Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2348658757929960.0
Sklu_1838.358958326620.0
YER165W (PAB1)57758323060.0
AGR122C58557622670.0
CAGL0L11792g57957622390.0
Scas_576.757557622110.0
KLLA0C17600g59259720920.0
YFR023W (PES4)6113923871e-39
Sklu_1706.16722963482e-34
AEL016C6782963234e-31
Kwal_0.3705602933133e-30
YHR015W (MIP6)6593182951e-27
Scas_607.106052942941e-27
KLLA0A08338g7661992772e-25
CAGL0I08943g6022992734e-25
Scas_697.106104322254e-19
CAGL0H10604g4161892136e-18
YNL016W (PUB1)4531612092e-17
Scas_671.44431752083e-17
Kwal_27.114474391792031e-16
KLLA0C11495g4451831994e-16
KLLA0E08745g4751851951e-15
AGR390C3781721932e-15
CAGL0E03245g4251791932e-15
Scas_621.104151741861e-14
AFR107W3961811852e-14
Kwal_55.219605971731828e-14
CAGL0E01947g4521781801e-13
YGR159C (NSR1)4141731791e-13
CAGL0M03795g5132701782e-13
AEL217W8342161792e-13
Sklu_1879.44211731772e-13
KLLA0C12925g5701811746e-13
Scas_598.15161771737e-13
ADL160W5261351738e-13
Sklu_2085.22091191649e-13
Scas_637.23772991691e-12
YOL123W (HRP1)5341781711e-12
ADR307W5663181693e-12
Scas_558.14352431664e-12
Scas_635.75811751675e-12
Sklu_2307.26971911659e-12
Kwal_56.247098282471651e-11
AGL250W7291971586e-11
Sklu_905.15152091551e-10
Kwal_23.39858762001552e-10
AAL018W3371791502e-10
Scas_645.147172221533e-10
ABL059W2041181453e-10
Kwal_55.201545223351513e-10
Scas_665.42191701436e-10
Kwal_27.123372091261428e-10
KLLA0D11792g6852011489e-10
KLLA0C14388g2031211392e-09
ADR035C8384181472e-09
YPL043W (NOP4)6853161462e-09
YCL011C (GBP2)4273101442e-09
CAGL0I09900g2111671383e-09
KLLA0E11011g4321911433e-09
YOR319W (HSH49)2131681374e-09
CAGL0H02123g5553421415e-09
CAGL0B04807g4192991398e-09
YGR250C7812221409e-09
CAGL0B04169g8611721382e-08
CAGL0L12672g6823171372e-08
Scas_376.14042111353e-08
CAGL0J11154g3801591343e-08
ABL134C3752041343e-08
Scas_705.22869931346e-08
Scas_157.12321761286e-08
Kwal_27.118326861941311e-07
Sklu_2442.114643021301e-07
KLLA0D14949g8781741311e-07
KLLA0A05346g8743171292e-07
CAGL0H03861g4432051273e-07
KLLA0C08019g301581243e-07
Sklu_2257.4188941204e-07
ADR183C320851235e-07
YNL175C (NOP13)4031701237e-07
CAGL0F08217g6784021248e-07
Kwal_55.20972135831141e-06
AAR151W481771211e-06
ADL063W320991201e-06
Sklu_1715.13961711211e-06
YNL004W (HRB1)4293211211e-06
Sklu_1790.3473841212e-06
YIR005W (IST3)1481181132e-06
Kwal_33.144633931591202e-06
Kwal_0.2502161181152e-06
KLLA0D05016g2621341163e-06
Sklu_2353.5252731163e-06
KLLA0F18216g7083161184e-06
Kwal_14.1851535771175e-06
YPR112C (MRD1)8871691176e-06
CAGL0K06655g802771176e-06
YOL041C (NOP12)459681166e-06
KLLA0C05522g540921167e-06
KLLA0F07799g524871157e-06
Scas_88.1256641129e-06
YMR268C (PRP24)4443001149e-06
Scas_701.33211111112e-05
CAGL0J01914g169741072e-05
Kwal_47.18572363751112e-05
Kwal_26.7179456771112e-05
Scas_717.41379861103e-05
YBR212W (NGR1)672771113e-05
Scas_709.2*171611044e-05
KLLA0B00979g3421221075e-05
ADR017W173721035e-05
YHR086W (NAM8)5232121086e-05
KLLA0F14861g5891731077e-05
Sklu_2182.33711671067e-05
Kwal_27.103644432151078e-05
YDR432W (NPL3)414751068e-05
CAGL0D06182g280911058e-05
AFL050W218831038e-05
KLLA0D08206g391761068e-05
CAGL0H04763g3831131068e-05
Kwal_23.5864278851041e-04
YNL110C (NOP15)2201161021e-04
CAGL0M12573g299531031e-04
AFR649W310761031e-04
Sklu_2375.5207831011e-04
KLLA0D13420g16674991e-04
CAGL0L03806g255831022e-04
CAGL0F01023g396661032e-04
CAGL0H02211g3811981032e-04
AGR010C266781012e-04
YIR001C (SGN1)2501071003e-04
Scas_666.11224127993e-04
Scas_621.163141111013e-04
KLLA0F09383g258751003e-04
Kwal_26.752226264985e-04
Sklu_2213.425771976e-04
Sklu_2060.311099900.001
ACR274W42676970.001
Scas_643.16448104970.001
YGL044C (RNA15)29664950.001
ADR001C32497950.002
YIL061C (SNP1)300105940.002
KLLA0B10472g19871900.003
Scas_316.1483159930.004
Scas_714.5923360900.004
CAGL0D05236g443109920.005
Kwal_33.15208186110890.005
Scas_720.224583900.005
Scas_570.1411379850.006
Kwal_27.1109620179880.007
YDR429C (TIF35)27460890.008
AGL038C71279900.008
KLLA0E00484g24289880.008
Scas_582.1028382890.008
Kwal_33.1349633072890.008
Scas_530.468486900.009
CAGL0E03630g74677900.009
Kwal_26.845821979870.009
KLLA0D13772g34590890.009
KLLA0E19118g652196890.010
AFL224W20674860.012
YFR032C289137870.014
ADR399C73670880.017
YPL178W (CBC2)20868850.017
CAGL0J02200g14489820.020
Kwal_55.20903147128820.020
CAGL0C01529g23675850.021
Kwal_55.2103911987810.021
CAGL0G05511g67463860.025
AER285C426193850.028
Kwal_55.2041428489820.061
Kwal_55.22147468120820.062
Sklu_1984.328460810.066
YHL024W (RIM4)71379830.067
YBL051C (PIN4)66838820.071
ACL149W628120820.082
Scas_565.832290800.095
Sklu_2221.828158800.099
CAGL0H03267g77575810.11
Kwal_56.24638527122800.11
AER349C21866790.11
Sklu_2434.1473683810.12
KLLA0B11594g11484750.13
YDL167C (NRP1)719147800.15
Kwal_30.1289028056780.16
Sklu_2063.4600115790.18
Kwal_55.2071859448790.19
Sklu_2249.430979780.19
Scas_241.118698760.20
ADL126C46694780.24
KLLA0B14432g17381740.30
AAR022W11480700.50
Scas_710.31*16254720.53
CAGL0A04213g63972740.62
CAGL0H04675g27461730.71
KLLA0B00847g26959730.73
Sklu_1192.1280147730.74
KLLA0A09097g80564740.80
YNL286W (CUS2)28586720.87
Kwal_26.682473989721.1
Kwal_27.1115856764721.2
Kwal_23.459766461721.3
CAGL0C01419g63996711.5
Scas_677.962661711.6
Scas_537.5570115711.7
CAGL0I05082g60436701.9
Scas_500.6621120702.1
CAGL0J07546g789108702.1
ADR189W26959673.5
Sklu_2412.499661683.6
Kwal_33.1481057474683.8
KLLA0D12364g63126683.8
CAGL0L09889g71750674.5
KLLA0E19943g59274674.6
AFL061C52350674.7
KLLA0F23650g31290664.8
ACR235W57874674.9
Scas_589.4530120675.0
KLLA0B08976g30577665.2
KLLA0E01936g484116665.9
CAGL0I03344g603117666.2
YGR178C (PBP1)72284657.6
Kwal_23.520429452648.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23486
         (579 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23486                                                        1158   0.0  
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement       1030   0.0  
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...   892   0.0  
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...   877   0.0  
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...   867   0.0  
Scas_576.7                                                            856   0.0  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...   810   0.0  
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...   153   1e-39
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                           138   2e-34
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...   129   4e-31
Kwal_0.370                                                            125   3e-30
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...   118   1e-27
Scas_607.10                                                           117   1e-27
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...   111   2e-25
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...   109   4e-25
Scas_697.10                                                            91   4e-19
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    87   6e-18
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    85   2e-17
Scas_671.4                                                             85   3e-17
Kwal_27.11447                                                          83   1e-16
KLLA0C11495g complement(990832..992169) some similarities with s...    81   4e-16
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    80   1e-15
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    79   2e-15
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    79   2e-15
Scas_621.10                                                            76   1e-14
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    76   2e-14
Kwal_55.21960                                                          75   8e-14
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    74   1e-13
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    74   1e-13
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    73   2e-13
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    74   2e-13
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         73   2e-13
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    72   6e-13
Scas_598.1                                                             71   7e-13
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    71   8e-13
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            68   9e-13
Scas_637.2                                                             70   1e-12
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    70   1e-12
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    70   3e-12
Scas_558.1                                                             69   4e-12
Scas_635.7                                                             69   5e-12
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         68   9e-12
Kwal_56.24709                                                          68   1e-11
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    65   6e-11
Sklu_905.1 YMR268C, Contig c905 196-1743                               64   1e-10
Kwal_23.3985                                                           64   2e-10
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    62   2e-10
Scas_645.14                                                            64   3e-10
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    60   3e-10
Kwal_55.20154                                                          63   3e-10
Scas_665.4                                                             60   6e-10
Kwal_27.12337                                                          59   8e-10
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    62   9e-10
KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181 S...    58   2e-09
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...    61   2e-09
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    61   2e-09
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    60   2e-09
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    58   3e-09
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    60   3e-09
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    57   4e-09
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    59   5e-09
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    58   8e-09
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    59   9e-09
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    58   2e-08
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    57   2e-08
Scas_376.1                                                             57   3e-08
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    56   3e-08
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    56   3e-08
Scas_705.22                                                            56   6e-08
Scas_157.1                                                             54   6e-08
Kwal_27.11832                                                          55   1e-07
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      55   1e-07
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...    55   1e-07
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    54   2e-07
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    54   3e-07
KLLA0C08019g complement(704199..705104) some similarities with s...    52   3e-07
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         51   4e-07
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    52   5e-07
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    52   7e-07
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    52   8e-07
Kwal_55.20972                                                          49   1e-06
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    51   1e-06
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    51   1e-06
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          51   1e-06
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    51   1e-06
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            51   2e-06
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    48   2e-06
Kwal_33.14463                                                          51   2e-06
Kwal_0.250                                                             49   2e-06
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    49   3e-06
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          49   3e-06
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    50   4e-06
Kwal_14.1851                                                           50   5e-06
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...    50   6e-06
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    50   6e-06
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    49   6e-06
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    49   7e-06
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    49   7e-06
Scas_88.1                                                              48   9e-06
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    49   9e-06
Scas_701.3                                                             47   2e-05
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    46   2e-05
Kwal_47.18572                                                          47   2e-05
Kwal_26.7179                                                           47   2e-05
Scas_717.41                                                            47   3e-05
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    47   3e-05
Scas_709.2*                                                            45   4e-05
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    46   5e-05
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    44   5e-05
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    46   6e-05
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    46   7e-05
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            45   7e-05
Kwal_27.10364                                                          46   8e-05
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    45   8e-05
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    45   8e-05
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    44   8e-05
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    45   8e-05
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    45   8e-05
Kwal_23.5864                                                           45   1e-04
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    44   1e-04
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    44   1e-04
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    44   1e-04
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       44   1e-04
KLLA0D13420g complement(1157491..1157991) some similarities with...    43   1e-04
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    44   2e-04
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    44   2e-04
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    44   2e-04
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    44   2e-04
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    43   3e-04
Scas_666.11                                                            43   3e-04
Scas_621.16                                                            44   3e-04
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    43   3e-04
Kwal_26.7522                                                           42   5e-04
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         42   6e-04
Sklu_2060.3 YIR009W, Contig c2060 4599-4931                            39   0.001
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    42   0.001
Scas_643.16                                                            42   0.001
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    41   0.001
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    41   0.002
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    41   0.002
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    39   0.003
Scas_316.1                                                             40   0.004
Scas_714.59                                                            39   0.004
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    40   0.005
Kwal_33.15208                                                          39   0.005
Scas_720.2                                                             39   0.005
Scas_570.14                                                            37   0.006
Kwal_27.11096                                                          39   0.007
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    39   0.008
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    39   0.008
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    39   0.008
Scas_582.10                                                            39   0.008
Kwal_33.13496                                                          39   0.008
Scas_530.4                                                             39   0.009
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    39   0.009
Kwal_26.8458                                                           38   0.009
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    39   0.009
KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925 S...    39   0.010
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    38   0.012
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    38   0.014
ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH] (1420640..1...    39   0.017
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    37   0.017
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    36   0.020
Kwal_55.20903                                                          36   0.020
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    37   0.021
Kwal_55.21039                                                          36   0.021
CAGL0G05511g complement(522026..524050) similar to sp|P34761 Sac...    38   0.025
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    37   0.028
Kwal_55.20414                                                          36   0.061
Kwal_55.22147                                                          36   0.062
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         36   0.066
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    37   0.067
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    36   0.071
ACL149W [900] [Homologous to ScYDL167C (NRP1) - SH] complement(8...    36   0.082
Scas_565.8                                                             35   0.095
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       35   0.099
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    36   0.11 
Kwal_56.24638                                                          35   0.11 
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    35   0.11 
Sklu_2434.14 YOR361C, Contig c2434 32150-34360                         36   0.12 
KLLA0B11594g complement(1018044..1018388) some similarities with...    33   0.13 
YDL167C (NRP1) [704] chr4 complement(160996..163155) Asparagine-...    35   0.15 
Kwal_30.12890                                                          35   0.16 
Sklu_2063.4 YDL167C, Contig c2063 1979-3781                            35   0.18 
Kwal_55.20718                                                          35   0.19 
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         35   0.19 
Scas_241.1                                                             34   0.20 
ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391) [...    35   0.24 
KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036 Saccha...    33   0.30 
AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH] complement(3...    32   0.50 
Scas_710.31*                                                           32   0.53 
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    33   0.62 
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    33   0.71 
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    33   0.73 
Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement          33   0.74 
KLLA0A09097g 794827..797244 some similarities with sp|P25339 Sac...    33   0.80 
YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRN...    32   0.87 
Kwal_26.6824                                                           32   1.1  
Kwal_27.11158                                                          32   1.2  
Kwal_23.4597                                                           32   1.3  
CAGL0C01419g complement(153063..154982) similar to sp|Q08925 Sac...    32   1.5  
Scas_677.9                                                             32   1.6  
Scas_537.5                                                             32   1.7  
CAGL0I05082g complement(473462..475276) some similarities with s...    32   1.9  
Scas_500.6                                                             32   2.1  
CAGL0J07546g complement(731562..733931) similar to sp|P13134 Sac...    32   2.1  
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    30   3.5  
Sklu_2412.4 YMR124W, Contig c2412 7729-10719                           31   3.6  
Kwal_33.14810                                                          31   3.8  
KLLA0D12364g complement(1051765..1053660) some similarities with...    31   3.8  
CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...    30   4.5  
KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217 Saccha...    30   4.6  
AFL061C [3132] [Homologous to ScYPL184C - SH] (317447..319018) [...    30   4.7  
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    30   4.8  
ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH] complement(...    30   4.9  
Scas_589.4                                                             30   5.0  
KLLA0B08976g complement(786122..787039) weakly similar to sp|P32...    30   5.2  
KLLA0E01936g 183638..185092 similar to sp|Q08287 Saccharomyces c...    30   5.9  
CAGL0I03344g complement(285637..287448) similar to sp|P32770 Sac...    30   6.2  
YGR178C (PBP1) [2130] chr7 complement(851050..853218) Protein th...    30   7.6  
Kwal_23.5204                                                           29   8.3  

