Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_248.126026011071e-154
Kwal_56.225225132214616e-54
YOL013C (HRD1)5512173866e-43
Scas_644.65102493383e-36
CAGL0E02299g5452252884e-29
KLLA0C05874g5532292338e-22
ACL019C5752072126e-19
YKL171W92849720.44
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_248.1
         (260 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_248.1                                                            431   e-154
Kwal_56.22522                                                         182   6e-54
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...   153   6e-43
Scas_644.6                                                            134   3e-36
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...   115   4e-29
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    94   8e-22
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    86   6e-19
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    32   0.44 

>Scas_248.1
          Length = 260

 Score =  431 bits (1107), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 224/260 (86%)

Query: 1   GAALLLALHPTSFTWXXXXXXXXXXXXFENNKNRMPVSQNRRGQFIVYSVFTYSAAIWSV 60
           GAALLLALHPTSFTW            FENNKNRMPVSQNRRGQFIVYSVFTYSAAIWSV
Sbjct: 1   GAALLLALHPTSFTWLSPSRSSSLLRSFENNKNRMPVSQNRRGQFIVYSVFTYSAAIWSV 60

Query: 61  YDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKXXXXXXXXXXXXIEYEHVFER 120
           YDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWK            IEYEHVFER
Sbjct: 61  YDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKLLTRLLFGELRLIEYEHVFER 120

Query: 121 LSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWILKDRLEFVFQNANENTNLKKM 180
           LSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWILKDRLEFVFQNANENTNLKKM
Sbjct: 121 LSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWILKDRLEFVFQNANENTNLKKM 180

Query: 181 XXXXXXXXXXXXASVDYQMVRYCLSNSISNDQWTSSSVYLMFGIDFAMLLVDTLSIGLHG 240
                       ASVDYQMVRYCLSNSISNDQWTSSSVYLMFGIDFAMLLVDTLSIGLHG
Sbjct: 181 LFSRFNFNLLFLASVDYQMVRYCLSNSISNDQWTSSSVYLMFGIDFAMLLVDTLSIGLHG 240

Query: 241 VVNFVEVYRLQSHNSHYDEE 260
           VVNFVEVYRLQSHNSHYDEE
Sbjct: 241 VVNFVEVYRLQSHNSHYDEE 260

>Kwal_56.22522
          Length = 513

 Score =  182 bits (461), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 97/221 (43%), Positives = 142/221 (64%), Gaps = 5/221 (2%)

Query: 35  MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 94
           M V   RR QF  Y   +Y+AA W++  ++  S++FL+ + +LCEG+NLI+L NF  +NG
Sbjct: 1   MAVRVQRR-QFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNG 59

Query: 95  VLLWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 154
           VLLWK            +EYEH+FERLSFTIVN  F+SS F E +F++V+ F+A LIF+K
Sbjct: 60  VLLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVK 119

Query: 155 VFHWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSN----SISN 210
           VFHW+L+DRLE VFQ+ +E+TN  ++              +D+QM ++C+      S S 
Sbjct: 120 VFHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSG 179

Query: 211 DQWTSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQ 251
              +S SV+LMF ++FAMLLVD   + +  ++N VEVY+ +
Sbjct: 180 FYSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCK 220

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score =  153 bits (386), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 137/217 (63%), Gaps = 2/217 (0%)

Query: 37  VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 96
           V +NRR Q  ++ V TY    + VY +  +SV+FLQ T+KL EG NL++L  F LLN  L
Sbjct: 2   VPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTL 61

Query: 97  LWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 156
           LW+            IE+EH+FERL FTI+N++F+SS+F E+ F TV  F  +L++LKVF
Sbjct: 62  LWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVF 121

Query: 157 HWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQ--WT 214
           HWILKDRLE + Q+ N++T +K +            A VDYQ++  C+S+  +N +    
Sbjct: 122 HWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIE 181

Query: 215 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQ 251
           S+S+YL+  ++F MLL+D L++ L   +NF E YR Q
Sbjct: 182 STSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQ 218

>Scas_644.6
          Length = 510

 Score =  134 bits (338), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 133/249 (53%), Gaps = 33/249 (13%)

Query: 39  QNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLW 98
           Q RR Q I ++   Y   I  + +S   S +FL  ++KL +G N++I+  F LLN +LLW
Sbjct: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLW 62

Query: 99  KXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHW 158
           K            IE EH+ ERL FTI+N IF+S+MF E+ F+T+  +  +L+++K+F+W
Sbjct: 63  KFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122

