Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_248.1d1541547941e-110
KLLA0C05896g1581475652e-75
Kwal_56.225201571315417e-72
ACL018W1341274494e-58
Scas_706.24460149651.1
KLLA0C13211g70948613.5
KLLA0E05225g175554604.4
Scas_587.1045835595.2
Scas_651.10873108588.3
YDR484W (VPS52)64150588.6
Kwal_56.24134110252589.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_248.1d
         (154 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_248.1d                                                           310   e-110
KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359 ...   222   2e-75
Kwal_56.22520                                                         213   7e-72
ACL018W [1031] [Homologous to NOHBY] complement(329990..330394) ...   177   4e-58
Scas_706.24                                                            30   1.1  
KLLA0C13211g 1126739..1128868 weakly similar to sp|P32389 Saccha...    28   3.5  
KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces c...    28   4.4  
Scas_587.10                                                            27   5.2  
Scas_651.10                                                            27   8.3  
YDR484W (VPS52) [1300] chr4 (1422751..1424676) Subunit of the VF...    27   8.6  
Kwal_56.24134                                                          27   9.2  

>Scas_248.1d
          Length = 154

 Score =  310 bits (794), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%)

Query: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60
           MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN
Sbjct: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60

Query: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120
           FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ
Sbjct: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120

Query: 121 SEIEELRSLMEIQNEILKNLTRDKQQLVQKSKKV 154
           SEIEELRSLMEIQNEILKNLTRDKQQLVQKSKKV
Sbjct: 121 SEIEELRSLMEIQNEILKNLTRDKQQLVQKSKKV 154

>KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359
           Candida albicans unknown function, start by similarity
          Length = 158

 Score =  222 bits (565), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 107/147 (72%), Positives = 127/147 (86%)

Query: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60
           MSAIA+KLGAL++RQVTRP+ANVLK QAK+H  FK ICI LAQ+MH ADV+LRS+LTP+ 
Sbjct: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60

Query: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120
           FSK IRPLN+ KAVENGATL SE FVFGVTGSVVVWETLRQR KEL+RREQV+QDI+FLQ
Sbjct: 61  FSKTIRPLNDTKAVENGATLLSEGFVFGVTGSVVVWETLRQRQKELDRREQVTQDIAFLQ 120

Query: 121 SEIEELRSLMEIQNEILKNLTRDKQQL 147
           SEIEELRS  + Q++ +K+    K++L
Sbjct: 121 SEIEELRSTTKTQSDQIKSCQSLKEEL 147

>Kwal_56.22520
          Length = 157

 Score =  213 bits (541), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%)

Query: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60
           MSA+AVKLG L+IRQVTRPVANVLKAQAKQHD FKRIC+ +AQ+MHR D  LR+RLTP N
Sbjct: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60

Query: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120
              K+RPLN+ +AVENGAT  SE FVFGVTGSVVVWET+RQR KE+NRREQV+ DISFLQ
Sbjct: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120

Query: 121 SEIEELRSLME 131
           SEIE LR L+E
Sbjct: 121 SEIEYLRDLLE 131

>ACL018W [1031] [Homologous to NOHBY] complement(329990..330394)
           [405 bp, 134 aa]
          Length = 134

 Score =  177 bits (449), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%)

Query: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60
           MSA+A KLGAL+IRQVTRPVANVLK QAKQH +FK++CI LAQ+MHRADV LRSRLTP  
Sbjct: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60

Query: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120
             KKIRPLN+E+AVENGATL SE+FVFGVTG+VVVWET+RQR KEL+RREQV QDI  LQ
Sbjct: 61  QPKKIRPLNDERAVENGATLLSELFVFGVTGTVVVWETVRQRNKELDRREQVLQDIKELQ 120

Query: 121 SEIEELR 127
            EI+EL+
Sbjct: 121 EEIDELK 127

>Scas_706.24
          Length = 460

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 63/149 (42%), Gaps = 26/149 (17%)

Query: 14  RQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSNFSKKIRPLNEEKA 73
           R +  P+AN +  +  Q    ++I     +R  RA  I R   T S F+  I P NE  A
Sbjct: 11  RTIDSPMANAMTTKFLQELKAEKI---QDERYTRA--ITR---THSRFTSSITP-NEVLA 61

