK VGLFI  VVG+YT I+L+    DK +    Y  HWL RII LI
Sbjct: 236 WMLLTGLSIGCVCSVKWVGLFITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLI 295

Query: 289 IVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQ 348
           ++PFL++L CFKIHF LL  SGTGD+  ++LFQ NL G+ + AGPRDVA GS  ++I++ 
Sbjct: 296 VIPFLIYLYCFKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSE-LTIRSH 354

Query: 349 ALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPF-YHENET---DIEYV 404
            L   LLHSH   YPEGS Q+Q+T Y + D+NN W F+  R       +N T    I  +
Sbjct: 355 GLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNGTLNGKIIPI 414

Query: 405 LGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQR---- 460
               + RL H  TG NLH+H V + +S   +EVSGYG    GD +D+W++EIV Q     
Sbjct: 415 TDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPN 474

Query: 461 ---GDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTW 517
               +E+ T LHP++T FR+ +  + CYL+ TG   P WGFKQ E+ C  +  RRDK TW
Sbjct: 475 PVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTW 534

Query: 518 WNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQW 577
           WN+E + N  L     D+  PK+NF+ DFI  N AM ++NNALVPD +K+D L+S AW+W
Sbjct: 535 WNVEDHWNHNL-ETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEW 593

Query: 578 PTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPK 637
           PTL+ GLR+CSW   + +Y+L+G+P +TW S+++++     I+ +L RW+RQ   L D +
Sbjct: 594 PTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSDDQ 653

Query: 638 DLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKT 697
                + G F P ++W  HY PF +M RVTYVHHY+PALYFA+++  +V D      T T
Sbjct: 654 IWQITIQGIF-PFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLD-----FTLT 707

Query: 698 KSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
           +   +++  IYL+ +   I  +  F+PI  GM G    Y  L W STW+IA
Sbjct: 708 RVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/709 (47%), Positives = 451/709 (63%), Gaps = 27/709 (3%)

Query: 55  RVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 114
           +   +I  L FT L+  +R   I  N+ VVWDEAHFGKFGSYY+RHEFYHDVHPPLGKML
Sbjct: 33  KYRDLIACLGFTVLSFVLRFQGIDKNNSVVWDEAHFGKFGSYYIRHEFYHDVHPPLGKML 92

Query: 115 VGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTV 174
           + LS +LAG++G FDF SG +YPD V++  MR FNA F A+C PV +FTAK +  S P V
Sbjct: 93  IALSEWLAGFDGEFDFESGHQYPDGVNFKFMRQFNATFGALCTPVVFFTAKTMNLSWPIV 152

Query: 175 WLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTG 234
           +L T+ V  E+S+  L KFILLDSMLLFFT  ++ C V     R    +R+W  W+LLTG
Sbjct: 153 YLVTLMVTLEHSFIALSKFILLDSMLLFFTATTFACMVKLIQLRGCQLTRQWLWWLLLTG 212

Query: 235 LSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLV 294
           LS+GC  SVK VGLFI  VVG++TIIDL     +K  S K Y  HW+ RII LII+PFLV
Sbjct: 213 LSIGCVCSVKWVGLFITLVVGLFTIIDLLEHYWNKKESRKIYYKHWILRIINLIIIPFLV 272

Query: 295 FLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGAL 354
           +L CFKIHF LL  SGTGDA+ +SLFQ NL G+ +   PR V  GS  ++I++  L   L
Sbjct: 273 YLFCFKIHFLLLYKSGTGDASTNSLFQVNLEGTQIQNSPRTVMYGSE-VTIRSHGLSPNL 331

Query: 355 LHSHYNAYPEGSNQQQVTAYSYKDANNEWF--FDRPRGEPFYHENET---DIEYVLGDSQ 409
           LHSH   YP+GS Q+QVT Y + D NN W   F R  G     +N+    ++  V     
Sbjct: 332 LHSHVQLYPDGSRQRQVTGYGHSDGNNNWMIKFGRTTGRYLDEDNKRLNGELVPVRDGDT 391

Query: 410 YRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQR-------GD 462
            RL H + G NLH+H + + +S   +EVSGYG  E GD +D+W+IEI++Q        G 
Sbjct: 392 IRLFHVRMGCNLHSHTISSHVSKGNYEVSGYGSEEVGDEKDDWIIEIMEQLDSANTNFGK 451

Query: 463 EDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIET 522
           ED   LHP++T FR+ + D+ CYL+ TG   P WGF Q E+ C  +  +RDK TWWN+E 
Sbjct: 452 EDNEVLHPISTMFRLRHKDLGCYLASTGLSYPTWGFHQAEIVCKYSWGKRDKSTWWNVED 511

Query: 523 NENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYW 582
           + ND L     ++  PK+ F+ DFI +N AM ++NNALVPD +K+D LAS AW+WP L+ 
Sbjct: 512 HWNDQLVV-DEEYVPPKSKFWTDFILINFAMASSNNALVPDEDKYDYLASKAWEWPILHK 570

Query: 583 GLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTF 642
           GLR+C W    V+Y+LLG+P +TW SS+A++  ++  +V+ I+W+RQ S + + +     
Sbjct: 571 GLRLCGWSSAGVRYYLLGSPFNTWLSSIALLVNILLGMVVAIKWRRQ-SIVINEESCWKL 629

Query: 643 MMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQI 702
                +P LAW  ++ P+V+M RVTYVHHY+PALYFA+I    + +  L      K+   
Sbjct: 630 FTLLLFPFLAWLANFMPYVMMGRVTYVHHYMPALYFAIIAFGSITEYLLADYCTVKA--- 686

Query: 703 LRIVIYLAAYVTVIGC---FWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
                   A+++++GC   +WYF+PI  G+ G   +Y YL W   W+IA
Sbjct: 687 ------FLAFLSMVGCTYIYWYFAPICQGLHGIGSHYFYLQWLPGWDIA 729

>Scas_408.1*
          Length = 391

 Score =  353 bits (907), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 179/365 (49%), Positives = 246/365 (67%), Gaps = 5/365 (1%)

Query: 17  VKARQDINIDTHXXXXXXXXXXXXXXVSTEKKESNTLLRVESIIMPLVFTGLAIFIRMYK 76
            +   +++I  H              V+T K  S+    + S I PL+ T L+  +R + 
Sbjct: 26  TQTSTELDIKQHEPDDSKQNKSRYPYVTTAKISSS----MRSYIGPLLLTILSFQLRFHD 81

Query: 77  IGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFSSGAEY 136
           IG N+HVVWDEAHFGKFGSYY+ HEFYHDVHPPLGKML+ LS YLAG++G F+F S   Y
Sbjct: 82  IGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLIALSEYLAGFDGHFNFDSNEAY 141

Query: 137 PDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVLFENSYTTLGKFILL 196
           P+ V+Y+ MR FNA F A+CVPV  FT +++GF+  T +L T+ V  E+SY  L KFILL
Sbjct: 142 PEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSYLVTLMVTLEHSYIVLSKFILL 201

Query: 197 DSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGI 256
           DS+LLFFT+ ++ C V  +  + +  +++W  WMLLTGLS+GC  SVK VGLFI  +VG+
Sbjct: 202 DSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGLSVGCVCSVKWVGLFITIIVGL 261

Query: 257 YTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANM 316
           +TI++L+    DKT+    Y  HW+ RII LII+PFL+++ CFKIHF LL  SGTGD+  
Sbjct: 262 FTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFLIYMFCFKIHFTLLYKSGTGDSAT 321

Query: 317 SSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSY 376
           ++LFQ NL G+ +  GPRDV  GS  ++I++  L   LLHSH   YP+GS Q+Q+T Y +
Sbjct: 322 NTLFQVNLEGTTIENGPRDVMYGSE-VTIRSHGLSPNLLHSHVQLYPDGSRQRQITGYGH 380

Query: 377 KDANN 381
            D+++
Sbjct: 381 SDSSS 385

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  361 bits (926), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 241/694 (34%), Positives = 361/694 (52%), Gaps = 33/694 (4%)

Query: 48  KESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVH 107
           K   T+   +  ++ +    +A  +R++ +   + VV+DE HFGKF + Y++  F+ DVH
Sbjct: 43  KSIRTMTSSKERLVVIALAVIASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGIFFTDVH 102

Query: 108 PPLGKMLVGLSGYLAGYNGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKA 166
           PPL KML    G LAG+ G F+F   G  +P    Y  MR F+A      V + YFT +A
Sbjct: 103 PPLAKMLFAGIGSLAGFTGDFEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLMYFTLRA 162

Query: 167 IGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKW 226
            G  I   ++ ++    ENS+ T+ ++ILLD+ L+FF   +   +  +    S+ F+   
Sbjct: 163 SGIRIWIAFVASLMFALENSFVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSESFNS-- 220

Query: 227 WKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIIC 286
           +K +L TGLS+G A+S K VGLF I  VG  ++  LW  +GD     ++ + H + +   
Sbjct: 221 YKALLATGLSLGLAVSSKWVGLFTIAWVGALSLFKLWFDIGDLKKPVQSTLRHTVVKATL 280

Query: 287 LIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAG-PRDVAVGSSIISI 345
           L+  P  ++L  F IHF  L ++  G    SS F++ LIG+++ +  P DV VGSS+ SI
Sbjct: 281 LLAAPAALYLFFFYIHFQTLIYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVGSSV-SI 339

Query: 346 KNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEW---FFDRPRGEPFYHENETDIE 402
           ++    G  LHSH + Y  GS QQQVT YS+ DANN+W    +D+P   P   E   D  
Sbjct: 340 RHTGTMGGYLHSHKHIYETGSKQQQVTLYSHLDANNDWVIELYDQPEVIPETFEGLKD-- 397