>Kwal_56.23486
          Length = 587

 Score = 1158 bits (2996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/579 (96%), Positives = 561/579 (96%)

Query: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60
           MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF
Sbjct: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120

Query: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXX 180
           SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHF     
Sbjct: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEA 180

Query: 181 XXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240
               IDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL
Sbjct: 181 AKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240

Query: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY
Sbjct: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300

Query: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360
           ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA
Sbjct: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360

Query: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420
           GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR
Sbjct: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420

Query: 421 YQQXXXXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFGR 480
           YQQ         GMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFGR
Sbjct: 421 YQQATAAAAAAAGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFGR 480

Query: 481 PNGPMYGVPPQGPQGAFPRNGNQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITGMILD 540
           PNGPMYGVPPQGPQGAFPRNGNQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITGMILD
Sbjct: 481 PNGPMYGVPPQGPQGAFPRNGNQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITGMILD 540

Query: 541 LPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQDAQAQ 579
           LPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQDAQAQ
Sbjct: 541 LPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQDAQAQ 579

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/583 (85%), Positives = 533/583 (91%), Gaps = 4/583 (0%)

Query: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60
           MSDVTDKTAEQLEQL+I D+Q T PTST+SE+ K + SSASLYVGELDP+VTEALLYDLF
Sbjct: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAITKTSLGYAYVNFHDH+AG TAI+KLNYT IKGRPCRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120

Query: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXX 180
           SLRKKGSGN+FIKNLHPAIDNKALHDTFSVFGNILSCKIATDE G S+ FGFVHF     
Sbjct: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180

Query: 181 XXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240
               +DAINGMLLNG EVYVAPHVSKKDRQSKL+E KSNFTN+YVKNID ET Q+EFE L
Sbjct: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240

Query: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           F+Q+G ITSAVLE D+EGK RGFGF+NFEDH +AAKAV+ELNDTDF  Q+LYVGRAQKKY
Sbjct: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300

Query: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360
           ERLQEL+KQYE SR+EKLAKYQGVNLFVKNLDDSIDDEKL++EFAPFG ITS KVMRDDA
Sbjct: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360

Query: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420
           G+SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQARNQMR
Sbjct: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420

Query: 421 YQQXX-XXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGV-PPQQF 478
           YQQ          GMPGQFM PMFYGVMPPRGVPFNGPNPQQMAAM GMPKNGV PPQQF
Sbjct: 421 YQQVTAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480

Query: 479 GRPNGPMYGVPPQG-PQGAFPRN-GNQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITG 536
           GRPNGPMYGVPPQG PQG FPRN GNQF+HQKQRQALGEQLYK+VSAKTQDEEAAGKITG
Sbjct: 481 GRPNGPMYGVPPQGAPQGGFPRNGGNQFYHQKQRQALGEQLYKKVSAKTQDEEAAGKITG 540

Query: 537 MILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQDAQAQ 579
           MILDLPPQEVVPLLEND+LF+QHFKEAFAAY+SFKKDQ+AQ+Q
Sbjct: 541 MILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKDQEAQSQ 583

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/583 (74%), Positives = 496/583 (85%), Gaps = 12/583 (2%)

Query: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60
           M+D+TDKTAEQLE L IQD+Q    T ++S+S   E SSASLYVG+L+PSV+EA LYD+F
Sbjct: 1   MADITDKTAEQLENLNIQDDQKQAATGSESQSV--ENSSASLYVGDLEPSVSEAHLYDIF 58

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAITKTSLGYAYVNF+DH AG  AIE+LNYTPIKGR CRIMWSQRDP
Sbjct: 59  SPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDP 118

Query: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXX 180
           SLRKKGSGN+FIKNLHP IDNKAL+DTFSVFG+ILS KIATDE GKS+ FGFVHF     
Sbjct: 119 SLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGA 178

Query: 181 XXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240
               IDA+NGMLLNG E+YVAPH+S+K+R S+L+E K+++TN+YVKNI+ ET  ++F++L
Sbjct: 179 AKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEL 238

Query: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           F+++G I SA LE D +GKL+GFGFVN+E H  A KAVE LND++ NG+KLYVGRAQKK 
Sbjct: 239 FAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKN 298

Query: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360
           ER+  LKKQYE+ R+EK+AKYQGVNLFVKNLDDS+DDEKL+EEFAP+GTITS KVMR + 
Sbjct: 299 ERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTEN 358

Query: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQARNQMR
Sbjct: 359 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 418

Query: 421 YQQ-XXXXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFG 479
           YQQ          GMPGQFM PMFYGVMPPRGVPFNGPNPQQM  M GMPKNG+PPQ   
Sbjct: 419 YQQATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNGMPPQ--- 475