Query: 74  VE---NGATLFSEMFVFG-VTGSVVVW--------ETLRQRTKELNRREQVSQDISFLQS 121
           ++   +GA L      +G + GS+ VW        +       + N  ++V  D+SF  S
Sbjct: 62  LQFHPSGAYL-----AYGRMDGSLTVWVLQGHSFNKAKNCYIPDANGNDKVINDLSFNPS 116

Query: 122 EIEELRSLMEIQNEILKNLTRDKQQLVQK 150
           E+ E  ++       + N+  D    V K
Sbjct: 117 ELNEFATVSNSNEIFIWNIQNDSSPTVNK 145

>KLLA0C13211g 1126739..1128868 weakly similar to sp|P32389
           Saccharomyces cerevisiae YNL103w MET4 transcriptional
           activator of sulfur metabolism singleton, hypothetical
           start
          Length = 709

 Score = 28.1 bits (61), Expect = 3.5,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 31/48 (64%), Gaps = 2/48 (4%)

Query: 102 RTKELNRREQVS--QDISFLQSEIEELRSLMEIQNEILKNLTRDKQQL 147
           +TK+L  +E  +  QD+S L  ++++  + +E++N +LKNL  ++  L
Sbjct: 639 QTKKLKEKEMETWVQDLSQLACDLKQRINTLEMENRLLKNLVIERGDL 686

>KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces
           cerevisiae YDL058w USO1 intracellular protein transport
           protein, start by similarity
          Length = 1755

 Score = 27.7 bits (60), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 40  SLAQRMHRADV--ILRSRLTPSNFSKKIRPLNEEKAVENGATLFSEMFVFGVTG 91
           S++    RAD+  +L SR++P N++ +I+ L E +   N   ++     F  TG
Sbjct: 602 SVSSPFSRADLYSLLVSRISPDNYASRIKQLRENELFTNSLDVYLNP-TFDETG 654

>Scas_587.10
          Length = 458

 Score = 27.3 bits (59), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 26/35 (74%), Gaps = 2/35 (5%)

Query: 116 ISFLQSEIEELRSLMEIQNEILKNLTRDKQQLVQK 150
           ISFL    +E+R+LME+Q+E+L +  R+ Q ++Q+
Sbjct: 422 ISFLFGR-KEIRALMEVQHEVL-DAERNVQNILQR 454

>Scas_651.10
          Length = 873

 Score = 26.9 bits (58), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 16/108 (14%)

Query: 22  NVLKAQAKQHDSFKRICISL---AQRMHRADVILRSRLT---PSNFSKKIRPLNEEKAVE 75
           N L     Q  ++K++  SL   +Q+++   VIL   LT   P N +K I P+     ++
Sbjct: 412 NFLYTLIVQSTAYKKLIFSLKTESQQVYVVRVILDILLTDDDPENNNKSILPIESMDQLK 471

Query: 76  NGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQSEI 123
              TL++ M  F         E L   + +L +RE++S+ I  + + I
Sbjct: 472 RLLTLYNPMLSFKT-------ENL---SMDLPKREKLSKLIHLVANSI 509

>YDR484W (VPS52) [1300] chr4 (1422751..1424676) Subunit of the VFT
           (Sac2p-Vps53p-Luv1p) complex, involved in protein
           sorting in the late Golgi [1926 bp, 641 aa]
          Length = 641

 Score = 26.9 bits (58), Expect = 8.6,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 30/50 (60%)

Query: 92  SVVVWETLRQRTKELNRREQVSQDISFLQSEIEELRSLMEIQNEILKNLT 141
           ++++ + +   T+  NR    +QD+ F++ +  EL+SL+E  +  L +++
Sbjct: 71  NIIIPQLIDYLTEFTNRLSNYTQDLDFIKKKSNELQSLLEYNSTKLAHIS 120

>Kwal_56.24134
          Length = 1102

 Score = 26.9 bits (58), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 99  LRQRTKELNRREQVSQDISFLQSEIEELRSLMEIQNEILKNLTRDKQQLVQK 150
           L  + +EL+ +EQ +QD+  L +  +E+ S +  QN+++  L +DK+ L +K
Sbjct: 682 LNSQLRELDTKEQ-AQDV--LNTAKDEISSKIAAQNDLIIRLNKDKEHLNRK 730

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.130    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,036,932
Number of extensions: 144536
Number of successful extensions: 934
Number of sequences better than 10.0: 47
Number of HSP's gapped: 932
Number of HSP's successfully gapped: 47
Length of query: 154
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 61
Effective length of database: 13,376,635
Effective search space: 815974735
Effective search space used: 815974735
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)