Query: 403 YVLGDSQYRLVHHKTGKNLHTHPVRAPISST---QWEVSGYG-DAEQGDSRDNWLIEIVD 458
                ++ RL H  T + LH+H  + P+S +   Q EVS YG D   GD+ D+W+IEI  
Sbjct: 398 ----GTKIRLRHRLTDRRLHSHDHKPPVSESSDWQKEVSAYGADNFTGDANDDWVIEIDH 453

Query: 459 QRG--DEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRT 516
           +     E +  +  L T FR+ +    C L      LP+WGF+Q EV C  +       T
Sbjct: 454 EASAPGEAQEYVKALDTKFRLRHAMTGCRLFSHEVKLPKWGFEQQEVTCASSGV--PSLT 511

Query: 517 WWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQ 576
            W +E N N +LP   A   +    F + FI+ +  M   N  L    ++  +  S    
Sbjct: 512 LWYVEHNSNPLLPEDAAKISYQTPTFLEKFIESHQRMWHINKNL----KEHHVYQSDPAT 567

Query: 577 WPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVL-LIRWQRQYSDLQD 635
           WP L  G  I  W +D  + +LLG  A  W S  A +G+ V ++V  L+ WQ   S LQD
Sbjct: 568 WPLLLRG--ISYWSQDHKQIYLLGN-AVVWWSVTAFIGVFVLVIVAELLAWQLGKSILQD 624

Query: 636 PKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLT 695
              LN F +  F  LL WGLHYAP  +M R  ++HHYLPA YF ++  A+  +  + ++ 
Sbjct: 625 KHVLN-FHIQTFQYLLGWGLHYAPSFLMGRQLFLHHYLPAYYFGILAFAHALEIIVSYVF 683

Query: 696 KTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGM 729
           K K T    +VI   A  T    F+ + P+ +G+
Sbjct: 684 KNKKTVGYGVVITFLAAATAF--FYVYKPLIYGL 715

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  359 bits (921), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 240/714 (33%), Positives = 363/714 (50%), Gaps = 46/714 (6%)

Query: 51  NTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPL 110
            T+  ++  +M  +   +  F+R+YK+     VV+DE HFG F S Y++ +F+ DVHPPL
Sbjct: 53  RTVKTLKEKLMVAILLIITAFVRLYKLSWPSSVVFDEVHFGGFASKYIKGDFFMDVHPPL 112

Query: 111 GKMLVGLSGYLAGYNGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGF 169
            KML    G LAGY G F F   G EYPD V +  MR+F+A+     V + Y T +A G 
Sbjct: 113 AKMLFAGVGALAGYTGDFSFKPIGEEYPDTVPFYTMRLFSASLGVFTVLMLYLTLRASGV 172

Query: 170 SIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPF---SRKW 226
            +   +LF +   FENS+ T+ ++ILLD+ L+ F     +   ++  ++S+ +   S + 
Sbjct: 173 RLGVAYLFALVFAFENSFVTISRYILLDAPLICF-----IAAAVYSYKKSELYPTNSFRA 227

Query: 227 WKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIIC 286
            K +L TG+++G A S K VGLF +  VG+  +  LW  +GD   S    +   + +++ 
Sbjct: 228 LKSLLATGIALGLASSSKWVGLFTVAWVGLLCVWKLWFMIGDLNKSPCTIVKAAIGKLVL 287

Query: 287 LIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAG-PRDVAVGSSIISI 345
           L+ VP L+++A F +HF  L H G+G +   S F+A L G+ + +    DV VG SI+++
Sbjct: 288 LLGVPILLYVAFFYVHFQALIHDGSGSSFFPSEFRATLEGNQIPSDVVYDVGVG-SIVTL 346

Query: 346 KNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVL 405
           K+ +  G  LHSH +AYP GS QQQ+T Y + D NN+W  +R       H     ++  +
Sbjct: 347 KHLSTEGGYLHSHSHAYPTGSEQQQITLYPFLDDNNKWVIERS------HLPGASLKDFI 400

Query: 406 G---DSQYRLVHHKTGKNLHTHPVRAPISST---QWEVSGYG-DAEQGDSRDNWLIEIVD 458
           G        L+H  TG  LH+H  + P+S +   Q EVSGYG     GD  D+W IEI D
Sbjct: 401 GLKNGESISLLHLATGVRLHSHDHKPPVSESADWQKEVSGYGYLGFTGDINDHWTIEI-D 459

Query: 459 QRGDEDKTKLH---PLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKR 515
           Q   +     H    + T F++ +    CYL      LP+WGF Q EV C      + + 
Sbjct: 460 QSSSKPGIAQHEVRAIDTKFKLRHA-TGCYLFSHEVKLPKWGFDQQEVTCATQ--GKPEL 516

Query: 516 TWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAW 575
             W IE +EN  LP       +   NF + FI+ +  M   N  L           S A+
Sbjct: 517 LLWYIEGSENPQLPENTPRISYKPMNFIEKFIENHKKMWKINKGLTGT----HYYESLAY 572

Query: 576 QWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIR---WQRQYSD 632
           +WP +  G  I  WGE   K +LLG   + W  S  +   +VY  +L      +      
Sbjct: 573 EWPLMRRG--IGYWGEHHRKIYLLGNAVTWWAVSAFI---LVYAAILAFEAGSFLVGKPI 627

Query: 633 LQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLK 692
           LQD K++  F +   + LL + +HY PF +M R  ++HHYLPA YF ++ LA+ FD  + 
Sbjct: 628 LQD-KNVINFHVQVLHYLLGFAIHYVPFFLMGRQLFLHHYLPAYYFGILALAHAFDIIIT 686

Query: 693 FLTKTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWN 746
           F+ K +      ++I   A    I  F   SPI++G     +      W STW+
Sbjct: 687 FVCKNRKQAAYALLILFTA--ASIYFFHAHSPIAYGTDWTKDVCRNSRWVSTWD 738

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  355 bits (910), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 247/718 (34%), Positives = 365/718 (50%), Gaps = 34/718 (4%)

Query: 43  VSTEKKESNTLLRVESIIMPLVFTGLAIF---IRMYKIGINDHVVWDEAHFGKFGSYYLR 99
           V+    E  +L  + ++   L+   LA+F   IR++ +   D VV+DE HFG F S Y+R
Sbjct: 31  VTDPSAELASLRTMVTLKEKLLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIR 90

Query: 100 HEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVP 158
             ++ DVHPPL KML      L G+ G FDF + G  +P    YV MR F+A+  A+ V 
Sbjct: 91  GTYFMDVHPPLAKMLYAGVASLGGFQGDFDFENIGDSFPSTTPYVLMRFFSASLGALTVI 150

Query: 159 VAYFTAKAIGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQR 218
           + Y T +  G  +    +  I    ENSY T+ ++ILLD+ L+FF   +   F  +    
Sbjct: 151 LMYMTLRYSGVRMWVALMSAICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKYEMYP 210

Query: 219 SKPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIG 278
           +   S   +K +L TG+++G A S K VGLF +T VG+  I  LW  +GD T S K+   
Sbjct: 211 AN--SLNAYKSLLATGIALGMASSSKWVGLFTVTWVGLLCIWRLWFMIGDLTKSSKSIFK 268

Query: 279 HWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAG-PRDVA 337
              A++  L+ VPF ++L  F IHF  LT  G G +  S  F++ L  + +      DV 
Sbjct: 269 VAFAKLAFLLGVPFALYLVFFYIHFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVVADVG 328

Query: 338 VGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHEN 397
           +G SIIS+++ +  G  LHSH + YP GS QQQ T Y + DANN+W  +         E+
Sbjct: 329 IG-SIISLRHLSTMGGYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLELYNAP---GES 384

Query: 398 ETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISST---QWEVSGYG-DAEQGDSRDNWL 453
            T  + +   ++ RL H  T   LH+H  + P+S +   Q EVS YG     GD+ D+W+
Sbjct: 385 LTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWV 444

Query: 454 IEIVDQRGDED---KTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPF 510
           +EI D++       + ++  L T FR+ +    CYL      LP WGF+Q EV C  +  
Sbjct: 445 VEI-DKKNSAPGVAQERVIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCASS-- 501

Query: 511 RRDKRTWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDIL 570
            R   T W +E N N +LP       +   +F   FI+ +  M   N  LV +P  ++  
Sbjct: 502 GRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIESHKKMWHINKNLV-EPHVYE-- 558

Query: 571 ASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVL-LIRWQRQ 629
            S    WP L  G  I  WGE+    +LLG  A  W +  A +G+   IV+  L  WQ  
Sbjct: 559 -SQPTSWPFLLRG--ISYWGENNRNVYLLGN-AIVWWAVTAFIGIFGLIVITELFSWQLG 614

Query: 630 YSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDA 689
              L+D K +N F +   + LL + +HYAP  +M R  ++HHYLPA YF ++ L +  D 
Sbjct: 615 KPILKDSKVVN-FHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAYYFGILALGHALDI 673

Query: 690 GLKFLTKTKSTQILRIVI-YLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWN 746
            + ++ ++K      +VI +LAA V     F  FSPI +G     E      W S W+
Sbjct: 674 IVSYVFRSKRQMGYAVVITFLAASVYF---FKSFSPIIYGTPWTQELCQKSQWLSGWD 728

>Kwal_23.3623
          Length = 876

 Score =  345 bits (886), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 236/715 (33%), Positives = 363/715 (50%), Gaps = 41/715 (5%)

Query: 48  KESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVH 107
           KES T   V+  +       +   IR+Y +   + VV+DE HFG F + Y++  F+ DVH
Sbjct: 84  KESRTPTSVKEKVTIAALAVITGVIRLYGLSNPNSVVFDEVHFGGFAAKYIKGIFFMDVH 143

Query: 108 PPLGKMLVGLSGYLAGYNGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKA 166
           PPL KML    G +AG+ G FDF   G  +P+   Y  MR+F A    + V + Y T + 
Sbjct: 144 PPLAKMLFAAIGSIAGFTGDFDFEKIGQHFPESTPYYFMRLFPALLGTLTVLLMYLTLRC 203