Query: 480 RPNGPMYGVPPQGPQGAFPRNG---NQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITG 536
             NGP+YGVP   PQG FPRN    NQF+ QKQRQALGEQLYK+VSAKT +EEAAGKITG
Sbjct: 476 FRNGPVYGVP---PQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITG 532

Query: 537 MILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQDAQAQ 579
           MILDLPPQEV PLLE+DELF+QH+KEA AAY+SFKK+Q+ Q +
Sbjct: 533 MILDLPPQEVFPLLESDELFEQHYKEASAAYESFKKEQEQQTE 575

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/576 (77%), Positives = 498/576 (86%), Gaps = 15/576 (2%)

Query: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60
           MSD+TDKTAEQLEQL+I+++  T PT+T+SE+ K E S ASLYVGEL+P+V+EALLYD+F
Sbjct: 1   MSDITDKTAEQLEQLKIEEQ--TAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIF 58

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120
           SPIGSVSSIRVCRDAIT TSLGYAYVNFHDH AG  AIE+LNYT IKG+PCRIMWSQRDP
Sbjct: 59  SPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDP 118

Query: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXX 180
           SLRKKGSGN++IKNLHPAIDNK+LH+TFS FGNILSCK+ATDE G SR FGFVHF     
Sbjct: 119 SLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESD 178

Query: 181 XXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240
               I+A++GML+N  EVYVA HVSKKDRQSKL+EVK+ FTNVYVKNID ET Q+EFE+L
Sbjct: 179 ARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238

Query: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           F +YG ITSAVLE D+EGKLRGFGFVNFEDH AAAKAV+ELN+ +F GQKLYVGRAQKKY
Sbjct: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY 298

Query: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360
           ERLQELKKQYE++R+EKLAKYQGVNLFVKNLDDSIDDEKL+EEFAPFGTITS KVMRD+ 
Sbjct: 299 ERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDET 358

Query: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420
           G+S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRR+QLAQQIQARNQMR
Sbjct: 359 GNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMR 418

Query: 421 YQQ-XXXXXXXXXGMPGQFM-QPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNG-VPPQQ 477
           +Q           G+PGQFM  PM+YG +PPR VPF GPNPQ    M GMPKNG +PPQQ
Sbjct: 419 FQHANAAAAAAVAGLPGQFMPPPMYYGGIPPR-VPFQGPNPQ----MAGMPKNGAMPPQQ 473

Query: 478 FGRPNGPMYGVPPQGPQGAFPRNG--NQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKIT 535
           FGRP GPMYG     PQG FPRNG   QF+ QKQRQALGEQLY++V AKTQD+EAAGKIT
Sbjct: 474 FGRP-GPMYG--GFAPQGQFPRNGQQQQFYQQKQRQALGEQLYQKVFAKTQDDEAAGKIT 530

Query: 536 GMILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFK 571
           GMILDLPPQ+V+ LLENDEL +QHF+EA AAY  FK
Sbjct: 531 GMILDLPPQQVIQLLENDELLEQHFQEAHAAYQKFK 566

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/576 (73%), Positives = 483/576 (83%), Gaps = 16/576 (2%)

Query: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60
           M+D+T+KTAEQLE L +QD+Q        +E  + E  SASLYVG+LDPSV+EA LYD+F
Sbjct: 1   MADITEKTAEQLENLSLQDKQ-----EGTNEENQSETVSASLYVGDLDPSVSEAHLYDIF 55

Query: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120
           SPIG+VSSIRVCRDAITKTSLGYAYVNF+DH+A  TAIEKLN+TPIKG+ CRIMWSQRDP
Sbjct: 56  SPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDP 115

Query: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXX 180
           SLRKKG+GN+FIKNLHP IDNKAL+DTFSVFGNILS K+ATDETGKS+ FG+VHF     
Sbjct: 116 SLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDES 175

Query: 181 XXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240
               IDA+NGMLLNG E+YV PH+SKK+R+SK +E+K+NFTNVY+KNI+ ET   EFE+L
Sbjct: 176 ASEAIDALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEEL 235

Query: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
            +++G   S VLE   EG+ +GFGFVNF +H  A K VEELN+T+F GQ LYV RAQKKY
Sbjct: 236 VAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKY 295

Query: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360
           ER QELKKQYE++RMEK+AKYQG+NLF+KNLDDSIDD+KL+EEFAP+GTITS KVM  + 
Sbjct: 296 ERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTEN 355

Query: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420
           G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQARNQMR
Sbjct: 356 GKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 415

Query: 421 YQQ--XXXXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQF 478
           +QQ           GMPGQFM PMFYGVMPPRGVPFNGPNP QMA M  MPKNG+PP QF
Sbjct: 416 FQQASAAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNP-QMANMGAMPKNGMPPHQF 474

Query: 479 GRPNGPMYGVPPQGPQGAFPRNG---NQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKIT 535
              NGP+YGVP   PQG F RNG   NQF+ QKQRQALGE+LYKR+ ++T DEEAAGKIT
Sbjct: 475 R--NGPVYGVP---PQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKIT 529

Query: 536 GMILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFK 571
           GMILDLPPQEVVPLLENDELF+QHFKEA AAY+SFK
Sbjct: 530 GMILDLPPQEVVPLLENDELFEQHFKEASAAYESFK 565

>Scas_576.7
          Length = 575

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/576 (74%), Positives = 482/576 (83%), Gaps = 25/576 (4%)

Query: 1   MSDVTDKTAEQLEQLRIQD--EQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYD 58
           MSD+T+KT EQLE L+I +  +QP       S +T  E S ASLYVGELDP+V+EALLYD
Sbjct: 1   MSDITEKTVEQLENLKISESEDQP-------STTTSTETSPASLYVGELDPTVSEALLYD 53

Query: 59  LFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118
           +FSPIGSVSSIRVCRDA+TKTSLGYAYVNF+DH AG  AIE+LNYTPIKGR CRIMWSQR
Sbjct: 54  IFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQR 113

Query: 119 DPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXX 178
           DP+LRKKGSGN+FIKNLHP IDNKAL +TFSVFGNILS KIATDETGKS+ FGFVHF   
Sbjct: 114 DPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHE 173

Query: 179 XXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFE 238
                 IDA+NGMLLNG E+YVAPH+++K+R S+L+E K++FTNVYVKNI+ ET  +EF 
Sbjct: 174 SSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFN 233

Query: 239 KLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQK 298
           +LF++YG + S+ LE   +GKL+GFGFV+FE H  AAKAVEELN T+F  Q L+V RAQK
Sbjct: 234 ELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQK 293

Query: 299 KYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD 358
           KYER+QELKKQYE+SR+EK+AKYQGVNLFVKNLDDSIDDEKL+EEFAP+GTITSV+VMR 
Sbjct: 294 KYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRT 353

Query: 359 DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQ 418
           D G SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRRSQLAQQIQAR Q
Sbjct: 354 DNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQ 413

Query: 419 MRYQQ-XXXXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQ 477
           MRYQQ          G+PGQFM PMFYGVMPPRGVPFNGPNPQQM        NGVPPQQ
Sbjct: 414 MRYQQATAAAAAAAAGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM--------NGVPPQQ 465

Query: 478 FGRPNGPMYGVPPQGPQGAFPRNG--NQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKIT 535
           F   NGP YG+P   PQG FPRNG  NQF+ + QRQALGE+LYK+VSAK  DEEAAGKIT
Sbjct: 466 FR--NGPGYGMP---PQGGFPRNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKIT 520

Query: 536 GMILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFK 571
           GMILDLPPQEVV LLENDELF+QHFKEA AAY+SFK
Sbjct: 521 GMILDLPPQEVVSLLENDELFEQHFKEASAAYESFK 556

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/597 (69%), Positives = 479/597 (80%), Gaps = 24/597 (4%)

Query: 1   MSDVTDKTAEQLEQLRIQDEQ----------PTGPTSTDSESTKGEASSASLYVGELDPS 50
           MSD+T+KTAEQLE L+I D+Q           +   S  S  +K E ++ASLYVGELDP+
Sbjct: 1   MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLYVGELDPN 60

Query: 51  VTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRP 110
           +TEALLYD+FSP+G +SSIRVCRDA+TK SLGYAYVN+ D+ AG  AI++LNY  I GRP
Sbjct: 61  ITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQELNYAEINGRP 120

Query: 111 CRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKF 170
           CRIMWS+RDP++RKKGSGN+FIKNLHPAIDNKALH+TFS FG +LSCK+A DE G SR F
Sbjct: 121 CRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGF 180

Query: 171 GFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDP 230
           GFVHF         I+A+NGML+NGLEVYVA HV KKDR SKL+E K+NFTN+YVKNID 
Sbjct: 181 GFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDV 240

Query: 231 ETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQK 290
           ET  +EFE+LFSQYG I SA LE D EGK +GFGFVNF DHNAAAKAVEELN  +F  Q 
Sbjct: 241 ETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQA 300

Query: 291 LYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTI 350
           LYVGRAQKKYER +ELKKQYE  R+EKLAK+QGVNLF+KNLDDSIDDEKL+EEFAP+GTI
Sbjct: 301 LYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTI 360

Query: 351 TSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLA 410
           TS +VMRD  G+SKGFGFVCFS+PEEATKA+TEKNQQIVAGKPLYVAIAQRK+VRRSQLA
Sbjct: 361 TSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRRSQLA 420

Query: 411 QQIQARNQMRY--QQXXXXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMN-G 467
           QQIQARNQ+R+  QQ         GMPGQ+M  MFYGVM PRG P  GPNP     M  G
Sbjct: 421 QQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFP--GPNPGMNGPMGAG 478

Query: 468 MPKNGV--PPQQF-GRPNGPMY-GVPPQGPQGAFPRN--GNQFFHQKQRQALGEQLYKRV 521
           +PKNG+  PPQQF GRPNGPMY G+P   PQ  FPR+   +    QKQRQALGEQLYK+V
Sbjct: 479 IPKNGMVPPPQQFAGRPNGPMYQGMP---PQNQFPRHQQQHYIQQQKQRQALGEQLYKKV 535

Query: 522 SAKTQDEEAAGKITGMILDLPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQDAQA 578
           SAK  DE AAGKITGMILDLPPQ+V+ LL+NDE F+Q F+EA AAY++FKK+Q+AQA
Sbjct: 536 SAKIDDENAAGKITGMILDLPPQQVIQLLDNDEQFEQQFQEALAAYENFKKEQEAQA 592

