Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2395835635115860.0
AFL072C3141633197e-34
KLLA0E19393g3361982426e-23
YGL081W3201291835e-15
Scas_720.14d1961111327e-09
Kwal_23.306145873691.5
YIL116W (HIS5)38549681.5
CAGL0F02431g78584645.2
AGL223C47844645.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23958
         (351 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23958                                                         615   0.0  
AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [...   127   7e-34
KLLA0E19393g 1720040..1721050 no similarity, hypothetical start        98   6e-23
YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containin...    75   5e-15
Scas_720.14d                                                           55   7e-09
Kwal_23.3061                                                           31   1.5  
YIL116W (HIS5) [2560] chr9 (142925..144082) Histidinol-phosphate...    31   1.5  
CAGL0F02431g 234061..236418 highly similar to sp|P39533 Saccharo...    29   5.2  
AGL223C [4089] [Homologous to ScYCR079W - SH] (278209..279645) [...    29   5.8  

>Kwal_56.23958
          Length = 356

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/351 (86%), Positives = 302/351 (86%)

Query: 1   MSTLDQSGCRKITFNIKETEGAGLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLC 60
           MSTLDQSGCRKITFNIKETEGAGLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLC
Sbjct: 1   MSTLDQSGCRKITFNIKETEGAGLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLC 60

Query: 61  IKRLIPSDDDPFVPLLCQFRISVQDLGSTHGLVDLQSQDSEASIIDLKNGERFGLIRLHH 120
           IKRLIPSDDDPFVPLLCQFRISVQDLGSTHGLVDLQSQDSEASIIDLKNGERFGLIRLHH
Sbjct: 61  IKRLIPSDDDPFVPLLCQFRISVQDLGSTHGLVDLQSQDSEASIIDLKNGERFGLIRLHH 120

Query: 121 PIAPGQSRGAKLKFQVLIKSNENEDDDGTLDLILRNVTHEDSPYVSRPATSADXXXXXXX 180
           PIAPGQSRGAKLKFQVLIKSNENEDDDGTLDLILRNVTHEDSPYVSRPATSAD       
Sbjct: 121 PIAPGQSRGAKLKFQVLIKSNENEDDDGTLDLILRNVTHEDSPYVSRPATSADLELETQL 180

Query: 181 XXXXXXXXXXXXMNYSEDLDLELDEKSGEPXXXXXXXXXXXXXXXXHTLFXXXXXXXXXX 240
                       MNYSEDLDLELDEKSGEP                HTLF          
Sbjct: 181 TSSSCSTSSSSEMNYSEDLDLELDEKSGEPVVCCSDSDDVAVQVSQHTLFVTQETTGVEE 240

Query: 241 XXXXGSDHGSARYKPFYAPHSDYMTETGQGSYDDANTLEGTPQCFDCSNTANSYNEDEME 300
               GSDHGSARYKPFYAPHSDYMTETGQGSYDDANTLEGTPQCFDCSNTANSYNEDEME
Sbjct: 241 EATVGSDHGSARYKPFYAPHSDYMTETGQGSYDDANTLEGTPQCFDCSNTANSYNEDEME 300

Query: 301 DCNIYSPIYTAAQFLDKKRVRERDNDEDSVAENEKRKKVKQEIEPKRQHLA 351
           DCNIYSPIYTAAQFLDKKRVRERDNDEDSVAENEKRKKVKQEIEPKRQHLA
Sbjct: 301 DCNIYSPIYTAAQFLDKKRVRERDNDEDSVAENEKRKKVKQEIEPKRQHLA 351

>AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [945
           bp, 314 aa]
          Length = 314

 Score =  127 bits (319), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 99/163 (60%), Gaps = 18/163 (11%)

Query: 10  RKITFNIKETEGAGLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLCIKRLI---- 65
           R++ FNI E    GL   IGRAS +D +R  R DN  + E+SLSK+HAML +KR      
Sbjct: 10  RRLIFNINE----GLAEVIGRASERDAERVARADNLFFAERSLSKQHAMLYVKRFTGPGG 65

Query: 66  PSDDDPFVPLLCQFRISVQDLGSTHGLVDLQSQDSEAS-IIDLKNGERFGLIRLHHPIAP 124
             D D         RI V+DLGSTHGLVDLQS     S +IDLKNGERFG++ +  PI  
Sbjct: 66  AQDGDE-----ENIRIWVEDLGSTHGLVDLQSTARGVSQLIDLKNGERFGVVYMDKPITS 120

Query: 125 GQSRGAKLKFQVLIKSNENEDDDGTLDLILRNVTHEDSPYVSR 167
            QSRGA+LKFQV    N  +      +L++R+VT  DSP +++
Sbjct: 121 TQSRGARLKFQV----NVMQKQGPLWELLVRDVTFGDSPCITK 159

>KLLA0E19393g 1720040..1721050 no similarity, hypothetical start
          Length = 336

 Score = 97.8 bits (242), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 103/198 (52%), Gaps = 10/198 (5%)

Query: 9   CRKITFNIKETEGAGLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLCIKRLIPSD 68
            R I FN       G++  IG+   +D  +     N ++ +  L  +HA L +K+L P++
Sbjct: 11  TRTIEFN----GSHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVKKLPPTN 66