Query: 167 IGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKW 226
            G  IP  ++ ++    ENS+ T+ ++ILLD+ LLFF   +   F     ++ + + +  
Sbjct: 204 SGVRIPIAFIASLCFAIENSFVTISRYILLDAPLLFFIASAVYSF-----KKYEIYPQGS 258

Query: 227 W---KWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLAR 283
           W   K +L  GL++G A+S K VGLF I  VG+  I  LW  +GD +    + +     +
Sbjct: 259 WGSLKALLSGGLALGMALSSKWVGLFTIAWVGVLCIWRLWFMVGDLSKPLSSTLKEASRK 318

Query: 284 IICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPR----DVAVG 339
           ++  + +P  ++   F +HF+ LT +  G    SS F+  L G+ +   P+    DV +G
Sbjct: 319 LMFFLALPLALYAVFFYVHFETLTINSDGAGFFSSAFRTTLHGNTI---PKDILADVGIG 375

Query: 340 SSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENET 399
           S+ IS+++ A  G  LHSH + Y +GS QQQVT Y + D NN+W  + P  +P  ++  T
Sbjct: 376 ST-ISMRHVATMGGYLHSHNHMYEKGSQQQQVTLYPHLDGNNDWVIELP-DQP--NKAVT 431

Query: 400 DIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISST---QWEVSGYGDAE-QGDSRDNWLIE 455
             E +   +  RL H  T + LH+H  +AP+S +   Q EVS YG  + +GD  D+W IE
Sbjct: 432 SFEGLKDGTVIRLKHAITQRRLHSHDHKAPVSESADWQKEVSCYGFEDFEGDGNDDWTIE 491

Query: 456 IVDQRGDED---KTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRR 512
           I DQ   E    + ++  L T FR+ +  M+C+L      LP+WGF+Q EV C      +
Sbjct: 492 I-DQDASEPGEAQKRVKALDTKFRLKHNIMNCHLFSHEVKLPKWGFEQQEVTCASQ--GK 548

Query: 513 DKRTWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILAS 572
              T W IE N + +L        + K NFF+  I+ +  M   N  LV +P    I  S
Sbjct: 549 PYLTLWYIEGNSHPLLTGDQERVSYKKPNFFEKLIESHQRMWHINKNLV-EPH---IYES 604

Query: 573 SAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVL-LIRWQRQYS 631
               WP L  G  I  WGE+  + +LLG  A  W S  A + L   IVV  L  WQ    
Sbjct: 605 KPHSWPFLLRG--INYWGENHKQVYLLGN-AIVWWSVTAFIALFATIVVFELFAWQLGKP 661

Query: 632 DLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGL 691
            LQD K +N F +   + LL +GLHY P  +M R  ++HHYLPA YF ++  A+  D  +
Sbjct: 662 ILQDSKVVN-FHVQVIHYLLGYGLHYIPSFLMGRQLFLHHYLPAYYFGILAFAHALDITV 720

Query: 692 KFLTKTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWN 746
            ++ + +  +++   +    +  V+  F  +  + +G     +      W S W+
Sbjct: 721 TYVFRKR--EVIGYAVIGVFFSAVVYFFVSYRALIYGTAWTTDLCQKSQWLSGWD 773

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  336 bits (862), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 220/688 (31%), Positives = 344/688 (50%), Gaps = 26/688 (3%)

Query: 67  GLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNG 126
           G+A  +R+Y +   D VV+DE HFG + S Y++  F+ DVHPPL KML+  +G LAGY G
Sbjct: 57  GVAAAVRLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGG 116

Query: 127 SFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVLFEN 185
            F F   G +YP  V Y  MR   AA   + V + + T +A G      +  ++    EN
Sbjct: 117 EFGFEDIGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVEN 176

Query: 186 SYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAISVKM 245
           S+ T+ ++ILLDS LLFF   +   F      ++   S +++K +  TG+++G A+S K 
Sbjct: 177 SFVTISRYILLDSPLLFFIAAAVYSFKRLELHQTG--SLQYYKCLAATGMALGLAMSSKW 234

Query: 246 VGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIHFDL 305
           VG F    VG+ +++ LW  +GD      + +     +   L ++P  +++  F+IHF  
Sbjct: 235 VGFFTFAWVGVVSVMQLWFQVGDLNKPVPSILKQSAIKASILCVLPMCLYVLFFRIHFQS 294

Query: 306 LTHSGTGDANMSSLFQANLIGSDVGAGP-RDVAVGSSIISIKNQALGGALLHSHYNAYPE 364
           L +      N SS F+  L G  + A     V +GS+ ++I++    G  LHSH + Y  
Sbjct: 295 LPNVTDAAGNFSSAFRTTLHGHTIPANIYAGVGIGST-VTIRHIGTMGGYLHSHNHMYQG 353

Query: 365 GSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKNLHTH 424
           GS QQQVT Y + D NN W+ +        +   T  E +   ++ RL H  TG  LH+H
Sbjct: 354 GSEQQQVTLYPHLDQNNHWYIEHYNAS---NTVPTTFEGLEHGTKIRLKHVLTGHRLHSH 410

Query: 425 PVRAPIS-STQW--EVSGYGDAE-QGDSRDNWLIEIVDQRG--DEDKTKLHPLTTSFRIY 478
             + P+S S+ W  EVSGYG  E +GD+ D+W++EI  ++    E + ++  + T FR+ 
Sbjct: 411 DHKPPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQEKSTPGEARERVRAIETKFRLR 470

Query: 479 NPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFP 538
           +    C L      LP+WGF+Q EV C      R   T W IE N N +L        + 
Sbjct: 471 HAMTGCMLFSHQVKLPKWGFEQQEVTCATQ--GRPDLTLWYIEENTNPLLSEDSEKISYK 528

Query: 539 KTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFL 598
             NF++  ++++  M   N +L  D   +    S   QWP L  G  I  W +D  + +L
Sbjct: 529 TPNFWEKLVEIHRKMWHINKSLT-DAHMYQ---SDPIQWPFLLRG--ISYWSKDSRQVYL 582

Query: 599 LGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYA 658
           LG     +  +L VV   +  V  L  WQ     L D K LN F +   + LL + +HY 
Sbjct: 583 LGNAVVWYSVTLFVVIFGLICVGELFVWQLGKPILSDTKILN-FHIQTIHYLLGYFIHYL 641

Query: 659 PFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGC 718
           P  +M R  ++HHYLPA YF ++ LA+  D  + FL + +      + +++   +  I  
Sbjct: 642 PSFLMGRQMFLHHYLPAYYFGILALAHGLDGLVTFLNRKRPIAYGLVAMFV---LGSIAF 698

Query: 719 FWYFSPISFGMVGPMENYSYLNWFSTWN 746
           F  +SP+ +G+       +     S W+
Sbjct: 699 FVTYSPLVYGLQWTRSQCAKTRLLSNWD 726

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  306 bits (783), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 239/737 (32%), Positives = 347/737 (47%), Gaps = 71/737 (9%)

Query: 49  ESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHP 108
           +S TL +V    M  + TGLA+ +R+++I     VV+DE HFGKF SYYL   ++ DVHP
Sbjct: 56  DSATLYKV----MNYLVTGLALVLRLWRISEPREVVFDEVHFGKFASYYLERTYFFDVHP 111

Query: 109 PLGKMLVGLSGYLAGYNGSFDFSS-GAEYPD-YVDYVKMRIFNAAFSAMCVPVAYFTAKA 166
           P+ KML+   G+L GYNGSF F   G  Y   Y  +V  R  +A    + V V + T K 
Sbjct: 112 PMAKMLIAAIGWLTGYNGSFKFDDIGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKE 171

Query: 167 IGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHN-QRSKPFSRK 225
           + F   T ++    +  +N++ T  + ILLD+ML+F   LS  C+V F+  Q + PFS +
Sbjct: 172 LNFKAVTCFIAAFLIAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSE 231

Query: 226 WWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKT-MSWKAYIGHWLARI 284
           W+ W+ LTG S+   +S K VGL     +G+  +++LW  L  ++ +S +  + H L RI
Sbjct: 232 WYLWLYLTGFSLSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIRSGLSMRKVVKHTLVRI 291

Query: 285 ICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGS---- 340
             LII PF+V+L  F  HF +L  SG GDA MSS FQ  L+ +     P  V + S    
Sbjct: 292 NGLIIFPFVVYLFWFWCHFAILNQSGPGDAFMSSDFQDTLLDA-----PGAVEIKSINYH 346

Query: 341 SIISIKNQALGGALLHSHYNAYPE-------GSNQQQVTAYSYKDANNEWFFDRPRGEPF 393
            II+IK++A   A LHSH   YP         SN QQVT YS++D NN+W    P G  F
Sbjct: 347 DIITIKHKA-TDAFLHSHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQWEILPPSGSKF 405

Query: 394 YHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQ-WEVSGYGDAEQGDSRDNW 452
                  +     D+  RL H  T   L  H V +P   T     +   +   G+S D  
Sbjct: 406 KKGAPVKL-----DADIRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEEEANGESYDFT 460

Query: 453 LIE----IVDQRGDEDKTKLHPLTTSFRIYNPDMDCYL-SQTGNHLPEWGFKQFEVACVQ 507
           L      +    G   KTK     ++FRI++      L +     LPEWGF Q EV    
Sbjct: 461 LFRFQPILPKNSGRVAKTK----NSAFRIFHVQTAVALWTHNDKLLPEWGFSQQEVN--G 514

Query: 508 NPFRRDKRTWWNIET----NENDVLPPRPADFKFPKT-NFFKDFIQLNLAMMATNNALVP 562
           N   +D    W +++     END    R    K P +  FF+ + +L   M   NN L  
Sbjct: 515 NKKVQDPENNWFVDSIVNMPEND--SRRIYTPKVPTSMPFFQKWYELQFLMFEHNNKLSS 572