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score =  153 bits (387), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 186/392 (47%), Gaps = 65/392 (16%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           L++G+L  +VTE  L  +F    S  S +VC D++TK SLG+ Y+NF D      A+E+L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNL---HPAIDNKALHDTFSVFGNILSCK 158
           NYT + G+  RIM S R+ + RK    NVF  NL   +P +  +  +DTFS +G ILSCK
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCK 212

Query: 159 IATDETGKSRK-FGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDR-------- 209
           +       SRK  GFV+F         I   N     G ++    H  K+ R        
Sbjct: 213 L------DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQ 266

Query: 210 QSKLD---------------------EVKSNFT----NVYVKNIDPETKQDEFEKLFSQY 244
           +S+LD                     E K+ ++    ++++KN+   T +D+    FS+ 
Sbjct: 267 KSRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEV 326

Query: 245 GAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQ 304
           G I S  L    + K   + FV +++ + + KA++  N+  F G+KL V RAQ K ER +
Sbjct: 327 GPIKSIYLSNATKVKYL-WAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAK 385

Query: 305 ELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKL-----QEEFAPFGTITSVKVMRDD 359
            ++ Q  S+            LF++NL    + E L     QE   PF     +++   D
Sbjct: 386 FIESQKIST------------LFLENLSAVCNKEFLKYLCHQENIRPF----KIQIDGYD 429

Query: 360 AGSSKGFGFVCFSTPEEATKAITEKNQQIVAG 391
             SS   GF+ F   E+AT+     N ++V G
Sbjct: 430 ENSSTYSGFIKFRNFEDATRIFNFLNNRLVGG 461

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 80/187 (42%), Gaps = 25/187 (13%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEEL 281
           +++ ++     ++  + +F +Y +  SA +  D+   K  G G++NFED   A KA+EEL
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 282 NDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNL---DDSIDDE 338
           N T  NG+++ +                  S R     K  G N+F  NL   +  +   
Sbjct: 153 NYTKVNGKEIRI----------------MPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTR 196

Query: 339 KLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
              + F+ +G I S K+      S K  GFV F   + A   I   N     GK +   I
Sbjct: 197 VFYDTFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGI 251

Query: 399 AQRKEVR 405
              KEVR
Sbjct: 252 HFDKEVR 258

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 54/115 (46%), Gaps = 1/115 (0%)

Query: 300 YERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD 359
           + R+   K  +++ +++     + V LF+ +L +++ +E L+  F  + +  S KV  D 
Sbjct: 67  FLRINNNKSGHKNGKLKSFESKKLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDS 126

Query: 360 AG-SSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQI 413
               S G G++ F   EEA KA+ E N   V GK + +  + R    R      +
Sbjct: 127 VTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNV 181

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 142/296 (47%), Gaps = 40/296 (13%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            +L++G+LD  VTE +L D F+   S+ S+++C DAI+K SLGY Y+NF +      A E
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 100 KLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNL---HPAIDNKALHDTFSVFGNILS 156
           + NY P+ G+  RIM S R+   RK    NVF  NL   + ++  +A +DTF  +G ILS
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILS 221

Query: 157 CKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSK--------KD 208
           CK+      + +  GF++F         ID  NG    G  +    H  +        + 
Sbjct: 222 CKL-----DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEK 276

Query: 209 RQSKLDE---VKSNFTN--------------------VYVKNIDPETKQDEFEKLFSQYG 245
           R+SKLD    +K                         ++VKN+     +D+    FS+ G
Sbjct: 277 RKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRIG 336

Query: 246 AITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYE 301
            + S V  +        + FV ++  +  ++A+E+LN   F  +K+ V RAQK ++
Sbjct: 337 PVKS-VFTSKVPKYNSSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKNFQ 391

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 134/294 (45%), Gaps = 31/294 (10%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGK-SRKFGFVHFXXXXXXXXXIDAI 188
           +FI +L   +  K L DTF+ + +++S KI  D   K S  +G+++F          +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 189 NGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAIT 248
           N + L G EV + P +     +  +      F+N+ ++N+   T+   F   F +YG I 
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIG-TNVFFSNLPLENLSLTTRA--FYDTFKKYGKIL 220

Query: 249 SAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVG----RAQKKYERLQ 304
           S  L+     + +  GF+ F+   +A  A+++ N  ++ G  +  G    R  +K    +
Sbjct: 221 SCKLD-----RRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFE 275

Query: 305 ELKKQYESSRM--EKLA-----KYQGVN----------LFVKNLDDSIDDEKLQEEFAPF 347
           + K + +   +  EKL      + Q V           +FVKNL  + +++ + + F+  
Sbjct: 276 KRKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRI 335

Query: 348 GTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
           G + SV   +    +S  + FV +    + ++AI + N +I   + + VA AQ+
Sbjct: 336 GPVKSVFTSKVPKYNS-SWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQK 388

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 85/207 (41%), Gaps = 32/207 (15%)

Query: 212 KLDEVKSNF-------TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLR-GF 263
           KLD++K +          +++ ++D    +      F++Y ++ S  +  D   K   G+
Sbjct: 86  KLDKLKDSLYLSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGY 145

Query: 264 GFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQG 323
           G++NF +   A KA EE N         YV    K+   +  L+  +    +       G
Sbjct: 146 GYINFSNDEDAEKATEEFN---------YVPLFGKEVRIMPSLRNSFYRKNI-------G 189

Query: 324 VNLFVKNL---DDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKA 380
            N+F  NL   + S+      + F  +G I S K+ R      K  GF+ F     A  A
Sbjct: 190 TNVFFSNLPLENLSLTTRAFYDTFKKYGKILSCKLDR-----RKNIGFIYFDKDTSAKSA 244

Query: 381 ITEKNQQIVAGKPLYVAIAQRKEVRRS 407
           I + N +   G  +   I   +EVR+S
Sbjct: 245 IDDFNGKEYYGNNIMCGIHFDREVRKS 271

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 52/97 (53%), Gaps = 1/97 (1%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEE 376
           L+  + V LF+ +LD+ + ++ L++ F  + ++ SVK+  D  +  S G+G++ FS  E+
Sbjct: 96  LSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDED 155

Query: 377 ATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQI 413
           A KA  E N   + GK + +  + R    R  +   +
Sbjct: 156 AEKATEEFNYVPLFGKEVRIMPSLRNSFYRKNIGTNV 192

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score =  129 bits (323), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 91/296 (30%), Positives = 135/296 (45%), Gaps = 41/296 (13%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            +L++G+LD  VTE  L D F+   S  S ++C D+ TK SLGY Y+NF +       IE
Sbjct: 116 VALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIE 175

Query: 100 KLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNL---HPAIDNKALHDTFSVFGNILS 156
           + NY PI GR  RIM S R+   RK    NVF  NL   + A+  +  +D F  FG ILS
Sbjct: 176 EFNYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILS 235

Query: 157 CKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQS----- 211
           CK+      + +  GFV+F         I   NG    G  +    H  +  R+S     
Sbjct: 236 CKL-----DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRNVRKSPEFEK 290

Query: 212 ---KLDE---VKSNFT-------------------NVYVKNIDPETKQDEFEKLFSQYGA 246
              +L++   VK +                      V++KN+      D     FSQ G 
Sbjct: 291 RKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLNPDSDLLLDYFSQIGP 350

Query: 247 ITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYE 301
           + S  + T N  KL   + F+ F+  + A  A++ LN +   G+ + + RAQK ++
Sbjct: 351 VKS--IFTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLGRPIELSRAQKNFQ 404

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 142/307 (46%), Gaps = 30/307 (9%)

Query: 116 SQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVH 174
           S+  P+L  K    +FI +L   +  K L DTF+ F + +S KI  D  T KS  +G+++
Sbjct: 104 SKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLN 163

Query: 175 FXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQ 234
           F         I+  N + + G EV + P +     +  +      F+N+ ++N+   T+ 
Sbjct: 164 FSNEEDAERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIG-TNVFFSNLPLENLALTTRV 222

Query: 235 DEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVG 294
             F   F ++G I S  L+     + +  GFV FE  +AA +A+ E N  +F G  +  G
Sbjct: 223 --FYDAFKKFGKILSCKLD-----RRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCG 275

Query: 295 -----------RAQKKYERLQELKKQYESSRMEKL------AKYQGVN---LFVKNLDDS 334
                        +K+  RL+++    ES  M+        +K +G +   +F+KNL  +
Sbjct: 276 IHFDRNVRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLN 335

Query: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
            D + L + F+  G + S+    + +  S  + F+ F    +A  AI   N   + G+P+
Sbjct: 336 PDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLGRPI 394

Query: 395 YVAIAQR 401
            ++ AQ+
Sbjct: 395 ELSRAQK 401

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 84/198 (42%), Gaps = 25/198 (12%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEEL 281
           +++ ++D +  +      F+++ +  SA +  D N  K  G+G++NF +   A + +EE 
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 282 NDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNL---DDSIDDE 338
           N     G+++ +                  S R     K  G N+F  NL   + ++   
Sbjct: 178 NYIPIFGREVRI----------------MPSLRNSFYRKNIGTNVFFSNLPLENLALTTR 221

Query: 339 KLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
              + F  FG I S K+ R      K  GFV F     A +AI E N +   G  +   I
Sbjct: 222 VFYDAFKKFGKILSCKLDR-----RKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGI 276

Query: 399 AQRKEVRRSQLAQQIQAR 416
              + VR+S   ++ +AR
Sbjct: 277 HFDRNVRKSPEFEKRKAR 294

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEE 376
           L   + V LF+ +LD+ + ++ L++ F  F +  S K+  D +   S G+G++ FS  E+
Sbjct: 110 LTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEED 169

Query: 377 ATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQI 413
           A + I E N   + G+ + +  + R    R  +   +
Sbjct: 170 AERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIGTNV 206

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 55  LLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIM 114
           LL D FS IG V SI      ++K S  +A++ F   +    AI+ LN++ + GRP  + 
Sbjct: 340 LLLDYFSQIGPVKSIFTSN--VSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLGRPIELS 397

Query: 115 WSQR----DPSLRKKGSGN 129
            +Q+    D      G+GN
Sbjct: 398 RAQKNFQTDIDAANAGAGN 416

>Kwal_0.370
          Length = 560

 Score =  125 bits (313), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/293 (30%), Positives = 133/293 (45%), Gaps = 40/293 (13%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           +SL++G+LDP+VTE +L D F    S+ S+++C D+ T  SLGY Y+NF+      TAIE
Sbjct: 15  SSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIE 74

