Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2396734233816550.0
YPL193W (RSA1)3811693812e-42
AFL073W3351493461e-37
Scas_611.33891403437e-37
CAGL0G09218g3791813341e-35
KLLA0E19437g3421603293e-35
Sklu_2339.7413115700.92
CAGL0F01529g75782681.8
CAGL0F06611g86337681.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23967
         (338 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23967                                                         642   0.0  
YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic prote...   151   2e-42
AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH] complement(...   137   1e-37
Scas_611.3                                                            136   7e-37
CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces c...   133   1e-35
KLLA0E19437g complement(1721747..1722775) some similarities with...   131   3e-35
Sklu_2339.7 YLR423C, Contig c2339 14555-15796 reverse complement       32   0.92 
CAGL0F01529g 156044..158317 highly similar to sp|P25039 Saccharo...    31   1.8  
CAGL0F06611g 650449..653040 similar to sp|Q04748 Saccharomyces c...    31   1.9  

>Kwal_56.23967
          Length = 342

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/338 (93%), Positives = 315/338 (93%)

Query: 1   MSYNQNSGYGSNENQQRQPNIPRPTSSGQLPGQQGDIGSRPVMNFPAPQAVPYYQNYQNY 60
           MSYNQNSGYGSNENQQRQPNIPRPTSSGQLPGQQGDIGSRPVMNFPAPQAVPYYQNYQNY
Sbjct: 1   MSYNQNSGYGSNENQQRQPNIPRPTSSGQLPGQQGDIGSRPVMNFPAPQAVPYYQNYQNY 60

Query: 61  GTAHIQGQSHGTPYGQGYYGSXXXXXXXXXXXXXFTNPYYGYPASHLPAKESSRMQAPVK 120
           GTAHIQGQSHGTPYGQGYYGS             FTNPYYGYPASHLPAKESSRMQAPVK
Sbjct: 61  GTAHIQGQSHGTPYGQGYYGSYPAYYIPAQQQPQFTNPYYGYPASHLPAKESSRMQAPVK 120

Query: 121 PRMAEKVTIDYEDSAATPSSVSGIDSIEEDRTHHPKPDQNFDDAEGALQSDKKEKKVVAI 180
           PRMAEKVTIDYEDSAATPSSVSGIDSIEEDRTHHPKPDQNFDDAEGALQSDKKEKKVVAI
Sbjct: 121 PRMAEKVTIDYEDSAATPSSVSGIDSIEEDRTHHPKPDQNFDDAEGALQSDKKEKKVVAI 180

Query: 181 PGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKKDKQ 240
           PGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKKDKQ
Sbjct: 181 PGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKKDKQ 240

Query: 241 FIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELGDAKXXXXXXXXXXKNVLF 300
           FIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELGDAK          KNVLF
Sbjct: 241 FIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELGDAKLLEYELTEEEKNVLF 300

Query: 301 GNTFKRNKPRADFNRKRPNFTRDGPSRYEGNTKKQQIT 338
           GNTFKRNKPRADFNRKRPNFTRDGPSRYEGNTKKQQIT
Sbjct: 301 GNTFKRNKPRADFNRKRPNFTRDGPSRYEGNTKKQQIT 338

>YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic protein
           involved in assembly of 60S ribosomal subunits [1146 bp,
           381 aa]
          Length = 381

 Score =  151 bits (381), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 115/169 (68%), Gaps = 4/169 (2%)

Query: 162 DDAEGALQSDKKEKKVVAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGV 221
           DD +  L+S+    KVV +PGTSI L ++ED+KKWREER+KMWL+KISN ++KH QE+G+
Sbjct: 212 DDRDEQLESEGL-GKVVLVPGTSIALITDEDVKKWREERKKMWLLKISNNKQKHMQEMGI 270

Query: 222 EEKE-PTNAGAFQQVKKDKQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQE 280
           +E E  +    F++ +K+KQFIQSIQNQ+ R NP  +L+L+L+QR  A EN  LL+FI+E
Sbjct: 271 KEDELKSQPSIFKESRKEKQFIQSIQNQVQRGNPKIDLNLKLIQREFANENSQLLDFIRE 330

Query: 281 LGDAKXXXXXXXXXXKNVLFGNTFKRNKP--RADFNRKRPNFTRDGPSR 327
           LGD            K+VLFG++   NK   + ++  ++PN +R   +R
Sbjct: 331 LGDVGLLEYELSQQEKDVLFGSSEDNNKNHYKPNYKNRKPNLSRANFTR 379

>AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH]
           complement(298718..299725) [1008 bp, 335 aa]
          Length = 335

 Score =  137 bits (346), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 88/149 (59%), Gaps = 1/149 (0%)

Query: 179 AIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKKD 238
           AI GTSI L + EDI+KWR ERRKMWL+KISNQ+EKH +ELGV E+E        Q +KD
Sbjct: 176 AIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQE-LRCSPLVQGRKD 234

Query: 239 KQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELGDAKXXXXXXXXXXKNV 298
           K+FI  IQ+ + R     NLS+ L+QRTMA EN  +L FI+ELGDA           K  
Sbjct: 235 KKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDANLLEHVLTEKEKEA 294

Query: 299 LFGNTFKRNKPRADFNRKRPNFTRDGPSR 327
           LFG   +  + R  F  +      DG  R
Sbjct: 295 LFGKAMRAAENRKQFAGRSFTSQNDGRGR 323

>Scas_611.3
          Length = 389

 Score =  136 bits (343), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 68/140 (48%), Positives = 93/140 (66%), Gaps = 4/140 (2%)