Query: 563 DPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVL 622
           +       AS+   WP    G+   +  E   + F  G     W   ++V   +  +V  
Sbjct: 573 EHP----FASNPQSWPLSLSGVSFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVAD 628

Query: 623 LIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPA------L 676
           LI  QR    L        +   AF  +  W +HY PF +M+R  ++HHYLPA       
Sbjct: 629 LITRQRAVYALNKMARQKLYGPMAFL-IFGWCIHYFPFFLMARQKFLHHYLPAHLILAMF 687

Query: 677 YFALIILAYVFDAGLKFLTKTKST--------QILRIVIY---LAAYVTVIGCFWYFSPI 725
             AL  + +  +  L F    + +        ++  I  Y   L+  V V GCF YF+P+
Sbjct: 688 SAALWEIVFTDNQSLDFDLDEEDSKNPHDAEPKVYTIAYYLFCLSVIVNVGGCFIYFAPL 747

Query: 726 SFGMVGPMENYSYLNWF 742
            +G+   ++      WF
Sbjct: 748 VYGLSMTVDQIKARQWF 764

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  303 bits (777), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 200/672 (29%), Positives = 328/672 (48%), Gaps = 37/672 (5%)

Query: 63  LVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 122
           L+FT +   +R++ I + + VV+ E   G F S Y+ + F+ DVHPPL  ML      + 
Sbjct: 53  LIFTAI---VRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVF 109

Query: 123 GYNGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITV 181
           GY G F++ + G EY   V YV MR F+A    + V V Y T +  G  I    +  +  
Sbjct: 110 GYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCF 169

Query: 182 LFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSK---PFSRKWWKWMLLTGLSMG 238
             ENS+ TL +F L++   +FF     M   ++  +RS+   P S K  K +L   +++G
Sbjct: 170 AIENSFVTLSRFTLIEGPFVFF-----MACAVYFFRRSELYLPNSCKANKSLLAASIALG 224

Query: 239 CAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLAC 298
            A+S K  GLF I   GI  +  +W  +GD +    + I +   +  CL+ +P  ++   
Sbjct: 225 FAVSSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLI 284

Query: 299 FKIHFDLLTHSGTGDANMSSLFQANLIGSDV-GAGPRDVAVGSSIISIKNQALGGALLHS 357
           F +H   L  +G   +   + F+  L  ++V      +VAVGS+ +S+ +    G  LHS
Sbjct: 285 FSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSA-VSLNHVGTAGGYLHS 343

Query: 358 HYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKT 417
           H + YP GS QQQVT Y + D NN+W  +        +EN T  + +   +  +L   K 
Sbjct: 344 HLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHP---NENVTSFQNLTDGTIIKLRQLKN 400

Query: 418 GKNLHTHPVRAPISST---QWEVSGYG-DAEQGDSRDNWLIEIVDQRGDEDKTKLH--PL 471
           G  LH+H  + P+S     Q EVS YG +  +GD  D+W+IEI  +R +    + H   +
Sbjct: 401 GCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAI 460

Query: 472 TTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPR 531
            T FR+ +    CYL      LPEWGF Q EV C    F R+  T W IE NEN++  P 
Sbjct: 461 ETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAY--FAREDLTSWYIEENENEISLPN 518

Query: 532 PADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGE 591
           P    + K +F++ F+ ++  M   NN +    +     +S    WP +  G+    W E
Sbjct: 519 PEKVSYKKMSFWQKFVAIHKFMFYLNNYM----DTSHAYSSEPKTWPLMLRGIDF--WNE 572

Query: 592 DVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLL 651
           +  + + LG     W  +  +   ++ + V L+ W+   + L+D   +N F    F  LL
Sbjct: 573 NGREVYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLGVNILRDKHIIN-FHYQVFQYLL 631

Query: 652 AWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAA 711
            +  HY P+  + +  +++ YLPA YF ++   +  D    +++  ++        Y+  
Sbjct: 632 GFAAHYFPYFFVGQKLFLYDYLPAYYFGILAFGHALDLISTYISNKRNN-----TGYIVV 686

Query: 712 YVTVIGCFWYFS 723
            + ++ CF++FS
Sbjct: 687 AIFMVVCFYFFS 698

>Scas_442.1
          Length = 309

 Score =  265 bits (677), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 136/311 (43%), Positives = 194/311 (62%), Gaps = 14/311 (4%)

Query: 445 QGDSRDNWLIEIVDQRGD-------EDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWG 497
            GD  D+W++EIVDQ          ED+  +HP++T FR+ +  + CYL+ TG   P WG
Sbjct: 5   NGDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWG 64

Query: 498 FKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATN 557
           F+Q E+ C ++   RDK TWWN+E + ND LP    D+  PK+ F+ DFI +N AM ++N
Sbjct: 65  FQQAEIVCKKSWSHRDKATWWNVEDHWNDQLPIE-EDYVPPKSKFWTDFILINFAMASSN 123

Query: 558 NALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMV 617
           +ALVPD +KFD LAS  W+WPTL+ GLR+CSW  DV KY+LLG+P +TW S+L++   + 
Sbjct: 124 SALVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVF 183

Query: 618 YIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALY 677
            I  +  +W+RQ+ +LQ+ +     + G F P LAW  H+ PFV+M RVTYVHHYLPALY
Sbjct: 184 IISKIAYQWRRQHLNLQEDQLWRLGIQGIF-PFLAWITHFFPFVMMGRVTYVHHYLPALY 242

Query: 678 FALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYS 737
           FA++   +V D  +      ++   ++  IYLA +V     +  F+PI  G+ G +  Y 
Sbjct: 243 FAILTFGFVLDYSIG-----RANPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKYL 297

Query: 738 YLNWFSTWNIA 748
            L W  TWNI 
Sbjct: 298 RLEWLPTWNIV 308

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  276 bits (706), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 215/706 (30%), Positives = 326/706 (46%), Gaps = 69/706 (9%)

Query: 66  TGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 125
           T +A  +R +K+     VV+DE HFGK  SYYL   ++ DVHPP  KML+   G+L GY+
Sbjct: 55  TAIAFAVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYD 114

Query: 126 GSFDFSS-GAEYPDY-VDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVLF 183
           G+F F   G  Y  + V Y+  R  +A    + VP+ +   + + F   T     + V  
Sbjct: 115 GAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAV 174

Query: 184 ENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHN-QRSKPFSRKWWKWMLLTGLSMGCAIS 242
           +N++    + ILLD+ L+    LS   ++ F+  Q   P S +W+ W+  TGLS+   IS
Sbjct: 175 DNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVIS 234

Query: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKT-MSWKAYIGHWLARIICLIIVPFLVFLACFKI 301
            K VG+F   ++G   I++LW  L  +  +S + +  H++ R   L+  PF V+L  F +
Sbjct: 235 TKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYV 294

Query: 302 HFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNA 361
           HF +LT SG GD  MSS FQ  L  S +    +DV     I++ +++   GALLHSH   
Sbjct: 295 HFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHY-YDIVTFQHRD-TGALLHSHNAY 352

Query: 362 YP-------EGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVH 414
           YP         S  QQVT YS++D NN+W        P    +    + VL D   RL H
Sbjct: 353 YPLRYEDGRVSSQGQQVTGYSHEDINNQW-----EILPTKELSSRTGQPVLLDDVLRLRH 407

Query: 415 HKTGKNLHTHPVRAPISSTQWEVSGYGDA-EQGDSRDNWLIEIVDQRGDEDKTKLHPLTT 473
             TG  L TH V +P   T  EV+   +    G+     L ++      +    +   T+
Sbjct: 408 IATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDGGHTVKSKTS 467

Query: 474 SFRIYNPDMDCYL-SQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIE-----TNENDV 527
            FR+++ D    L +     LPEWGFKQ EV    N    D    W +      + E  V
Sbjct: 468 MFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNG--NKKVTDPANIWTVNSILNLSEERKV 525

Query: 528 LPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRIC 587
             P+    K  K  FF  +++L  +M   NN L  +       AS    WP    G+   
Sbjct: 526 YIPK----KVTKMPFFSKWLELQRSMFEHNNKLSSEHP----FASQPESWPGSLSGVSFW 577

Query: 588 SWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLL---IRWQRQYSDLQDPKDLNTFMM 644
           +   +  + +  G     W   + ++ L +++ +LL   I  QR +  L        +  
Sbjct: 578 TNDTERRQIYFTGNIIGWW---IELISLALFVGILLADAITRQRSFFVLGKLAREKIYGP 634

Query: 645 GAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGL--------KFLTK 696
             F   + W +HY PF +M R  ++HHYLPA      ++A +F AGL        + LT 
Sbjct: 635 LCFL-YIGWAIHYFPFFLMGRQKFLHHYLPAH-----LIAAMFTAGLWEVIFTDNRALTT 688

Query: 697 TK---------STQILRIVIYLAAY-----VTVIGCFWYFSPISFG 728
            K         +T  +    +L A+     + V+G F YFSPI +G
Sbjct: 689 RKDESEPAAPHNTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIVYG 734

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  267 bits (682), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 212/709 (29%), Positives = 326/709 (45%), Gaps = 65/709 (9%)

Query: 64  VFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 123
           + T LA   R YKI     VV+DE HFGKF SYYL   ++ DVHPP  KM++   G+L G
Sbjct: 58  IVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLCG 117

Query: 124 YNGSFDFSS-GAEYPDY-VDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITV 181
           Y+GSF F   G  Y  +   Y+  R FNA    + VP+ + T K + F   T    ++ V
Sbjct: 118 YDGSFKFDEIGYSYETHPAPYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASLLV 177

Query: 182 LFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHN-QRSKPFSRKWWKWMLLTGLSMGCA 240
             + ++ T  + ILLD++L+     +  C+V F+  Q  +PF+  W+ W+  TGLS+   
Sbjct: 178 AIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLSFV 237