Query: 100 KLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNL---HPAIDNKALHDTFSVFGNILS 156
             +Y  + GR  RIM S R+   RK    NVF  NL    PA+  +  ++TF  +G +LS
Sbjct: 75  TFSYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLS 134

Query: 157 CKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQS----- 211
           CK+      + +  GFV+F         I + N     G  V    H  K  R+S     
Sbjct: 135 CKL-----DRRKNIGFVYFESDAAARKAIASYNNKEYYGNIVTCGLHFDKDIRRSPEFEK 189

Query: 212 ------KLDEVKSNF--------------------TNVYVKNIDPETKQDEFEKLFSQYG 245
                  L   K N                      +++VKN+      ++    FS+ G
Sbjct: 190 RRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFNICNEDLLNYFSRIG 249

Query: 246 AITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQK 298
            + S V  +  E     +GFV ++      KA++ LN   F  ++L V +A K
Sbjct: 250 PVKS-VFTSKLEAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALK 301

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 148/336 (44%), Gaps = 39/336 (11%)

Query: 114 MWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGF 172
           M +  +P +  +   ++FI +L P +  K L+DTF VF +++S KI  D ETG S  +G+
Sbjct: 1   MNNSYNPCVTSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGY 60

Query: 173 VHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNI---D 229
           ++F         I+  + + L G EV + P +    R S     K+  TNV+  N+    
Sbjct: 61  LNFYSSKDAETAIETFSYVNLFGREVRIMPSM----RNSYFR--KNIGTNVFFSNLPLEQ 114

Query: 230 PETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQ 289
           P      F + F +YG + S  L+     + +  GFV FE   AA KA+   N+ ++ G 
Sbjct: 115 PALTTRVFYETFREYGKVLSCKLD-----RRKNIGFVYFESDAAARKAIASYNNKEYYGN 169

Query: 290 KLYVG-----------RAQKKYERLQELKKQYESSRMEKLAKYQGVN----------LFV 328
            +  G             +K+  RL  L    E+   E   + +  +          + V
Sbjct: 170 IVTCGLHFDKDIRRSPEFEKRRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHV 229

Query: 329 KNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQI 388
           KNL  +I +E L   F+  G + SV   + +A  S  +GFV +    +  KA+   N  I
Sbjct: 230 KNLPFNICNEDLLNYFSRIGPVKSVFTSKLEAYRS-SWGFVTYKKGCDTRKALDSLNGAI 288

Query: 389 VAGKPLYV--AIAQRKEVRRSQLAQQIQARNQMRYQ 422
              + L V  A+    + R   +++  +A N   ++
Sbjct: 289 FMDRRLEVNKALKNNGDRRDGTVSKNRRAYNDQNFR 324

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 92/318 (28%), Positives = 148/318 (46%), Gaps = 34/318 (10%)

Query: 3   DVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSP 62
           D  + T E+ EQ ++  E+     S     TK  + + SL++G L  +VTE +L  +F  
Sbjct: 76  DCKNATQEKKEQEQVF-EKTVAKGSVQKYITKT-SKTNSLFIGNLKSTVTEEMLRKIFKR 133

Query: 63  IGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSL 122
             S  S +VCRD +TK SLGY Y+NF D N   +A ++ NYT   G+  +IM S ++   
Sbjct: 134 YQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLF 193

Query: 123 RKKGSGNVFIKNL---HPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXX 179
           RK    NVF  NL   +P +  ++ +     +GN+LSC +      + +  GFV+F    
Sbjct: 194 RKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLE-----RRKNIGFVYFDNDI 248

Query: 180 XXXXXIDAINGM------LLNGL----EVYVAPHVSKKDRQSKLDEV-------KSNFTN 222
                I   N        ++ GL    EV   P  +K+ +    D V        +N ++
Sbjct: 249 SARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSD 308

Query: 223 ------VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAK 276
                 + VKN+  +T Q+E    FS  G I S  + ++ +       FV +++   + K
Sbjct: 309 NARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFI-SEKQANTPHKAFVTYKNEEESKK 367

Query: 277 AVEELNDTDFNGQKLYVG 294
           A + LN T F    ++VG
Sbjct: 368 AQKCLNKTIFKNHTIWVG 385

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 74/187 (39%), Gaps = 25/187 (13%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEEL 281
           +++ N+     ++   K+F +Y +  SA +  D    K  G+G++NF+D N A  A +E 
Sbjct: 113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEF 172

Query: 282 NDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNL---DDSIDDE 338
           N T F GQ++ +  + K                     K  G N+F  NL   +  +   
Sbjct: 173 NYTVFFGQEVKIMPSMKN----------------TLFRKNIGTNVFFSNLPLENPQLTTR 216

Query: 339 KLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
                   +G + S  + R      K  GFV F     A   I + N Q   G  +   +
Sbjct: 217 SFYLIMIEYGNVLSCLLER-----RKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGL 271

Query: 399 AQRKEVR 405
              KEVR
Sbjct: 272 HFDKEVR 278

>Scas_607.10
          Length = 605

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 132/294 (44%), Gaps = 40/294 (13%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            SL++  L   VTE +LYD+FS   S+ S+++C D+ +K SL Y Y+NF D      A++
Sbjct: 92  TSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVD 151

Query: 100 KLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNL---HPAIDNKALHDTFSVFGNILS 156
             NYT + G   ++M S R+   RK    NVF  NL   +  +  +A +DTF  +G ILS
Sbjct: 152 DFNYTILFGNEIKMMPSLRNTIYRKNIGTNVFFANLPLENKHLTTRAFYDTFKGYGEILS 211

Query: 157 CKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQ-SKLDE 215
           CK+      K +  GFV+F         I+  N  +  G ++    H  K+ R     D+
Sbjct: 212 CKL-----DKRKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIICGLHFDKEIRNFPNFDK 266

Query: 216 VKSNFTN------------------------------VYVKNIDPETKQDEFEKLFSQYG 245
            K+N  N                              ++VKN+  +   +E    FS+ G
Sbjct: 267 RKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLPFDVPDEEILDHFSKLG 326

Query: 246 AITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299
            + S V  ++       + F+ ++      +A    N+T F G+ + V RA+ K
Sbjct: 327 PVKS-VFSSNVTKYKSSWAFITYKKQTDTIRATNHFNNTKFQGKTITVSRAKLK 379

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 128/310 (41%), Gaps = 37/310 (11%)

Query: 118 RDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFX 176
           R+   RK+   ++FI  L   +    L+D FS + +++S KI  D ++ KS  +G+++F 
Sbjct: 82  RNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFS 141

Query: 177 XXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQ-- 234
                   +D  N  +L G E+ + P +     +  +       TNV+  N+  E K   
Sbjct: 142 DELEAKKAVDDFNYTILFGNEIKMMPSLRNTIYRKNIG------TNVFFANLPLENKHLT 195

Query: 235 -DEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
              F   F  YG I S  L+     K +  GFV F++   A   + + N+  + G K+  
Sbjct: 196 TRAFYDTFKGYGEILSCKLD-----KRKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIIC 250

Query: 294 G----RAQKKYERLQELKKQYESSRM---EKLAKYQGVN--------------LFVKNLD 332
           G    +  + +    + K   ++  +   E  A   GV               +FVKNL 
Sbjct: 251 GLHFDKEIRNFPNFDKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLP 310

Query: 333 DSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGK 392
             + DE++ + F+  G + SV    +       + F+ +    +  +A    N     GK
Sbjct: 311 FDVPDEEILDHFSKLGPVKSV-FSSNVTKYKSSWAFITYKKQTDTIRATNHFNNTKFQGK 369

Query: 393 PLYVAIAQRK 402
            + V+ A+ K
Sbjct: 370 TITVSRAKLK 379

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 25/189 (13%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLR-GFGFVNFEDHNAAAKAVE 279
           T++++  +  +  ++    +FS+Y ++ S  +  D++ K    +G++NF D   A KAV+
Sbjct: 92  TSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVD 151

Query: 280 ELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNL---DDSID 336
           + N T   G ++                K   S R     K  G N+F  NL   +  + 
Sbjct: 152 DFNYTILFGNEI----------------KMMPSLRNTIYRKNIGTNVFFANLPLENKHLT 195

Query: 337 DEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
                + F  +G I S K+ +      K  GFV F   + A   I + N +I  G  +  
Sbjct: 196 TRAFYDTFKGYGEILSCKLDK-----RKNIGFVYFDNDKPAQMVINDFNNKIYFGNKIIC 250

Query: 397 AIAQRKEVR 405
            +   KE+R
Sbjct: 251 GLHFDKEIR 259

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 51/102 (50%), Gaps = 1/102 (0%)

Query: 313 SRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCF 371
           SR  +  K    +LF+  L D + +  L + F+ + ++ S+K+  D D+  S  +G++ F
Sbjct: 81  SRNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNF 140

Query: 372 STPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQI 413
           S   EA KA+ + N  I+ G  + +  + R  + R  +   +
Sbjct: 141 SDELEAKKAVDDFNYTILFGNEIKMMPSLRNTIYRKNIGTNV 182

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 99/199 (49%), Gaps = 8/199 (4%)

Query: 27  STDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYV 86
           ST   +T       +L++G+L  +VTE +L+++F+   S +S+++C D+ TK SLGY Y+
Sbjct: 125 STQQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYL 184

Query: 87  NFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNL---HPAIDNKA 143
           NF D      A+++ NY PI GR  R+M S R+   RK    NVF  NL   +  +  + 
Sbjct: 185 NFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPLDNTKLTTRV 244

Query: 144 LHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPH 203
            +D F  FG ILSCK+      + +  GF++F         I   NG       +    H
Sbjct: 245 FYDEFKKFGKILSCKL-----DRRKNIGFIYFENDAAAKEAIKQYNGKEFFDSTIMCGVH 299

Query: 204 VSKKDRQSKLDEVKSNFTN 222
             +  R+S   E K N  N
Sbjct: 300 FDRNVRKSPEFEQKINRIN 318

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score =  109 bits (273), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 128/299 (42%), Gaps = 41/299 (13%)

Query: 38  SSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA 97
           ++ +L+VG L   +T   L ++F    S  S +VC +A    SLG+ Y+NF +      A
Sbjct: 62  NNIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERA 121

Query: 98  IEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNL---HPAIDNKALHDTFSVFGNI 154
            E  NY  I G+  RIM S RD   RK    N+F  NL      + ++  +D F  +GN+
Sbjct: 122 TEDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKYGNV 181

Query: 155 LSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQ---- 210
           LS K+ +     S+  GFV+F         I   N     G  +    H  K+ R+    
Sbjct: 182 LSVKLDS-----SKNIGFVYFEDDTIARDVIKEFNNKEFLGNIISCGLHFDKELRKKPNF 236

