Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_324.11031035212e-70
YMR233W226972161e-22
CAGL0M04939g233611909e-19
ABL015C220491584e-14
YOR295W (UAF30)228641288e-10
Scas_665.26249581103e-07
CAGL0G07557g24168848e-04
CAGL0H08624g18574660.21
Scas_670.1563239592.3
KLLA0D02398g120527592.4
Scas_710.3842943575.0
Scas_633.6*302537575.4
AFR168W158042565.5
Scas_696.749339565.9
Scas_673.1843158566.7
Kwal_27.1130170034557.4
Sklu_2436.951755557.7
Kwal_26.876342659557.9
YJL020C (BBC1)115737558.2
Kwal_27.1203971833559.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_324.1
         (103 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_324.1                                                            205   2e-70
YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...    88   1e-22
CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...    78   9e-19
ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...    65   4e-14
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...    54   8e-10
Scas_665.26                                                            47   3e-07
CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...    37   8e-04
CAGL0H08624g complement(845036..845593) similar to tr|Q12262 Sac...    30   0.21 
Scas_670.15                                                            27   2.3  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...    27   2.4  
Scas_710.38                                                            27   5.0  
Scas_633.6*                                                            27   5.4  
AFR168W [3360] [Homologous to ScYGL197W (MDS3) - SH; ScYER132C (...    26   5.5  
Scas_696.7                                                             26   5.9  
Scas_673.18                                                            26   6.7  
Kwal_27.11301                                                          26   7.4  
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          26   7.7  
Kwal_26.8763                                                           26   7.9  
YJL020C (BBC1) [2887] chr10 complement(398853..402326) Protein i...    26   8.2  
Kwal_27.12039                                                          26   9.0  

>Scas_324.1
          Length = 103

 Score =  205 bits (521), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   IVRMSLDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNAL 60
           IVRMSLDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNAL
Sbjct: 1   IVRMSLDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNAL 60

Query: 61  QDRPKVKESSNTQTVERSPTLSEEGQVDEDRKFALQLQKEADE 103
           QDRPKVKESSNTQTVERSPTLSEEGQVDEDRKFALQLQKEADE
Sbjct: 61  QDRPKVKESSNTQTVERSPTLSEEGQVDEDRKFALQLQKEADE 103

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score = 87.8 bits (216), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 68/97 (70%), Gaps = 13/97 (13%)

Query: 6   LDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPK 65
           +++Y+ M+DAILS SNPDE+SPK++R+ALQ L++V+LD+QRK +N+LI+ERF  +Q+ P+
Sbjct: 4   INKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQENPR 63

Query: 66  VKESSNTQTVERSPTLSEEGQVDEDRKFALQLQKEAD 102
           V              + +   +  D++ +L+LQKE +
Sbjct: 64  V-------------LIPKNDLISRDQELSLRLQKEEE 87

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
          cerevisiae YMR233w or tr|Q08747 Saccharomyces
          cerevisiae YOR295w, hypothetical start
          Length = 233

 Score = 77.8 bits (190), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 50/61 (81%)

Query: 6  LDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPK 65
          L+ YVSM+DAI+S S+PD+VSPKKIR+AL++LF+V L+ ++K VN+LI+ RF  LQ  P 
Sbjct: 7  LNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADPH 66

Query: 66 V 66
          +
Sbjct: 67 I 67

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
          (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score = 65.5 bits (158), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (81%)

Query: 15 AILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDR 63
          AILS S+PDE+S K+IR+ALQELF VDLD  +K +  LI+ERF+ L+DR
Sbjct: 20 AILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDR 68

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
          Upstream Activation Factor (UAF) complex, involved in
          activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score = 53.9 bits (128), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 46/64 (71%)

Query: 6  LDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPK 65
          L+ Y +MID +LS  + + V+ KK+R AL+E++ +D+++Q KA+N LI +  + +++RP+
Sbjct: 4  LNDYSTMIDILLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVKERPR 63

Query: 66 VKES 69
           + S
Sbjct: 64 FERS 67

>Scas_665.26
          Length = 249

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 37/58 (63%)

Query: 9  YVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPKV 66
          Y+SMIDA+L++S  D  + K++R  LQE+F ++++  R   ND+I  R    Q R K+
Sbjct: 18 YISMIDALLNSSFTDNPTVKELRMDLQEVFALNIEPLRGDFNDIIQSRIEMWQQRSKI 75

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
          cerevisiae YOR295w, hypothetical start
          Length = 241

 Score = 37.0 bits (84), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 7  DRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDL---DAQRKAVNDLIIERFNALQDR 63
          + Y SMIDA+L+  + +EVS   +R  L E+F++++   D   + + D  +E F  + ++
Sbjct: 8  EEYESMIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEK 66

Query: 64 PKVKESSN 71
          PKVK+ S 
Sbjct: 67 PKVKDIST 74

>CAGL0H08624g complement(845036..845593) similar to tr|Q12262
           Saccharomyces cerevisiae YPR046w MCM16, hypothetical
           start
          Length = 185

 Score = 30.0 bits (66), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 30  IRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPKVKESSNTQTVERSPTLSEEGQVDE 89
           I R LQ +  +D D +R ++ DL+ ER N+L +R    E+   Q +     +S +   DE
Sbjct: 66  ILRTLQRVNQLDKDGER-SLEDLVAERLNSLMERHYSTETECMQIINARLDVSTKI-FDE 123