Query: 241 ISVKMVGLFIITVVGIYTIIDLWNFLGDKT-MSWKAYIGHWLARIICLIIVPFLVFLACF 299
           IS K VG+   + +G   +++LW  L  K  +S + ++ H+  R+  L+++PF+++L  F
Sbjct: 238 ISTKYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLFWF 297

Query: 300 KIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHY 359
            +HF +L  SG GDA MS+ FQ  L  S +    + V     II+IK+Q    A LHSH 
Sbjct: 298 WVHFTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNY-FDIITIKHQD-TDAFLHSHL 355

Query: 360 NAYPE-------GSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRL 412
             YP+        S  QQVT Y++ D NN+W    P G      +    + VL +   RL
Sbjct: 356 ARYPQRYEDGRISSAGQQVTGYTHPDFNNQWEVLPPHG-----SDVGKGQAVLLNQHIRL 410

Query: 413 VHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSR--DNWLIEIVDQRGDEDKTKLHP 470
            H  T   L  H V +P   T  E++     E+GD       L      +  ++   L  
Sbjct: 411 RHVATDTYLLAHDVASPFYPTNEEITTV-TLEEGDGELYPETLFAFQPLKKSDEGHVLKS 469

Query: 471 LTTSFRIYNPDMDCYL-SQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNEN---- 525
            T SFR+++ D    L +     LP+WGF+Q E+    N    D    W ++   N    
Sbjct: 470 KTVSFRLFHVDTSVALWTHNDELLPDWGFQQQEIN--GNKKVIDPSNNWVVDEIVNLDEV 527

Query: 526 ------DVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPT 579
                  V+ P P         F K +I+   +M   NN L  +       AS  + WP 
Sbjct: 528 RKVYIPKVVKPLP---------FLKKWIETQKSMFEHNNKLSSE----HPFASEPYSWPG 574

Query: 580 LYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDL 639
              G+   + G++  + + +G     W   +++   +  IV  LI   R Y  L      
Sbjct: 575 SLSGVSFWTNGDEKKQIYFIGNIIGWWFQVISLAVFVGIIVADLITRHRGYYALNKMTRE 634

Query: 640 NTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFD---AGLKFLTK 696
             +    F+  ++W  HY PF +M+R  ++HHYLPA   A +    +++   +  K L  
Sbjct: 635 KLYGPLMFF-FVSWCCHYFPFFLMARQKFLHHYLPAHLIACLFSGALWEVIFSDCKSLDL 693

Query: 697 TKSTQI------LRIVIYLAAYVTVIGC--------FWYFSPISFGMVG 731
            K   I          +Y+  Y   + C        F YFSP+ +G V 
Sbjct: 694 EKDEDISGASYERNPKVYVKPYTVFLVCVSCAVAWFFVYFSPLVYGDVS 742

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  267 bits (682), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 217/707 (30%), Positives = 330/707 (46%), Gaps = 73/707 (10%)

Query: 66  TGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 125
           T +A  +R YKI     VV+DE HFGKF SYYL   F+ DVHPPL KM++   G+L  Y+
Sbjct: 66  TAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCNYD 125

Query: 126 GSFDFSS-GAEYPDY-VDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVLF 183
           GSF F   G  Y  +   ++  R FNA    + V + + + K + F   T +L ++ V  
Sbjct: 126 GSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLVAI 185

Query: 184 ENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHN-QRSKPFSRKWWKWMLLTGLSMGCAIS 242
           +N++ T  + ILLD++LL     +   ++ F+  Q  +PFS  W+ W+ LTG S+ C IS
Sbjct: 186 DNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCVIS 245

Query: 243 VKMVGLFIITVVGIYTIIDLWNFLG-DKTMSWKAYIGHWLARIICLIIVPFLVFLACFKI 301
            K +G+     +GI  +++LW  L  +  +S +  I H   R+  LI++PF+++L  F +
Sbjct: 246 TKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFWFYV 305

Query: 302 HFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNA 361
           HF +L  SG GD  MSS FQ  L  S+     ++V     I++ +NQ   GA LHSH   
Sbjct: 306 HFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQF-FDIVTFENQD-TGAFLHSHLAR 363

Query: 362 YP-------EGSNQQQVTAYSYKDANNEW----FFDRPRGEPFYHENETDIEYVLGDSQY 410
           YP         S  QQVT Y+++D NN+W      D+ +G+        +I +  GD ++
Sbjct: 364 YPLRYEDDRVSSQGQQVTCYTHEDVNNQWEILPVADKAKGD--------NIRF--GD-EF 412

Query: 411 RLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTK-LH 469
           RL H  T   L  H V +P+  T  E++     +   +R N  I        +D+   + 
Sbjct: 413 RLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDEGHIIK 472

Query: 470 PLTTSFRIYNPDMDCYL-SQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNEN-DV 527
                 RI + +    L S     LP+WGF Q EV    N    D    W I++  N D 
Sbjct: 473 SKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNG--NKKMTDSGNAWTIDSIMNLDE 530

Query: 528 LPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRIC 587
                A  +     FF  +++L   M   NN L  +       AS    WP    G+   
Sbjct: 531 KRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSEHP----FASQPESWPGSMSGVSFW 586

Query: 588 SWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLL---IRWQRQYSDLQDPKDLNTFMM 644
           +  E+  + + +G     W     V+   VY+ +++   I  QR Y  L   K     + 
Sbjct: 587 TKNEERRQIYFIGNIIGFW---FQVISFAVYVGIIIADQITRQRGYFALN--KVTREKLY 641

Query: 645 GAF-YPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGL--KFLTKTKSTQ 701
           G   Y    W  HY PF +M R  ++HHYLPA      ++A +F AGL     ++ KS  
Sbjct: 642 GPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAH-----LIAALFAAGLWETVFSRCKSDD 696

Query: 702 ILR------------IVIYLAAYVT--------VIGCFWYFSPISFG 728
             +              IY AAY+T        ++ CF +FSP+ + 
Sbjct: 697 PYKDEEKPGVSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYA 743

>Scas_710.1
          Length = 919

 Score =  269 bits (687), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 202/729 (27%), Positives = 346/729 (47%), Gaps = 56/729 (7%)

Query: 43  VSTEKKESNTLLRVES----IIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYL 98
           + TE  +    LR  S    II+ L        IR++ +G  + VV+DEA +G   S YL
Sbjct: 32  IDTEPSQDLVQLRTISTTHEIILVLSLLAFTALIRLHDLGWPNGVVFDEAVYGNIVSKYL 91

Query: 99  RHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCV 157
           ++  + DVHPPL K+L     +  G+ G F+F+  G  +P    Y  MR+F+A   ++ V
Sbjct: 92  KNILFVDVHPPLIKLLYAGIAHFLGFEGQFEFNDIGVPFPTTTPYYAMRLFSATLGSLTV 151

Query: 158 PVAYFTAKAIGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQ 217
            + Y T +A G  I      +I ++ ENS+ T+ + I+L+  L+FF     +   ++  +
Sbjct: 152 LLMYLTLRASGVRIWVALAGSICLVIENSFVTVSRHIMLEGPLMFF-----IAAAVYFTK 206

Query: 218 RSKPFSRKWWKWMLLTGL---SMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWK 274
           +S  F        +  G+   ++G AIS K VG+  +   G+  +  LW  +G+ +M   
Sbjct: 207 KSDLFKADSCNSYINIGIAAVALGLAISSKWVGVATLIWAGLICVWRLWFMVGNLSMPVC 266

Query: 275 AYIGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGS-----DV 329
                 L +   LI +P ++++  F  HF    ++G  ++++S LF      +      V
Sbjct: 267 GSFKVALIKAFTLIFLPIILYILTFYFHFQ---YTGI-NSDVSQLFTPEFRTTLANNSVV 322

Query: 330 GAGPRDVAVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEW---FFD 386
                ++AVG S+I++++    G  LHSH   Y +GSNQQQ+T Y Y D N+ W    +D
Sbjct: 323 NNVVAEIAVG-SMITLRHPGTHGGYLHSHDAFYEKGSNQQQITCYPYVDKNDNWTVELYD 381

Query: 387 RPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISST---QWEVSGYG-D 442
            P       EN T  + +   ++ RL+H+ TG  LH+H  + P+S     Q EVS YG  
Sbjct: 382 VPL------ENITSFQNLTDGTKIRLLHN-TGCRLHSHDHKPPVSENSDWQKEVSCYGYP 434

Query: 443 AEQGDSRDNWLIEIVDQRG--DEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQ 500
             +GD+ D+W+IEI        E +  +  + T FR+ +  M CYL      LP+ GF+Q
Sbjct: 435 GFEGDANDDWIIEIDKDASIPGESQEHVRAIETKFRLKHAIMGCYLFSHNTMLPKLGFEQ 494

Query: 501 FEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNAL 560
            EV C  +    D  T W++E NEN  +        +   +F+K F++ +  M+   + +
Sbjct: 495 QEVTCAYSGI--DSLTLWSVENNENPFVSDDAERVSYEPLSFWKKFVETHKRMLEIASGM 552

Query: 561 VPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIV 620
               +   +  S    WP +  G+    W E     +LLG     W  +  +VG    +V
Sbjct: 553 ----DNTHMYESKPATWPFMLRGIDF--WSEQHQDIYLLGNAVLWWSVTAFIVGFAGIVV 606

Query: 621 VLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFAL 680
             L+  Q  Y   +DP  +N F +     LL + L++ P +++    +++HYLPA YF +
Sbjct: 607 WELVSLQLGYEFSKDPHVIN-FHIQVIQYLLGFLLNFIPSLLLENQIFLYHYLPAYYFGI 665

Query: 681 IILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYF---SPISFGMVGPMENYS 737
           + L +  D  + ++ + +     R + Y   ++    C ++F   S + +G     +   
Sbjct: 666 LALTHGLDILVSYIFRRR-----RSIGYTIVFLFATLCVYFFRDRSALVYGTSWTKDLCE 720