Query: 211 ----SKLD-----------------EVKSNFTNV--------YVKNIDPETKQDEFEKLF 241
               SKLD                 E+K +   V        ++KN+  +T  +E   +F
Sbjct: 237 DKQISKLDDDIIIEKEKEIFDSNKVEIKIDKDKVAIIQPNGIFIKNLPLDTNNNEILAIF 296

Query: 242 SQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           S+ G I S  L   NE +   + FV ++D  +  KA+   N      + ++V  A  KY
Sbjct: 297 SEVGPIKSVFLSPLNESREYLWAFVTYKDKASVEKAISLFNGKAIGNRNVFVTHAYSKY 355

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 79/190 (41%), Gaps = 29/190 (15%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEEL 281
           ++V N+  E   +   ++F  Y +  SA + T+ ++ +  G G++NF +   A +A E+ 
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 282 NDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQ 341
           N     G+++ +                  S R     K  G N+F  NL   +  EKL 
Sbjct: 126 NYNKIMGKEIRI----------------MPSIRDSVYRKNFGTNIFFSNL--PLQKEKLT 167

Query: 342 EE-----FAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
                  F  +G + SVK+      SSK  GFV F     A   I E N +   G  +  
Sbjct: 168 HRMFYDIFRKYGNVLSVKL-----DSSKNIGFVYFEDDTIARDVIKEFNNKEFLGNIISC 222

Query: 397 AIAQRKEVRR 406
            +   KE+R+
Sbjct: 223 GLHFDKELRK 232

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 1/92 (1%)

Query: 323 GVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
            + LFV NL + I  E+L E F  + +  S KV  + D   S G G++ F   E+A +A 
Sbjct: 63  NIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERAT 122

Query: 382 TEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQI 413
            + N   + GK + +  + R  V R      I
Sbjct: 123 EDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNI 154

>Scas_697.10
          Length = 610

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 108/432 (25%), Positives = 176/432 (40%), Gaps = 63/432 (14%)

Query: 30  SESTKGEASS-ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNF 88
           S STK E+    +L++G+L+  VT+  L  +F    S  S +VC D  T  SLG+ Y+NF
Sbjct: 90  SHSTKLESKPFTALFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNF 149

Query: 89  HDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALH--- 145
            D      AI+  N   +  +  RIM S R  + +K    NVF  NL P  DN+  H   
Sbjct: 150 GDKEDAEKAIDDFNCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFTNL-PDEDNRLFHSRK 208

Query: 146 --DTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA-- 201
             + F  FG ILSC++       ++  GF+ F         +   N  +  G  +     
Sbjct: 209 FFEIFRQFGKILSCRL-----DPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRITCGIL 263

Query: 202 -------PHVSKKDRQS--------KLDEVKSNF------TN-------VYVKNIDPETK 233
                  P + +K  Q+        K D  + N       TN       V+V N+     
Sbjct: 264 SEDNSKKPIMEEKQEQAKQFSQLNKKYDLNEKNMPRALLNTNNLFIENTVFVSNLPTSIT 323

Query: 234 QDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
            +E    F++ G I +  + +D       + FV +     A +A++ELN+T    +++ V
Sbjct: 324 VEEIRNHFNKIGNIMNLFI-SDKISSNALWAFVKYSTAACAIRAIKELNNTFIRKKQIVV 382

Query: 294 GRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFA-----PFG 348
            +A ++ E       Q+  SR     K     L++K L   I D+    +F       F 
Sbjct: 383 SQAFRRGE------TQFHLSR-----KPTKRILYLKEL-SRICDKDFVSQFCHQRRIKFD 430

Query: 349 TITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQ 408
            I+  KV  + +  +      C  T E+A K     N +++AG  +  +     E+   +
Sbjct: 431 EISLTKVNLEKSTHTARIK--C-RTDEDARKLYNSINNRLIAGSIIKASWENSNEIENVE 487

Query: 409 LAQQIQARNQMR 420
                   NQ+R
Sbjct: 488 KDISNNVENQIR 499

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 97/189 (51%), Gaps = 6/189 (3%)

Query: 25  PTSTDSESTKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLG 82
           P+   + +TKG  E S   LYVG LD S+TE LL   F   G + ++++  D +    + 
Sbjct: 41  PSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVN 99

Query: 83  YAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDN 141
           YA+V +   +    A++ LN   ++ +  +I W+ +   +     + N+F+ +L+  +D+
Sbjct: 100 YAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDD 159

Query: 142 KALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
           + L  TF  F   +   +  D +TG+SR +GFV F         +DA+ G  L+G ++ +
Sbjct: 160 ETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219

Query: 201 APHVSKKDR 209
               +K++R
Sbjct: 220 N-WATKRER 227

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 89/205 (43%), Gaps = 22/205 (10%)

Query: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK 259
           V P  + K  +   D V      +YV N+D    +D  ++ F   G I +  +  D + +
Sbjct: 43  VVPASATKGGRETSDRV------LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNE 96

Query: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319
              + FV +   + A  A++ LN      + L +  A   +E  Q  +            
Sbjct: 97  YVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA---FETQQAAEND---------- 143

Query: 320 KYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEAT 378
                NLFV +L+  +DDE L   F  F T     VM D   G S+G+GFV FS  EEA 
Sbjct: 144 --DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201

Query: 379 KAITEKNQQIVAGKPLYVAIAQRKE 403
           KA+     + ++G+ + +  A ++E
Sbjct: 202 KAMDAMQGKDLSGRQIRINWATKRE 226

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 73/171 (42%), Gaps = 6/171 (3%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +++ NL  +I    L   F   G I + KI  D   +   + FV +         +  +N
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 190 GMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS 249
           G+ L    + +      +      D       N++V +++ +   +     F ++     
Sbjct: 120 GVQLENKTLKINWAFETQQAAENDDTF-----NLFVGDLNVDVDDETLAGTFREFPTFIQ 174

Query: 250 AVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299
           A +  D + G+ RG+GFV+F +   A KA++ +   D +G+++ +  A K+
Sbjct: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKR 225

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 4/94 (4%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F +      A++ 
Sbjct: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206

Query: 101 LNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKN 134
           +    + GR  RI W+ +    R++  GN F  N
Sbjct: 207 MQGKDLSGRQIRINWATK----RERNMGNNFGNN 236

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 84/161 (52%), Gaps = 2/161 (1%)

Query: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95
           E S   LYVG LD ++TE +L   F   G +++I++  D   K ++ YA+V +H  +   
Sbjct: 71  ETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK-NVNYAFVEYHQSHDAN 129

Query: 96  TAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNIL 155
            A++ LN   I+    +I W+ +        + N+F+ +L+  +D++ L + F  F + L
Sbjct: 130 IALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL 189

Query: 156 SCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG 195
           S  +  D +TG SR +GFV F         +D++ G  LNG
Sbjct: 190 SGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNG 230

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 84/182 (46%), Gaps = 17/182 (9%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           +YV N+D    +D  ++ F   G I +  +  D   K   + FV +   + A  A++ LN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342
                   + +  A          + Q  SS           NLFV +L+ ++DDE L+ 
Sbjct: 137 GKQIENNIVKINWA---------FQSQQSSSD-------DTFNLFVGDLNVNVDDETLRN 180

Query: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F +  S  VM D   GSS+G+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 181 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240

Query: 402 KE 403
           ++
Sbjct: 241 RD 242

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +L+VG+L+ +V +  L + F    S  S  V  D  T +S GY +V+F   +    A++ 
Sbjct: 163 NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDS 222

Query: 101 LNYTPIKGRPCRIMWSQR 118
           +    + GRP RI W+ +
Sbjct: 223 MQGQDLNGRPLRINWAAK 240

>Scas_671.4
          Length = 443

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 89/175 (50%), Gaps = 5/175 (2%)

Query: 30  SESTKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVN 87
           + +T+G  E S   LYVG LD S+ E LL   F   G ++ +++  D     ++ YA++ 
Sbjct: 71  ASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIE 129

Query: 88  FHDHNAGTTAIEKLNYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHD 146
           +   +    A++ LN   I+G+  RI W+ Q   +     + N+F+ +L+  +D++ L  
Sbjct: 130 YLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSH 189

Query: 147 TFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
            F  F + +   +  D +TG+SR +GFV F         ++ + GM +NG  V +
Sbjct: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 16/182 (8%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           +YV N+D    +D  ++ F   G IT   +  D +     + F+ +   + A  A++ LN
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144

Query: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342
                G+ + +  A          + Q  ++  +        NLFV +L+  +DDE L  
Sbjct: 145 GIQIEGKTVRINWA---------FQSQQTTNSDDTF------NLFVGDLNVDVDDETLSH 189

Query: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F +     VM D   G S+G+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249

Query: 402 KE 403
           +E
Sbjct: 250 RE 251

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%)

Query: 30  SESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89
           S+ T     + +L+VG+L+  V +  L   F    S     V  D  T  S GY +V+F 
Sbjct: 161 SQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFA 220

Query: 90  DHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118
           D      A+  +   PI GR  RI W+ +
Sbjct: 221 DQEQAQEAMNVMQGMPINGRAVRINWATK 249

>Kwal_27.11447
          Length = 439

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 93/179 (51%), Gaps = 4/179 (2%)

Query: 25  PTSTDSESTKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLG 82
           P  T + +T+G  E S   LYVG LD +VTE +L   F   G+++++++  D   K +  
Sbjct: 45  PAVTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEA-N 103

Query: 83  YAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNK 142
           YA+V FH  +  + A + L+   I+    +I ++ +   +  + + N+F+ +L+  +D++
Sbjct: 104 YAFVEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDE 163

Query: 143 ALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
            L +TF      +   +  D +TG+SR +GFV F         ++   G ++NG  + +
Sbjct: 164 TLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRI 222

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 113/272 (41%), Gaps = 28/272 (10%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           +YV N+D    +D  ++ F   GAI +  +  D   K   + FV F   + A+ A + L+
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342
                   + +  A             ++S   ++++     NLFV +L+  +DDE L  
Sbjct: 124 GKQIENHVIKINYA-------------FQS---QQVSSEDTFNLFVGDLNVDVDDETLAN 167

Query: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F    T     VM D   G S+G+GFV F    +A KA+ EK   +V G+ + +  A +
Sbjct: 168 TFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

Query: 402 KEVRRSQLAQQIQARNQMRYQQXXXXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGPNPQQ 461
           +E      A    A N               G  G     M +  +PP G+P +G     
Sbjct: 228 REHNNGNNANNNIANNNNNNNMGNRGGLRRGGFRGHSNAQMRHQ-LPPMGMPTHG----- 281