Query: 90  DRKFALQLQKEADE 103
            +KF ++L++E  E
Sbjct: 124 QKKF-MKLREELQE 136

>Scas_670.15
          Length = 632

 Score = 27.3 bits (59), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 15  AILSASNPDEVSP--KKIRRALQELFNVDLDAQRKAVND 51
           A++  S   E SP  KKIR  L++L +++   QR+AV D
Sbjct: 566 AVVDGSANKEASPEEKKIRSLLKKLRSIETLKQRQAVGD 604

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
           Saccharomyces cerevisiae YJL080c SCP160 required for
           maintenance of exact ploidy singleton, start by
           similarity
          Length = 1205

 Score = 27.3 bits (59), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 19  ASNPDEVSPKKIRRALQELFNVDLDAQ 45
           AS+P    P +  R +QE+F++DLDAQ
Sbjct: 98  ASSPGSAKPLR-SRNIQEVFSLDLDAQ 123

>Scas_710.38
          Length = 429

 Score = 26.6 bits (57), Expect = 5.0,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 35 QELFNVDLDAQRKAVNDLIIERFNALQDRPKVKESSNTQTVER 77
          ++ FN++  A  K+VNDL ++    +  RP VK     Q   R
Sbjct: 25 EDKFNLNCQAMLKSVNDLRLKTGKNILFRPHVKTHKTGQGTVR 67

>Scas_633.6*
          Length = 3025

 Score = 26.6 bits (57), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 37   LFNVDL-DAQRKAVNDLIIERFNALQDRPKVKESSNT 72
            LF++ L +++R+ + D+I++  N  Q   KV E+SNT
Sbjct: 1093 LFDLKLPNSKRELILDIIVKFMNVRQHLAKVTENSNT 1129

>AFR168W [3360] [Homologous to ScYGL197W (MDS3) - SH; ScYER132C (PMD1)
            - SH] complement(738941..743683) [4743 bp, 1580 aa]
          Length = 1580

 Score = 26.2 bits (56), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 42   LDAQRKAVNDLIIERFNALQDRPKVKESSNTQTVERSPTLSE 83
            +D     V+D  IE F+  QD PK+ +  +T +V++ P L E
Sbjct: 1230 IDEDPHVVSDADIEDFD--QDLPKINKHDDTGSVKKDPALHE 1269

>Scas_696.7
          Length = 493

 Score = 26.2 bits (56), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 45  QRKAVNDLIIERFNALQDRPKVKESSNTQTVERSPTLSE 83
           +++ +N +IIE    L ++PKV+ S N       PTLS+
Sbjct: 90  EQRNLNHIIIEHKKPLNEKPKVELSKNKLRKISKPTLSQ 128

>Scas_673.18
          Length = 431

 Score = 26.2 bits (56), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 34  LQELFNVDLDAQRKAVNDLIIERFNALQDRPKVKESSNTQTVERSPTLSE-EGQVDED 90
            Q+  N  L AQ+K +ND I+ERF +L   P ++E    +  E+  +L++ E Q+DE+
Sbjct: 55  FQQSNNNSLAAQKK-MNDEILERFKSLAQFP-LEEYETLKGEEQGRSLTQKEKQLDEE 110

>Kwal_27.11301
          Length = 700

 Score = 25.8 bits (55), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 30  IRRALQELFNVDLDAQRKAVNDLIIERFNALQDR 63
           I+  LQ+ +  ++D    A  DLIIER   +Q R
Sbjct: 203 IKTILQDFWQCEIDESINAGQDLIIERIIDVQTR 236

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 25.8 bits (55), Expect = 7.7,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 39  NVDLDAQRKAVNDLIIERFNALQDRPKVKESSNTQTVERSPTLSEEGQVDEDRKF 93
           NV LD ++ ++  LI E+F    ++P + E+ + Q     P L  E Q+ E +++
Sbjct: 454 NVPLDMEQCSMYPLIEEQFYKPIEKPHINETLDRQM---DPVLVSERQMRETQQY 505

>Kwal_26.8763
          Length = 426

 Score = 25.8 bits (55), Expect = 7.9,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 28  KKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPKVKESSNTQTVE---RSPTLSE 83
           KK+ RA    F       ++ VND  +ERF+  Q +P+ K  S+   ++   R P  S+
Sbjct: 64  KKLARAY---FRTSESFAKEEVNDYGVERFSKAQPKPQNKRPSSGTIIQLDRRLPQTSD 119

>YJL020C (BBC1) [2887] chr10 complement(398853..402326) Protein
            involved in the regulation of myosin function and the
            actin cytoskeleton, interacts with Myo3p and Myo5p [3474
            bp, 1157 aa]
          Length = 1157

 Score = 25.8 bits (55), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 23   DEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNA 59
            +  SP+K    LQE F   ++ Q   + D   +RFNA
Sbjct: 971  NSTSPEKTVTTLQERFPSPVETQSARILDEYAQRFNA 1007

>Kwal_27.12039
          Length = 718

 Score = 25.8 bits (55), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 2/33 (6%)

Query: 24  EVSP--KKIRRALQELFNVDLDAQRKAVNDLII 54
           E+SP  KKI+  ++ L  VD +A +  +ND+++
Sbjct: 395 ELSPHEKKIKHVMETLEGVDPEACQHIINDILV 427

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,992,145
Number of extensions: 109720
Number of successful extensions: 470
Number of sequences better than 10.0: 42
Number of HSP's gapped: 469
Number of HSP's successfully gapped: 42
Length of query: 103
Length of database: 16,596,109
Length adjustment: 74
Effective length of query: 29
Effective length of database: 14,034,377
Effective search space: 406996933
Effective search space used: 406996933
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)