Query: 738 YLNWFSTWN 746
              W S W+
Sbjct: 721 QSKWLSGWD 729

>Scas_719.80
          Length = 762

 Score =  259 bits (663), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 221/739 (29%), Positives = 343/739 (46%), Gaps = 78/739 (10%)

Query: 51  NTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPL 110
           ++ LR  +++  +  T +A   R Y I     VV+DE HFGKF SYYL   ++ DVHPP 
Sbjct: 47  DSALRYNALLYTV--TLIAFVARFYMIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPF 104

Query: 111 GKMLVGLSGYLAGYNGSFDFSS-GAEYP-DYVDYVKMRIFNAAFSAMCVPVAYFTAKAIG 168
            KM +   G+L GYNGSF F   G+ Y  +   Y+  R FNA    + V + + T K + 
Sbjct: 105 AKMAIAFIGWLVGYNGSFKFDEIGSSYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELN 164

Query: 169 FSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHN-QRSKPFSRKWW 227
           F   T +   + V  +N++ T  + ILLD++LL     S+  FV F+  Q   PFS +W+
Sbjct: 165 FKAITCFFGALLVAVDNAHVTETRLILLDAILLISIAASFYSFVRFYKAQLRAPFSPQWY 224

Query: 228 KWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKT-MSWKAYIGHWLARIIC 286
            W+ LTGLS+   IS K +G+     +G   I++LW  L  +  ++ +A+  H++ R+  
Sbjct: 225 IWLHLTGLSLSFVISTKYIGVMTYAAIGTGVIVNLWQLLDLRANLTLRAFFRHFVKRLNG 284

Query: 287 LIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIK 346
           L+  PF ++L  F +HF +L+ SG GDA MS+ FQ  L  S +    ++V     II++K
Sbjct: 285 LVFAPFCIYLFWFWVHFAILSKSGPGDAFMSAEFQETLGDSPMSILSKEVHF-YDIITLK 343

Query: 347 NQALGGALLHSHYNAYPE-------GSNQQQVTAYSYKDANNEW------FFDRPRGEPF 393
           ++    A LHSH   YP         S  QQVT ++  D +N+W        D  +G P 
Sbjct: 344 HKD-TEAFLHSHQAFYPLRYEDGRISSEGQQVTGFTGTDISNDWEVLPTRELDSHKGVP- 401

Query: 394 YHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDA-EQGDSRDNW 452
                     V+ +   RL H  +   L  H V +P   T  E++   +    G+S    
Sbjct: 402 ----------VVLNEPIRLRHVASNTYLLAHDVASPFYPTNEEITTVSEEIANGESYQQT 451

Query: 453 LIEIVD-QRGDED---KTKLHPLTTSFRIYNPDMDCYL-SQTGNHLPEWGFKQFEVACVQ 507
           +      ++GDE    KTK       F+IY+P+ D  L +     LP+WGF+Q EV   +
Sbjct: 452 VFTFQPLKKGDEGHVVKTK----GVQFKIYHPNTDVVLWTHNDVLLPDWGFEQQEVNGSK 507

Query: 508 NPFRRDKRTWWNIE--TN-ENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDP 564
           N    D    W+++  TN + D     P   K    +FF+ + +L  +M   NN L  + 
Sbjct: 508 N--FGDPTNAWSVDEITNLDEDRKKFTPKVVK--PMSFFRKWSELQKSMFEQNNKLSAE- 562

Query: 565 EKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLL- 623
                 AS    WP    G+   +  E+  + F        W     V+ + V+I +LL 
Sbjct: 563 ---HPFASQPQSWPAGLCGVSFWTKSEERKQIFFTANIIGWW---FQVISMSVFIGILLA 616

Query: 624 --IRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALI 681
             I  +R Y  L        +   AF   ++WG HYAPF +M R  ++HHYLPA     +
Sbjct: 617 DQISRKRGYFVLGKITREKLYGPLAFL-FISWGCHYAPFFLMHRQKFLHHYLPAHLIISL 675

Query: 682 ILAYVFDA-----------------GLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYFSP 724
             A +++                  G  +    K       V ++A  + ++  F YFSP
Sbjct: 676 FTAGLWEVVFSDCKSIDASRDEEIEGTPYKADPKINSTSLTVFFVAVSIAIVWFFIYFSP 735

Query: 725 ISFGMVGPM-ENYSYLNWF 742
           + +G V    E ++   WF
Sbjct: 736 LVYGNVTLRPEEFAKRQWF 754

>Kwal_47.16734
          Length = 792

 Score =  254 bits (650), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 210/708 (29%), Positives = 313/708 (44%), Gaps = 73/708 (10%)

Query: 66  TGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 125
           T LA  +R  K+     VV+DE HFGKF SYYL   ++ DVHPP  KML+   G+L GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 126 GSFDFSS-GAEY-PDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVLF 183
           G+F F   G  Y  +   +V  R  +A    + VP+ + T K + F   T  L  + V  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 184 ENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHN-QRSKPFSRKWWKWMLLTGLSMGCAIS 242
           + ++    + ILLD+ LL     S  C+V F+  Q   PFS  W+ W+ LTG S+   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKT-MSWKAYIGHWLARIICLIIVPFLVFLACFKI 301
            K +G+     +G    ++LW  L  +  ++ + ++ H L R+  LI  PF+++L  F +
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWV 329

Query: 302 HFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNA 361
           HF +L  SG GD  MSS FQ  L  S +    R V     II++K++ +  A LHSH   
Sbjct: 330 HFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNY-FDIITLKHK-VTDAYLHSHLER 387

Query: 362 YP-------EGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVH 414
           YP         SN QQVT Y+ +D NN+W     +  P        ++ V+     R  H
Sbjct: 388 YPIRYEDGRVSSNGQQVTGYTLEDVNNQWEVLPTKQLPAREGQPVHLDDVV-----RFRH 442

Query: 415 HKTGKNLHTHPVRAPISSTQWEVSGYGDA-EQGDSRDNWLIEIVDQRGDEDKTKLHPLTT 473
             T   L  H V +P+  T  E++   +    G +    L  +      + +  L    +
Sbjct: 443 VVTNTFLLAHDVASPLYPTNEEITTVEEEMANGANYPETLFRLQSVNKGDSEDVLKSKAS 502

Query: 474 SFRIYNPDMDCYL-SQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNEN-----DV 527
            FRI + D    L +     LPEWGFKQ EV    N    D    W  ET  N      V
Sbjct: 503 VFRIVHIDTTVALWTHNDVLLPEWGFKQQEVNG--NKKIIDPENSWFAETIVNIDEARSV 560

Query: 528 LPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRIC 587
             P+       K  FF  +++L   M   NN L          ASS   WP    G+   
Sbjct: 561 YVPKTRK----KLPFFTKWMELQRLMFEHNNKLSSSHP----FASSPESWPGSLSGVSFW 612

Query: 588 SWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVV----LLIRWQRQYS-DLQDPKDLNTF 642
           +   + ++ + +G     W     VV + ++  V    LL+R +  +  +    + LN  
Sbjct: 613 TKDSERIQIYFIGNIIGWW---FQVVSIALFCGVTAADLLVRRRGIFPLNKMAKQKLNAP 669

Query: 643 MMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGL--KFLTKTKST 700
           +   F   + W  H+ PF +M R  ++HHYLPA      ++A +F A +     T  KS 
Sbjct: 670 LSFLF---VGWLCHFVPFFLMGRQKFLHHYLPAH-----LIASMFSAAMWETIFTDNKSL 721

Query: 701 QILR--------------------IVIYLAAYVTVIGCFWYFSPISFG 728
            + +                    I+  L     +I  F YFSPI +G
Sbjct: 722 NLEKDEEDPANAHEANPHLNYIPLILFVLVMSGALIWFFVYFSPIVYG 769

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  209 bits (531), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 181/665 (27%), Positives = 294/665 (44%), Gaps = 48/665 (7%)

Query: 55  RVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 114
           + + I+M +V    AI  R Y IG    +V+DE       S Y    F  DV PPLGKM+
Sbjct: 58  KSDGILMAIV-ALFAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSIDVFPPLGKMI 116

Query: 115 VGLSGYLAGYNGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPT 173
               G   G++ S+ +   G ++ +   Y+  R   A   A  V   + T +A G S P 
Sbjct: 117 YYFVGKYTGFDTSYKYHPVGTQFENASVYLPERYLAAGLGACVVVFFFMTLRASGVSRPI 176

Query: 174 VWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLL- 232
             +F++ +  ENS+ T  +++ LD+  LFF   +     I+  ++S        +++   
Sbjct: 177 AGIFSVALSLENSFITASRYVHLDAPFLFFVAAA-----IYFTKKSDNLRAGSGRYIFTF 231

Query: 233 --TGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIV 290
                 +G AIS K  GLF++  V I T+  LW   GD ++     +  ++  ++ L +V
Sbjct: 232 THAACLLGLAISTKWAGLFVLAWVAIVTLWRLWLLAGDLSVPICRTVKVFIFNLLVLSLV 291

Query: 291 PFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDV-GAGPRDVAVGSSIISIKNQA 349
           P +++ + F  H    T  G     M   F++ L  + V      DV VG + + + N  
Sbjct: 292 PAVIYFSIFSWHIGSRTVDGNDSILMKPEFRSELYNNTVIKESFADVVVGGT-VRLNNIG 350

Query: 350 LGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEW---FFDRPRGEPFYHENETDIEYVLG 406
           + G  + +    Y  GS Q+Q+     +    +W   +++R    P   EN  + E +  
Sbjct: 351 MDGGFVEAAPAYYEAGSKQRQIDLRKNESVTTDWVVEYYNRSGSTPKSFENLKNHEKI-- 408