Query: 462 MAAMNGMPKNGVPPQQFGRPNGPMYGVPPQGP 493
             AM  MP  G P  Q  +  GPM  +PPQ P
Sbjct: 282 -GAM--MPGMGAPLPQGSQAPGPM--LPPQVP 308

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +L+VG+L+  V +  L + F  + +     V  D  T  S GY +V+F +      A+E+
Sbjct: 150 NLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEE 209

Query: 101 LNYTPIKGRPCRIMWSQR 118
              T + GR  RI W+ +
Sbjct: 210 KQGTVVNGRAIRINWASK 227

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 48/118 (40%), Gaps = 5/118 (4%)

Query: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK 259
           + P V  +  ++ +    S  T VY+ NI     + +   L   +G I       D    
Sbjct: 303 LPPQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPD---- 358

Query: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEK 317
            RG  F+ +  H  AA  +  L +  F G+ L  G  ++K   + + K    + +ME+
Sbjct: 359 -RGCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEKPTYVPQPKLDQSALQMEQ 415

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 88/183 (48%), Gaps = 14/183 (7%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A+++VG L  S+ +  L   F PIG V S RV  +  T  S GY YV+F D +    AI+
Sbjct: 196 ATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIK 255

Query: 100 KLNYTPIKGRP--CRIMWSQ-----RDPSLRKKG------SGNVFIKNLHPAIDNKALHD 146
           +++   I GRP  C +  S+     RD   +K G      S  +F+ NL    D   L++
Sbjct: 256 EMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYE 315

Query: 147 TFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVS 205
            F  +G I+S +I T  ET + + FG+V +          + + G  +N   V +   + 
Sbjct: 316 IFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYSIP 375

Query: 206 KKD 208
           K++
Sbjct: 376 KQN 378

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 93/197 (47%), Gaps = 19/197 (9%)

Query: 205 SKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFG 264
           SKK +     E  + F      +ID E  + EFE +    G I++ V+      + RG+G
Sbjct: 184 SKKPKTELAGEPATIFVGRLSWSIDDEWLKTEFEPIG---GVISARVMYERGTDRSRGYG 240

Query: 265 FVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGV 324
           +V+FED + A KA++E++  + +G+ +    +           K   + R ++  K+  V
Sbjct: 241 YVDFEDKSYAEKAIKEMHGKEIDGRPINCDMS---------TSKPAGAPRDDRAKKFGDV 291

Query: 325 ------NLFVKNLDDSIDDEKLQEEFAPFGTITSVKV-MRDDAGSSKGFGFVCFSTPEEA 377
                  LF+ NL    D + L E F  +G I SV++    +    KGFG+V + + E+A
Sbjct: 292 PSEPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDA 351

Query: 378 TKAITEKNQQIVAGKPL 394
           TKA      + +  +P+
Sbjct: 352 TKAFEGLQGEYINNRPV 368

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%), Gaps = 9/161 (5%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAI 188
           +F+  L  +ID++ L   F   G ++S ++  +  T +SR +G+V F         I  +
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 189 NGMLLNGLEVYVAPHVSK------KDRQSKLDEVKSNFTN-VYVKNIDPETKQDEFEKLF 241
           +G  ++G  +      SK       DR  K  +V S  ++ +++ N+  E  +D   ++F
Sbjct: 258 HGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEIF 317

Query: 242 SQYGAITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAVEEL 281
            +YG I S  + T  E +  +GFG+V +     A KA E L
Sbjct: 318 GKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGL 358

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEATKAIT 382
             +FV  L  SIDDE L+ EF P G + S +VM +     S+G+G+V F     A KAI 
Sbjct: 196 ATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIK 255

Query: 383 EKNQQIVAGKPLYVAIAQRK 402
           E + + + G+P+   ++  K
Sbjct: 256 EMHGKEIDGRPINCDMSTSK 275

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 92/185 (49%), Gaps = 2/185 (1%)

Query: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95
           E S   LYVG L  S+ + LL   F   GS+SS+++  D  ++    YA+V + + +   
Sbjct: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151

Query: 96  TAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNIL 155
            A + LN   ++G+  +I W+ +   +    + N+F+ +L+  +D+  L  TF  F + +
Sbjct: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211

Query: 156 SCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLD 214
              +  D ++G+SR +GFV F         ++   G  LNG  + +     ++ +QS+  
Sbjct: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271

Query: 215 EVKSN 219
           + + N
Sbjct: 272 QRRFN 276

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 98/214 (45%), Gaps = 23/214 (10%)

Query: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK 259
            AP ++ +  + K D++      +YV N+      D  ++ F   G+I+S  +  D   +
Sbjct: 82  AAPVLATQGGREKSDKI------LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ 135

Query: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319
              + FV + + + A  A + LN  +  G+ L +  A             ++S ++    
Sbjct: 136 ECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWA-------------FQSQQVNSDE 182

Query: 320 KYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEAT 378
            +   NLFV +L+  +DD  L   F  F +     VM D  +G S+G+GFV F   ++A 
Sbjct: 183 TF---NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239

Query: 379 KAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQ 412
            A+  K    + G+ L +  A ++E ++SQ  Q+
Sbjct: 240 VAMETKQGFELNGRALRINWASKREPQQSQQGQR 273

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 4/172 (2%)

Query: 32  STKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89
           +TKG  E S   LYVG LD ++ EA L   F   G +++++V  D   + +  YA+V + 
Sbjct: 25  ATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYR 83

Query: 90  DHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFS 149
                  A + L+   I+    +I W+ +   +    + N+F+ +L+  +D++ L  TF 
Sbjct: 84  QPRDANVAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFK 143

Query: 150 VFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
            F   +   +  D ++G+SR +GFV F         +DA  G  LNG  + V
Sbjct: 144 EFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRV 195

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 100/250 (40%), Gaps = 31/250 (12%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           +YV N+D    +   ++ F   G I +  +  D   +   + FV +     A  A + L+
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342
                   + +  A             ++S   ++++     NLFV +L+  +DDE L  
Sbjct: 97  GKQIENNVIKINWA-------------FQS---QQVSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            F  F T     VM D  +G S+G+GFV F   EEA KA+  K    + G+ + V  A +
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 402 KEVRRSQLAQQIQARNQMRYQQXXXXXXXXXGMPGQFMQPMFYGVMPPRGVPFNGP---- 457
           +E + +  A+    R   R            GMP     P   G  P   +   GP    
Sbjct: 201 RESQHA--ARPRSNRGGFR---GGSGHQPFRGMP---QGPHLGGAAPAGPMQLQGPPVPS 252

Query: 458 --NPQQMAAM 465
             NPQ + AM
Sbjct: 253 PVNPQAVEAM 262

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 76/172 (44%), Gaps = 9/172 (5%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +++ NL   I+   L   F V G I + K+  D+  +   + FV +            ++
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 190 GMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFT-NVYVKNIDPETKQDEFEKLFSQYGAIT 248
           G  +         +V K +   +  +V S+ T N++V +++ +   +     F ++    
Sbjct: 97  GKQIEN-------NVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEFPTFI 149

Query: 249 SAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299
            A +  D   G+ RG+GFV+F +   A KA++     + NG+ + V  A K+
Sbjct: 150 QAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKR 201

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 36/81 (44%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +L+VG+L+  V +  L   F    +     V  D  +  S GY +V+F +      A++ 
Sbjct: 123 NLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDA 182

Query: 101 LNYTPIKGRPCRIMWSQRDPS 121
                + GR  R+ W+ +  S
Sbjct: 183 KQGFNLNGRAIRVNWAAKRES 203

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/105 (19%), Positives = 36/105 (34%), Gaps = 6/105 (5%)

Query: 22  PTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSL 81
           P  P + ++   +      + Y+G +     E  L  L    G +   +   +       
Sbjct: 253 PVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEK------ 306

Query: 82  GYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKG 126
           G  ++ +  H+     I  L   P +GR  R  W +  PS    G
Sbjct: 307 GCCFIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPSFVPNG 351

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 86/179 (48%), Gaps = 14/179 (7%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           K +   A+++VG L  S+ +  L   F  IG V + RV  +  T  S GY YV+F D + 
Sbjct: 170 KTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSY 229

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPSL-----RKKGSGNV--------FIKNLHPAID 140
              A+++++   I GRP  +  S   P++     R+K  G++        F+ NL    D
Sbjct: 230 AEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNAD 289

Query: 141 NKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEV 198
              +++ F  FG I+S +I T  ET + + FG+V +         ++A+ G  ++   V
Sbjct: 290 RDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPV 348

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 93/188 (49%), Gaps = 8/188 (4%)

Query: 209 RQSKLD-EVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVN 267
           +++K D E  + F      +ID E  + EFE +    G + + V+      + RG+G+V+
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIG---GVVAARVMYERGTDRSRGYGYVD 223

Query: 268 FEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLF 327
           FED + A KAV+E++  + +G+ + V  +  K        +Q    R   +       LF
Sbjct: 224 FEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQ---KRFGDIPSEPSDTLF 280

Query: 328 VKNLDDSIDDEKLQEEFAPFGTITSVKV-MRDDAGSSKGFGFVCFSTPEEATKAITEKNQ 386
           + NL  + D + + E F  FG I SV++    +    KGFG+V +++ ++A KA+     
Sbjct: 281 LGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQG 340

Query: 387 QIVAGKPL 394
           + +  +P+
Sbjct: 341 EYIDNRPV 348

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 81/162 (50%), Gaps = 9/162 (5%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDA 187
            VF+  L  +ID++ L   F   G +++ ++  +  T +SR +G+V F         +  
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 188 INGMLLNGLEVYVAPHVSK------KDRQSKLDEVKSNFTN-VYVKNIDPETKQDEFEKL 240
           ++G  ++G  + V    SK      +DRQ +  ++ S  ++ +++ N+     +D   ++
Sbjct: 237 MHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEI 296

Query: 241 FSQYGAITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAVEEL 281
           F ++G I S  + T  E +  +GFG+V +   + A KA+E L
Sbjct: 297 FGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEAL 338

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 317 KLAKYQG--VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFST 373
           K AK  G    +FV  L  SIDDE L++EF   G + + +VM +     S+G+G+V F  
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFED 226

Query: 374 PEEATKAITEKNQQIVAGKPLYVAIAQRK 402
              A KA+ E + + + G+P+ V ++  K
Sbjct: 227 KSYAEKAVKEMHGKEIDGRPINVDMSTSK 255