Query: 159 ILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCL-------------- 204
           ILKDRLEF+ Q +N N ++ +             ++++ Q+++ C+              
Sbjct: 123 ILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181

Query: 205 --------------SNSISNDQWTSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRL 250
                         S   SN     + +YLM  ++FA+LL++ +++ LH +++  E+Y+ 
Sbjct: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK- 240

Query: 251 QSHNSHYDE 259
              ++ YD+
Sbjct: 241 ---SNQYDQ 246

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score =  115 bits (288), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 124/225 (55%), Gaps = 18/225 (8%)

Query: 42  RGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKXX 101
           + +F++++  TY   I+ V  +  SSV+FLQ  +KL EG N++I+  F LLN  LLW+  
Sbjct: 7   KREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFL 66

Query: 102 XXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWILK 161
                     IE+EH+FERL F ++N+IF+ S F E+ F T+     VL+++KVFHWIL+
Sbjct: 67  TSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWILR 126

Query: 162 DRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNS--ISNDQWTSSS-- 217
           DRL+ + Q  NE+T  K +              +D  ++ +C+S +  I++  +T+ +  
Sbjct: 127 DRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTNS 186

Query: 218 --------------VYLMFGIDFAMLLVDTLSIGLHGVVNFVEVY 248
                         +Y+M  ++F  L++D +++ L+  + F E +
Sbjct: 187 IVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFH 231

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 94.4 bits (233), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 115/229 (50%), Gaps = 19/229 (8%)

Query: 44  QFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKXXXX 103
           +FI YS+ +Y+AA WS++  +++S ++L    K+ EG++ +I GN  LLN VL+ K    
Sbjct: 25  KFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIH 84

Query: 104 XXXXXXXXIEYEHVFERLSFTIVNSIF-VSSMFKEQDFLTVLVFTAVL-IFLKVFHWILK 161
                   IEYEH+ ER+S+T++  +   SSM      ++V+    VL +  +  HWILK
Sbjct: 85  MLFGQLRLIEYEHILERISYTVITLLLSCSSM---NGLISVMQIHCVLFVCCRTLHWILK 141

Query: 162 DRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSI--SNDQWTSSSVY 219
           DR+E  FQ  +    LK +             +VD  +V Y ++  +  SN   T    Y
Sbjct: 142 DRMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVT----Y 197

Query: 220 LMFGI-DFAMLLVDTLSIGLHGVVNFVEVYRLQSH-------NSHYDEE 260
            +F I  +A+L  D L + L   +N  E+  +Q+        + H DE 
Sbjct: 198 TLFIISQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEP 246

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 86.3 bits (212), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 99/207 (47%), Gaps = 9/207 (4%)

Query: 52  TYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKXXXXXXXXXXXX 111
           TY+ A WS Y   +S    L        GV+ +I GNF +++  L               
Sbjct: 17  TYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTA 76

Query: 112 IEYEHVFERLSFTIVN-SIFVSSMFKE--QDFLTVLVFTAVLIFLKVFHWILKDRLEFVF 168
           IEY+H+FERL   +V  +  V +M K      +T+L +T  L    V HW+L+DR++FVF
Sbjct: 77  IEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRDRMDFVF 132

Query: 169 QNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQWTSSSVYLMFGIDFAM 228
           Q    +++L  +              VDY+M+++C+ N  +N       +YLM  + FA 
Sbjct: 133 QVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQN--TNVDGKRHELYLMLALSFAQ 190

Query: 229 LLVDTLSIGLHGVVNFVEVYRLQSHNS 255
           L++D L + L   +N  E+ R +   S
Sbjct: 191 LILDVLHVVLLTSLNLFEMVRSRRTRS 217

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 32.3 bits (72), Expect = 0.44,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 28  FENNKNRMPVSQNRRGQF--IVYSVFTYSAAIWSVYDSLSSSVTFLQTT 74
           +  + N   ++QN +  F  + YS+ T S+A+ + +DS +SS+ FL TT
Sbjct: 244 YTTSSNNNSITQNNKFSFAKLKYSLPTQSSAVPASFDSNASSLNFLPTT 292

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,082,374
Number of extensions: 245581
Number of successful extensions: 637
Number of sequences better than 10.0: 8
Number of HSP's gapped: 629
Number of HSP's successfully gapped: 8
Length of query: 260
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 160
Effective length of database: 13,134,309
Effective search space: 2101489440
Effective search space used: 2101489440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)