Query: 407 DSQYRLVHHKTGKNLHTHPVRAPISST---QWEVSGYG-DAEQGDSRDNWLIEIVDQRGD 462
               RL   K    LH+H  +APIS     Q EVS YG +   GD  D+W++EI     +
Sbjct: 409 ----RLYSPKYKCRLHSHDHKAPISQHVDWQKEVSCYGYEGFMGDPNDDWIVEIDQDLSE 464

Query: 463 --EDKTKLHPLTTSFRIYNPDMDCYL--SQTGNHLPEWGFKQFEVACVQNPFRRDKRTWW 518
             E +  +  + T FR+ +    CYL         PE+    +E+AC  +   + + T W
Sbjct: 465 PGEAREFVKAIDTKFRLKHAMSGCYLFTHDVRMRTPEF-VMDYEIACAHS--GKYELTLW 521

Query: 519 NIETNENDVLPPRPADFKFPKTNFF-----KDFIQLNLAMMATNNALVPDPEKFDILASS 573
           NIE ++     P P   K PK   +     KD I    A M     +  D        ++
Sbjct: 522 NIEQDQ-----PHPNSPKNPKRVSYKPMSLKDKILDLHAKMIEKAKVRTDKSSLITFPTT 576

Query: 574 AWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDL 633
              WP L  G  I  W     + + LG PA  W  S  +V  +V  V  LI WQ  +   
Sbjct: 577 ---WPLLEKG--IPFWNGFARQIYFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMGFEIS 631

Query: 634 QDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKF 693
            +P+ +N F +      + + L+Y P+++ +   +++ YLPA YF L+ LA+VF+    F
Sbjct: 632 SNPQFIN-FHIQVLQYGIGFALNYVPYILTTDRHHLYQYLPAYYFGLLALAHVFELVYSF 690

Query: 694 LTKTK 698
             K K
Sbjct: 691 AFKNK 695

>Scas_30.1
          Length = 128

 Score =  163 bits (413), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 79/117 (67%), Positives = 92/117 (78%)

Query: 632 DLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGL 691
           D  +P+DLNTF+MGAFYPLL WGLHY PFVIMSRVTYVHHYLPALYFAL+ILAY+FD  +
Sbjct: 12  DFANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFFM 71

Query: 692 KFLTKTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748
           K  TK+K   I ++ IY   Y  +I  F+YFSPISFGM GP +NYSYLN  S+W IA
Sbjct: 72  KKWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNYSYLNLLSSWKIA 128

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  150 bits (380), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 137/481 (28%), Positives = 216/481 (44%), Gaps = 48/481 (9%)

Query: 58  SIIMPLVFTGLAIFIRMYKI-GINDHVVWDEAHFGKFGS--YYLRHEFYHDVHPPLGKML 114
           SII  L+   +A+F  ++++  +N  +          GS  +YL HEFY D  PPL   L
Sbjct: 29  SIIDSLIAVLIALFFVLFQLTKVNGELGTSVQEKEILGSIDHYLSHEFYLDSRPPLSVQL 88

Query: 115 VGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTV 174
             L  ++ G                   + + +  AA ++ C  +A      +G    +V
Sbjct: 89  FSLLTFVYGE------------------LSVELLRAATTS-CGGIA-LVLLYLGLRKSSV 128

Query: 175 WLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHN------QRSKPFSRKWWK 228
               I+V+   S++ L  F   +  L   T +  +CF+          + +KPFS+ W K
Sbjct: 129 NR-VISVIAVVSFSYLKVF--REETLRVSTDIFQVCFLAMSLYSWKSFKAAKPFSKTWHK 185

Query: 229 WMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLI 288
           ++L   +S+G +IS K VG    + +   +I+ LWN + D  ++ K    H + R + L+
Sbjct: 186 YLLFLSISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADVRLTGKQVFTHCVLRFMALV 245

Query: 289 IVPFLVFLACFKIHFDLLTHSGTGDAN-MSSLFQANLIGSDVG--AGPRDVAVGSSIISI 345
           +VP +VFL  +  H   LT   T  +  MS  ++  L  + +     P  V  GS+I   
Sbjct: 246 LVPAIVFLLSYYAHISTLTQDLTDFSTFMSPYYKHTLENNPLNKIVPPGRVYYGSTITIR 305

Query: 346 KNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVL 405
              +LGG  LHSH   Y  GS++QQVT Y + D NNEW  +  +      +  +    V 
Sbjct: 306 HKDSLGG-YLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVEHKKENK---DVSSKAVAVK 361

Query: 406 GDSQYRLVHHKTGKNLHTHPVRAPISSTQW--EVSGYGDAE-QGDSRDNWLIEIVDQRGD 462
                RL H  TGK L     + P+S   +  EVS  GDA   G S + W I    +  +
Sbjct: 362 NGENIRLRHRLTGKLLRASGAKPPVSEQDYDREVSCTGDANYTGQSDELWKIRFSGRLLE 421

Query: 463 EDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIET 522
                L PL T+F++ N    C L      LPEW   Q EV C+  P +  +RT + +E+
Sbjct: 422 ----GLVPLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQEVLCLDPPTK--ERTLFYVES 475

Query: 523 N 523
           +
Sbjct: 476 S 476

>Scas_329.1
          Length = 273

 Score =  140 bits (353), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 121/212 (57%), Gaps = 6/212 (2%)

Query: 68  LAIF---IRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGY 124
           LA+F   IR+  +   D VV+DE HFGKF SYY++ EF+ DVHPPL KML      LAG+
Sbjct: 64  LALFTASIRLPNLQKPDSVVFDEVHFGKFASYYIKGEFFMDVHPPLAKMLYAGVAALAGF 123

Query: 125 NGSFDFSS-GAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVLF 183
            G+F F + G  +P  V YV MR F+A   A+ V + Y T ++ G      ++       
Sbjct: 124 RGNFMFENIGDVFPADVPYVLMRFFSAMLGALTVMLLYLTLRSSGVRPWVAFVSGACFAI 183

Query: 184 ENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAISV 243
           ENSY T+ ++ILLD+ L+FF   +   F  + N +S  FS    K + + G+++G A S 
Sbjct: 184 ENSYVTISRYILLDAPLIFFIAAAVYSFKKYENYKS--FSIGSIKSLFVAGVALGMAASA 241

Query: 244 KMVGLFIITVVGIYTIIDLWNFLGDKTMSWKA 275
           K VGLF I  VG+  I  LW  +GD + S K+
Sbjct: 242 KWVGLFTIAWVGLLCIWRLWFMIGDLSKSTKS 273

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  124 bits (312), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 94/313 (30%), Positives = 144/313 (46%), Gaps = 19/313 (6%)

Query: 212 VIFHNQRS----KPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLG 267
           +I +N +S    +PF + WW  +    +  G A   K VGL     V +     ++  +G
Sbjct: 181 IILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHIFQLIG 240

Query: 268 DKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGS 327
           D  +S +    H L R+  L +VP  + L  +  H    ++S    + M +LF+A L G 
Sbjct: 241 DLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKAQLDGY 300

Query: 328 DVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDR 387
            V   P  V  GS ++   + ++GG  LHSH   YP GS +QQ+T Y ++DANN+W    
Sbjct: 301 QV-LQPASVYYGSGVVIRHSSSIGG-YLHSHELTYPGGSEEQQITLYDFEDANNKWTV-- 356

Query: 388 PRGEPFYHENETDI----EYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQW--EVSGYG 441
              EP Y+E   DI    + V      +L H +TGK L     + P+S   +  EVS  G
Sbjct: 357 ---EPVYNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQEVSCTG 413

Query: 442 DAE-QGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRI-YNPDMDCYLSQTGNHLPEWGFK 499
           D+   GDS + W ++I D    ED      +  S R+   P +   LS  G         
Sbjct: 414 DSGYSGDSDETWRVDIQDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAEVGPCT 473

Query: 500 QFEVACVQNPFRR 512
           + EV C+ +P  +
Sbjct: 474 RQEVICLASPVHK 486

>Kwal_33.14357
          Length = 657

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 125/476 (26%), Positives = 202/476 (42%), Gaps = 59/476 (12%)

Query: 95  SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSA 154
           S Y++ EF+    PP    ++ L   + G                +    +R  N   +A
Sbjct: 69  SEYMKKEFFLMSSPPFMVQILALVSRIMGS---------------LSIEVLRKINLTTTA 113

Query: 155 MCVPVAYFTAKAIGFSIPTVWLFTITVLFENSYTTLGKFILLDS--MLLFFTVLSYMCFV 212
             V   Y      G       +F ++ +   S + L  F        L+ F VL   C +
Sbjct: 114 FVVSSFYLALSRSGV------VFVVSAVTAGSLSYLSLFAENSQHLSLINFQVLFLSCCL 167

Query: 213 IFHN--QRSKPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKT 270
           +  N  + S  F+R+W+  +    L +  ++S   +G    +   I  I  +W+ +GD  
Sbjct: 168 LSWNSFKHSTSFTRRWYVALTSLSLFLSLSLSTTFLGAITWSWFLILMIKQMWSIVGDVD 227

Query: 271 MSWKAYIGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVG 330
           +S    + H   R++ +I VPF + L+ +   F  L +S     N SSL         + 
Sbjct: 228 VSMWKILKHTFWRVLMIICVPFGLMLSSY---FVFLLNSRGAGMNHSSLVSPYFKTWFLP 284

Query: 331 AG---PRDVAVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSY-KDANNEWFFD 386
            G   P  V  GS+++    ++LGG  LHSH   Y  GS +QQVT   +  DA+NEW  +
Sbjct: 285 QGLPQPDAVYYGSNLLIRHAESLGG-YLHSHNYTYESGSLEQQVTLVDFSNDADNEWIIE 343

Query: 387 RPRGEPFYHEN---ETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQW--EVSGYG 441
                   +EN   +  ++ V      +L H  +GK L     +AP+S   +  EVS  G
Sbjct: 344 AQ------NENLKLDKTLQPVRNGDFVKLRHRTSGKLLRASSAKAPVSEQDYDHEVSCTG 397