Query: 69  DDPFVPL-LCQFRISVQDLGSTHGLVDLQSQDS--EASIIDLKNGERFGLIRLHHPIAPG 125
           D+  +P+ +  FRI ++ LG    +VDL+S DS  +  IIDLKNG+RFGL+RL  P++  
Sbjct: 67  DEESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLDEPVSVN 126

Query: 126 QSRGAKLKFQVLIKSNENEDDDGTLDLILRNVTHEDSPYVSRPATSADXXXXXXXXXXXX 185
           Q RGAKLKF + I+      +     ++L +VT + SP  SR +   D            
Sbjct: 127 QQRGAKLKFNLNIRPGAWPFN---YRIVLTDVTDQKSPCTSRSSDFLDSIMQHVSDESDS 183

Query: 186 XXXXXXXMNYSEDLDLEL 203
                   +++E++ +E+
Sbjct: 184 ENAWSKATDWNEEIKVEI 201

>YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containing a
           forkhead associated (FHA) domain, which bind
           phosphopeptides [963 bp, 320 aa]
          Length = 320

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 5/129 (3%)

Query: 10  RKITFNIKETEGA-GLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLCIKRLIPSD 68
           R   F I++TE   GL   IGR+S  D     +  N  + E  LS++HA+LCIK  IP  
Sbjct: 5   RTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKTPIPKI 64

Query: 69  DDPFVPLLCQFRISVQDLGSTHGLVDLQSQDSEASIIDLKNGERFGLIRL-HHPIAPGQS 127
           +   VP + Q RI ++DL +  G V+L S D     IDLKNG+ FGLI + +HP      
Sbjct: 65  EG--VPSIEQLRICIRDLNNKTGTVNLVS-DGPNDEIDLKNGDAFGLIAIDNHPFRDNHH 121

Query: 128 RGAKLKFQV 136
             AKL F++
Sbjct: 122 LAAKLIFRI 130

>Scas_720.14d
          Length = 196

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 60/111 (54%), Gaps = 16/111 (14%)

Query: 10  RKITFNIKETEGA---GLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLCIKRLIP 66
           R I F  KE E     G+  PIG   + DPQ +    N  +   +L KKHA L IK + P
Sbjct: 29  RNIYF--KEQEALREEGINIPIG---YGDPQIA----NLEFSNSALEKKHARLVIK-MFP 78

Query: 67  SDDDPFVPLLCQFRISVQDLGSTHGLVDLQSQD--SEASIIDLKNGERFGL 115
           S  +  +P+   FR  V+DL   +G+VDL S+   S  +I++LKNGE F +
Sbjct: 79  SVSNEGIPV-PNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVELKNGESFAI 128

>Kwal_23.3061
          Length = 458

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 92  LVDLQSQDSEASIIDLKNGERFGLIRLHHPIAPGQSRGAKLKFQVLIKSNENEDDDGTLD 151
           L D     + AS  ++K   R   ++ HHP   G S  +KLKFQ + K+ E   DD   +
Sbjct: 9   LYDTLGVAANASRQEIKKAYRLKALK-HHPDKNGHSEQSKLKFQQICKAYEILGDDKKRE 67

Query: 152 LILRNVTHEDSPY 164
           +  R  T +++ +
Sbjct: 68  MYDRFGTADETQW 80

>YIL116W (HIS5) [2560] chr9 (142925..144082) Histidinol-phosphate
           aminotransferase (imidazole acetol phosphate
           aminotransferase), eighth step in histidine biosynthesis
           pathway [1158 bp, 385 aa]
          Length = 385

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 98  QDSEASIIDLKNGERFGLIRLHHPIAPGQSRGAKLKFQVLIKSNENEDD 146
            D+EA +  LKN     LI+L    +PG   GAK+K  ++ K  +N D+
Sbjct: 150 MDTEAVLTILKNDS---LIKLMFVTSPGNPTGAKIKTSLIEKVLQNWDN 195

>CAGL0F02431g 234061..236418 highly similar to sp|P39533
           Saccharomyces cerevisiae YJL200c or sp|P19414
           Saccharomyces cerevisiae YLR304c, hypothetical start
          Length = 785

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 16/84 (19%)

Query: 48  HEKSLSKKHAMLCIKRLIPSDDDPFVPLLCQFRISVQDLGSTHGLVDLQSQD-SEASIID 106
           HE +L KK  ML +     +D D         RIS  D   T GL+DL +QD +    +D
Sbjct: 693 HETNL-KKQGMLPLTFADEADYD---------RISGGDTLETVGLIDLVAQDGNNGGFLD 742

Query: 107 LK----NGERFGLIRLHHPIAPGQ 126
           +K    NGE F +I+  H ++  Q
Sbjct: 743 VKVTKPNGESF-IIKTKHTLSKDQ 765

>AGL223C [4089] [Homologous to ScYCR079W - SH] (278209..279645)
           [1437 bp, 478 aa]
          Length = 478

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 92  LVDLQSQDSEASIIDLKNGERFGLIRLHHPIAPGQSRGAKLKFQ 135
           LV  Q  D++  + D KNG    L+R+HHP +P +S      FQ
Sbjct: 278 LVVTQVGDTKVVLCD-KNGIAHSLVRVHHPDSPRESDRLSGNFQ 320

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,064,754
Number of extensions: 469993
Number of successful extensions: 1499
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1489
Number of HSP's successfully gapped: 25
Length of query: 351
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 248
Effective length of database: 13,030,455
Effective search space: 3231552840
Effective search space used: 3231552840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)