Query: 163 DAEGALQSDKKEKKVVAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVE 222
           D E  ++ DKK    + +PGTSI+L ++EDI KWREERRKMWL+KISN ++KH +E+G++
Sbjct: 203 DEETNIEDDKKP---IVVPGTSISLVTDEDIIKWREERRKMWLLKISNNKQKHMEEMGLK 259

Query: 223 EKE-PTNAGAFQQVKKDKQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQEL 281
           E++         + +K  QFIQSIQNQ+NR NP  NL+L+L+QR M  +N  LL+FI  L
Sbjct: 260 EEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSKLLDFITNL 319

Query: 282 GDAKXXXXXXXXXXKNVLFG 301
           GDA           K+ LFG
Sbjct: 320 GDAGLLEYELTQDEKDKLFG 339

>CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces
           cerevisiae YPL193w RSA1, start by similarity
          Length = 379

 Score =  133 bits (334), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 115/181 (63%), Gaps = 11/181 (6%)

Query: 160 NFDDAEGALQSDKKEKKV-VAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQE 218
           N DD +  L   K E+   V IPGTSI+LE+EEDIKKW++ERRKMWL++ISN +++H ++
Sbjct: 183 NKDDDDDELSIPKSEEGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEK 242

Query: 219 LGVEE---KEPTNAGAFQQVKKDKQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLL 275
           +G ++   K+ TN    ++ +KDK FI++IQ+QI+R NPN NL+ RL+QR MAEEN  LL
Sbjct: 243 MGYKDEDLKKETN--VLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLL 300

Query: 276 NFIQELGDAKXXXXXXXXXXKNVLFG---NTFKRNKPRADFNRKRPNFTRDGPSRYEGNT 332
           +FI ELG+            K  LFG   N F  N  R +++ +R N   +    Y G +
Sbjct: 301 DFIVELGECGFLEYELTEEEKEKLFGGYSNNFSNN--RKNYHGRRNNNNSNEKREYNGAS 358

Query: 333 K 333
           +
Sbjct: 359 R 359

>KLLA0E19437g complement(1721747..1722775) some similarities with
           sp|Q08932 Saccharomyces cerevisiae YPL193w RSA1
           nucleoplasmic protein involved in assembly of 60S
           ribosomal subunits singleton, hypothetical start
          Length = 342

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 101/160 (63%), Gaps = 1/160 (0%)

Query: 178 VAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKK 237
           + IPGTSI L++EEDI KW+EERRKMWL+KISN++E +R++  V++ E  N    Q+ +K
Sbjct: 181 LYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKD-EDLNRNPLQESRK 239

Query: 238 DKQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELGDAKXXXXXXXXXXKN 297
           ++ FIQ+IQNQ+ R N  PNL++ L QR + EEN  +L+FI+ELGDA           K 
Sbjct: 240 ERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANYLKYELTEEEKE 299

Query: 298 VLFGNTFKRNKPRADFNRKRPNFTRDGPSRYEGNTKKQQI 337
           VLFG    +N      NR+         ++Y  +++K+ I
Sbjct: 300 VLFGGKDHKNDQNRRSNRRYDRQLNQRDTQYRNHSRKRPI 339

>Sklu_2339.7 YLR423C, Contig c2339 14555-15796 reverse complement
          Length = 413

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 162 DDAEGALQSDKKEKKVVAIPGTSITLESEEDIKKWREERRKM--WLVKISNQREKHRQEL 219
           DD E  L   + ++ V  +   S+TLE+ + ++K  +E++K+   + KIS + EKH + +
Sbjct: 243 DDGELTLIMSELQEAVCEVD--SLTLETNDLLRKKEDEKQKLKSAMFKISTEFEKHEEYI 300

Query: 220 GVEEKEPTNAGAFQ--------QVKKDKQFI----QSIQNQINRVNPNPNLSLRL 262
            V +        F+        QVK+  QF     QS QN +  V    +++LR+
Sbjct: 301 SVFQGISDLIQTFKTSCKQDMHQVKELCQFYNKFKQSYQNLLKEVERRQDVALRM 355

>CAGL0F01529g 156044..158317 highly similar to sp|P25039
           Saccharomyces cerevisiae YLR069c MEF1, start by
           similarity
          Length = 757

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 15/82 (18%)

Query: 191 EDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKKDKQFIQSIQNQIN 250
           E++K   EE+R++ +  +++  E H  E+ +EEKEPT              IQ +++ I 
Sbjct: 265 EELKSLAEEKRQVLIETLADVDE-HMAEIFLEEKEPT--------------IQEMKDAIR 309

Query: 251 RVNPNPNLSLRLMQRTMAEENI 272
           R       +  LM   +A   +
Sbjct: 310 RATIARKFTPVLMGSALANTGV 331

>CAGL0F06611g 650449..653040 similar to sp|Q04748 Saccharomyces
           cerevisiae YMR066w SOV1, hypothetical start
          Length = 863

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 209 SNQREKHRQELGVEEKEPTNAGAFQQVKKDKQFIQSI 245
           S+ RE HRQ+LG++  +P     FQ+V   K   +++
Sbjct: 42  SSAREHHRQDLGLKFNDPLKKSGFQEVNTIKHLEETL 78

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.129    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,884,200
Number of extensions: 523629
Number of successful extensions: 1816
Number of sequences better than 10.0: 74
Number of HSP's gapped: 1794
Number of HSP's successfully gapped: 76
Length of query: 338
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 236
Effective length of database: 13,065,073
Effective search space: 3083357228
Effective search space used: 3083357228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)