Query: 442 DAE-QGDSRDNWLIEIVDQRGDE-DKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFK 499
           D +  GDS + W I    +RG+  ++  L P T  F + N   DC L      LP+WGF 
Sbjct: 398 DHDYTGDSDETWRIRF--ERGNTPNEGILCPFTMYFSLENKGHDCKLLSHDLRLPDWGFG 455

Query: 500 QFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKT-------NFFKDFIQ 548
           Q EV CV +      R+ + ++   +++   R A   +PK        N  K++IQ
Sbjct: 456 QQEVLCVDSA--SPSRSLFFVD--RSNLYKERGAYLTYPKQWKLKRLWNLAKEYIQ 507

>Scas_588.7
          Length = 726

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 156/700 (22%), Positives = 272/700 (38%), Gaps = 97/700 (13%)

Query: 47  KKESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDV 106
           +KE    L V   I+ +    + ++I +  I     +   E        YY + +F  + 
Sbjct: 93  RKEKVGQLSVIDGILSITVALVTLYIGIRNIEKEVPLFPKEQDIFASVEYYQKDKFILNS 152

Query: 107 HPPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKA 166
            PPLG  L  L               G+       Y  MR+ + + S+  +   Y   + 
Sbjct: 153 FPPLGIQLYSL------------LPVGS-------YSAMRLMSLSASSFSLLFLYLAFRR 193

Query: 167 IGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLF---FTVLSYMCFVIFHNQRSKPFS 223
           +        + T+ +L    +      I LD++  F    ++ S+     F +     FS
Sbjct: 194 VNVPYLIALVSTVCILSIPLFRKESTRISLDTLQWFWLSISIYSWASLKCFSH-----FS 248

Query: 224 RKWWKWMLLTGLSMGCAISVKMVGL----FIITVVGIYTIIDLWNFLGDKTMSWKAYIGH 279
            KW    L+  +S+GC+++ K +G     + I +  IY     W  +GD  +S    + H
Sbjct: 249 IKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIY----FWQMIGDVRLSTSHIVKH 304

Query: 280 WLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDAN----MSSLFQANLIGSDVGAGPRD 335
              +I CL+++P  +F     +  +   HS          MSS ++  L        P +
Sbjct: 305 TTFQIFCLLVIPMTIFATTLYLQIN---HSRIDSPEYSQYMSSYYKIFLRSKSPILQPME 361

Query: 336 VAVGSSIISIKN-QALGGALLHSHYNAYPEGSNQQQVTAYSYK-DANNEWFFDRPRGEPF 393
           +  G SII+I++  +LGG L      +YPEGS +Q V+    + + +N+W  +       
Sbjct: 362 ITNG-SIITIRHLNSLGGYLTSPANESYPEGSAEQIVSLTDMESNVDNQWILE------- 413

Query: 394 YHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQW--EVSGYGDAE-QGDSRD 450
            + ++ +   ++   + +L H  TGK L     + P+S  ++  EVS  GD +  GDS +
Sbjct: 414 -YVDDYNKGPLIDSQRIKLRHRTTGKLLRASSAKPPVSEQEYNSEVSCTGDWDYHGDSDE 472

Query: 451 NWLIEIVDQRGDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPF 510
            W I++V+         L P      + N    C L      LP+WG  + EV C+Q+P 
Sbjct: 473 FWKIDLVE-------GSLIPCWNIMELDNVGQMCTLISHDTRLPDWGEFEQEVFCIQSP- 524

Query: 511 RRDKRTWWNIETNENDVLPPRPADFKFPK-TNFFKDFIQLNLAMMATNN--------ALV 561
              +R  + IE  +ND +         P   N+ + +  + LA               L 
Sbjct: 525 -DPQRAKFQIEFVDNDEIKNPITLAGLPGYGNYSRCYQYIKLAAELIQREFKYDYMVKLQ 583

Query: 562 PDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVV 621
            D ++ D +  +  +WP       I   G D      L        SS+AVV +     +
Sbjct: 584 NDNDENDKVHINKEKWP-------IYITGNDTTDLIWL-------TSSIAVVIVACRFGL 629

Query: 622 LLIRWQRQYSDLQDPK---DLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYF 678
            ++ W     D  D     ++  +   A   LL W +HY  F+  S      H    LY 
Sbjct: 630 QVMNWNPWKIDNGDSSSHLNMKIYHEFAIESLLGWFVHYYIFLKSSN----DHLEIVLYL 685

Query: 679 ALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGC 718
              + A++     + +T        +  I L  Y+  I C
Sbjct: 686 PSFVFAHLL--ATETVTAIGQWSQWKCAIILLVYIVTIKC 723

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 115/480 (23%), Positives = 190/480 (39%), Gaps = 42/480 (8%)

Query: 217 QRSKPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAY 276
           Q SK FS  W+  + L  +S+   IS K +GL     + I ++  LW  +GD  +  +  
Sbjct: 175 QASKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQL 234

Query: 277 IGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDV 336
                 R++  +++P +     +       T S    A MSS FQ   + S     P  +
Sbjct: 235 FAIMFCRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQHYSM-SQHNDIPSSI 293

Query: 337 AVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHE 396
             GSSI      +LGG  L +    YP+ ++     +    D  N W  +  +G     E
Sbjct: 294 IYGSSIRLRHVNSLGG-YLSALEIPYPKSNDTLVTVSDDPDDEANFWIIESNKGRN--TE 350

Query: 397 NETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWE--VSGYGDAE-QGDSRDNWL 453
                  V    + +L + KTG+ L     + PIS  +++  +S  GD++ QGD  + W 
Sbjct: 351 QTGSNALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQGDQDELWK 410

Query: 454 IEIVDQRGDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRD 513
           IEI  Q     +  L P      + NP   C L      +P WG ++ EV CV +P R +
Sbjct: 411 IEI--QGKASFREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCV-DPARVN 467

Query: 514 KRTWWN--IETNENDVLPPRPADFKFPKTNFFKDFI----QLNLAMMATNNALVPDPEKF 567
           +  ++   + + E  V+       ++P      +++    +LN      N ++ P     
Sbjct: 468 RALFYIDFVSSPEAGVVEKYKWAPEYPFYKLAFEYVVGQFRLNKRQNIDNTSMSPP---- 523

Query: 568 DILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQ 627
           D L+     WP L+           + K          W +S   VG+  ++        
Sbjct: 524 DCLS-----WPILFDN------NNQIGKIL--------WITSTVSVGVYTFMEAYSWLSW 564

Query: 628 RQYSDLQDPKDLNTFMMG--AFYPLLAWGLHYAPFVI-MSRVTYVHHYLPALYFALIILA 684
             + D       N  M         L W LH   F   + R   V+ Y+P+L FA+IIL+
Sbjct: 565 NIFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFTYSLHRNLSVNQYMPSLLFAVIILS 624

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 84/341 (24%), Positives = 155/341 (45%), Gaps = 38/341 (11%)

Query: 223 SRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLA 282
           +  W+  ++   +S+G AIS K +G+     V +  +      + D  ++    I   + 
Sbjct: 180 TTNWFANVITLSISLGLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVIL 239

Query: 283 RIICLIIVPFLVFLACFKIHFDLLTHSGTGDAN----MSSLFQANLIGSDVGAGPRDVAV 338
            ++ ++I+P  +F+  +    +LL++  T        MS+ F++ L G  V   P  +  
Sbjct: 240 CLLFVLIIPGSIFIISYS---NLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQ--PSRLYY 294

Query: 339 GSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKD--ANNEWFFDRPR-----GE 391
           GS+I      ++ G  L SH  +YP   ++Q V A S+++  A+NEW  + P       E
Sbjct: 295 GSTITLRHLDSMVG-YLASHDISYPSDVDEQLV-ALSFEEFAADNEWLIEHPTLNLSFSE 352

Query: 392 PFYHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQW--EVSGYGDAE-QGDS 448
            ++ +    +E+  G S  +L H  TGK L     + PIS   +  ++S   D+  +G  
Sbjct: 353 VYHADQLIPVEF--GQS-IKLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDSNYEGGM 409

Query: 449 RDNWLIEIV------DQRGDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFE 502
            + W + ++      D++ + D   + PL +  R YN    C L      LPEWG  + E
Sbjct: 410 DERWDVLLIKDEINNDKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQE 469

Query: 503 VACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNFF 543
           V C++ P     RT + I++ +       P DF+ P   ++
Sbjct: 470 VLCMEYPVI--PRTTFLIDSVQ------LPVDFQVPMIEYY 502

>Scas_710.0d
          Length = 271

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 78/167 (46%), Gaps = 13/167 (7%)

Query: 586 ICSWGE--DVVKYFLLGTPASTWGSSLAVVGLMVYIVVL-LIRWQRQYSDLQDPKDLNTF 642
           I  WGE    +  +LLG  A  W S  A +G+ V + +  LI WQ     LQD KD+  F
Sbjct: 3   ISYWGEHDQHLGIYLLGN-AVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQD-KDVINF 60

Query: 643 MMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKST-- 700
            +   + LL + +H  P  +M R  ++HHYLPA YF ++   +  D    ++ + K    
Sbjct: 61  HIQVIHYLLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRKKNFA 120

Query: 701 -QILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWN 746
             +L +   L+ Y      F   SPI +G     +  +   W S+W+
Sbjct: 121 YTLLAVFFALSYYF-----FKDHSPIIYGTEWTKDLCNKSKWVSSWD 162

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,584,560
Number of extensions: 1169862
Number of successful extensions: 3285
Number of sequences better than 10.0: 41
Number of HSP's gapped: 3181
Number of HSP's successfully gapped: 42
Length of query: 752
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 643
Effective length of database: 12,822,747
Effective search space: 8245026321
Effective search space used: 8245026321
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)