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S +L++G L  +     +Y++F   G + S+R+     T+   G+ YV +   +    A+
Sbjct: 276 SDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKAL 335

Query: 99  EKLNYTPIKGRPCRIMWSQRDP 120
           E L    I  RP R+ +S   P
Sbjct: 336 EALQGEYIDNRPVRLDYSTPKP 357

>Scas_621.10
          Length = 415

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 81/174 (46%), Gaps = 13/174 (7%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           K E   A+++VG L  S+ +  L   F  IG V S RV  +  T  S GY YV+F D + 
Sbjct: 156 KTEGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSY 215

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPSL----RKKGSGNV--------FIKNLHPAIDN 141
              AI+++    I GR   +  S   P+     R K  G+V        F+ NL    D 
Sbjct: 216 AEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADR 275

Query: 142 KALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLN 194
            A+ + FS +G I+S +I T  ET + + FG+V +         ++ + G  ++
Sbjct: 276 DAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYID 329

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 8/160 (5%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAI 188
           +F+  L  +ID++ L   F   G ++S ++  +  T +SR +G+V F         I  +
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 189 NGMLLNGLEVYV-----APHVSKKDRQSKLDEVKSNFT-NVYVKNIDPETKQDEFEKLFS 242
            G  ++G E+ V      P     DR  K  +V S  +  +++ N+     +D   +LFS
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 243 QYGAITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAVEEL 281
           +YG I S  + T  E +  +GFG+V + +   A KA+E L
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 85/169 (50%), Gaps = 8/169 (4%)

Query: 227 NIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDF 286
           +ID E  + EFE +    G +++ V+      + RG+G+V+FED + A KA++E+   + 
Sbjct: 172 SIDDEWLKKEFEHIG---GVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEMQGKEI 228

Query: 287 NGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAP 346
           +G+++ V  +  K            + +   +       LF+ NL  + D + + E F+ 
Sbjct: 229 DGREINVDMSTSK----PAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFSK 284

Query: 347 FGTITSVKV-MRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
           +G I SV++    +    KGFG+V ++  E+A KA+     + +  +P+
Sbjct: 285 YGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKV-MRDDAGSSKGFGFVCFSTPEEATKAIT 382
             +FV  L  SIDDE L++EF   G + S +V M      S+G+G+V F     A KAI 
Sbjct: 162 ATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIK 221

Query: 383 EKNQQIVAGKPLYVAIAQRK 402
           E   + + G+ + V ++  K
Sbjct: 222 EMQGKEIDGREINVDMSTSK 241

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S +L++G L  +     + +LFS  G + S+R+     T+   G+ YV + +      A+
Sbjct: 261 SETLFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKAL 320

Query: 99  EKLNYTPIKGRPCRIMWSQRDP 120
           E L    I  RP R+ +S   P
Sbjct: 321 EGLQGEYIDNRPVRLDYSTPRP 342

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 86/181 (47%), Gaps = 14/181 (7%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           K +   A+++VG L  SV +  L   F  IG V   RV  +  T  S GY YV+F D + 
Sbjct: 161 KTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSY 220

Query: 94  GTTAIEKLNYTPIKGRP--CRIMWSQ-----RDPSLRKKG------SGNVFIKNLHPAID 140
              A+++++   I GR   C +  S+     R+   +K G      S  +F+ NL    D
Sbjct: 221 AEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNAD 280

Query: 141 NKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVY 199
             AL + FS  GN++S +I T  E+ + + FG+V +         +DA+ G  ++   V 
Sbjct: 281 RDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVR 340

Query: 200 V 200
           +
Sbjct: 341 I 341

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 86/177 (48%), Gaps = 19/177 (10%)

Query: 227 NIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDF 286
           ++D E  + EF+ +    G + + V+      K RG+G+V+FED + A KAV+E++  + 
Sbjct: 177 SVDDEWLKTEFDHIG---GVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEI 233

Query: 287 NGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGV------NLFVKNLDDSIDDEKL 340
           +G+ +    +           K   + R ++  KY          LF+ NL  + D + L
Sbjct: 234 DGRAINCDMS---------TSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDAL 284

Query: 341 QEEFAPFGTITSVKV-MRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
            E F+  G + SV++    ++   KGFG+V + + EEA  A+     + +  +P+ +
Sbjct: 285 FELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRI 341

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 76/161 (47%), Gaps = 9/161 (5%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAI 188
           +F+  L  ++D++ L   F   G ++  ++  +  T KSR +G+V F         +  +
Sbjct: 169 IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEM 228

Query: 189 NGMLLNGLEVYVAPHVSK------KDRQSKLDEVKSNFTN-VYVKNIDPETKQDEFEKLF 241
           +G  ++G  +      SK      +DR  K  +  S  ++ +++ N+     +D   +LF
Sbjct: 229 HGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFELF 288

Query: 242 SQYGAITSAVLETDNEG-KLRGFGFVNFEDHNAAAKAVEEL 281
           S++G + S  + T  E  + +GFG+V +     A  A++ L
Sbjct: 289 SKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 304 QELKKQYESSRMEKLAKYQGVN-----LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD 358
           +E KK+   S  + +AK Q  +     +FV  L  S+DDE L+ EF   G +   +V+ +
Sbjct: 142 EESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE 201

Query: 359 -DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
                S+G+G+V F     A KA+ E + + + G+ +   ++  K
Sbjct: 202 RGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSK 246

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S +L++G L  +     L++LFS  G+V S+R+     +    G+ YV +        A+
Sbjct: 267 SDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAAL 326

Query: 99  EKLNYTPIKGRPCRIMWSQRDP 120
           + L    I  RP RI +S   P
Sbjct: 327 DALQGEYIDNRPVRIDFSSPRP 348

>Kwal_55.21960
          Length = 597

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 85/173 (49%), Gaps = 13/173 (7%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAI 188
           +FI  L+       L D FS +G +   KI  D  TG+SR FGF+ F         +   
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 189 NGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAIT 248
           +  +L+G +V        ++ Q K  ++       +V  I P+ +  EFE+ FSQ+G I 
Sbjct: 271 H--ILDG-KVIDPKRAIPREEQDKTGKI-------FVGGIGPDVRPKEFEEFFSQWGTII 320

Query: 249 SAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
            A L  D + G+ RGFGF+ ++  +A  +  E     +F G+++ + RA+ ++
Sbjct: 321 DAQLMLDKDTGRSRGFGFITYDTPDAVDRVCEN-KFIEFKGKRIEIKRAEPRH 372

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 90/186 (48%), Gaps = 23/186 (12%)

Query: 201 APHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGK 259
           +P      R +K D +  +   +++  ++ ET +D  +  FS+YG +T   +  DN  G+
Sbjct: 190 SPGAGVDQRPNKAD-LSRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGR 248

Query: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319
            RGFGF+ F    A A +V+E+  T    Q +  G       ++ + K+       +K  
Sbjct: 249 SRGFGFLTF----AEASSVDEVVKT----QHILDG-------KVIDPKRAIPREEQDKTG 293

Query: 320 KYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEAT 378
           K     +FV  +   +  ++ +E F+ +GTI   ++M D D G S+GFGF+ + TP+   
Sbjct: 294 K-----IFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVD 348

Query: 379 KAITEK 384
           +    K
Sbjct: 349 RVCENK 354

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 71/138 (51%), Gaps = 11/138 (7%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           +++G L+   TE  L D FS  G V+ +++ RD  T  S G+ ++ F + ++    ++  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 102 NYTPIKGR---PCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCK 158
           +   + G+   P R +     P   +  +G +F+  + P +  K   + FS +G I+  +
Sbjct: 271 HI--LDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 323

Query: 159 IATD-ETGKSRKFGFVHF 175
           +  D +TG+SR FGF+ +
Sbjct: 324 LMLDKDTGRSRGFGFITY 341

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA-GSSKGFGFVCFSTPEEATKAITEK 384
           +F+  L+    ++ L++ F+ +G +T +K+MRD+A G S+GFGF+ F+      + +  K
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVV--K 268

Query: 385 NQQIVAGK 392
            Q I+ GK
Sbjct: 269 TQHILDGK 276

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 86/178 (48%), Gaps = 13/178 (7%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXX 183
           K S  +FI  L+       L D FS +G +   KI  D  TG+SR FGF+ F        
Sbjct: 119 KDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDE 178

Query: 184 XIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQ 243
            +   +  +L+G +V        ++ Q K  ++       +V  I P+ +  EFE+ F+Q
Sbjct: 179 VVKTQH--ILDG-KVIDPKRAIPREEQDKTGKI-------FVGGIGPDVRPKEFEEFFAQ 228

Query: 244 YGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           +G I  A L  D + G+ RGFGF+ ++  +A  K  +     DF G+K+ + RA  ++
Sbjct: 229 WGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNKF-IDFKGRKIEIKRAAPRH 285

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 87/179 (48%), Gaps = 23/179 (12%)

Query: 208 DRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS-AVLETDNEGKLRGFGFV 266
           DR  K D  K +   +++  ++ ET +D     FS+YG +    +++    G+ RGFGF+
Sbjct: 110 DRTVKADLSKDS-CKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFL 168

Query: 267 NFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNL 326
            FE    +A +V+E+  T    Q +  G+       + + K+       +K  K     +
Sbjct: 169 TFE----SASSVDEVVKT----QHILDGK-------VIDPKRAIPREEQDKTGK-----I 208

Query: 327 FVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEK 384
           FV  +   +  ++ +E FA +GTI   ++M D D G S+GFGF+ + TP+   K    K
Sbjct: 209 FVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNK 267

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 70/141 (49%), Gaps = 11/141 (7%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S  +++G L+   TE  L D FS  G V  +++ +D  T  S G+ ++ F   ++    +
Sbjct: 121 SCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVV 180

Query: 99  EKLNYTPIKGR---PCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNIL 155
           +  +   + G+   P R +     P   +  +G +F+  + P +  K   + F+ +G I+
Sbjct: 181 KTQHI--LDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTII 233

Query: 156 SCKIATD-ETGKSRKFGFVHF 175
             ++  D +TG+SR FGF+ +
Sbjct: 234 DAQLMLDKDTGRSRGFGFITY 254

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A+++VG L  S+ +  L   F  IG V   RV  +  T  S GY YV+F + +    AI+
Sbjct: 168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQ 227

Query: 100 KLNYTPIKGRPCRIMWSQRDPS-----LRKKG------SGNVFIKNLHPAIDNKALHDTF 148
           ++    I GRP     S   P+      +K G      S  +F+ NL    D  A+ + F
Sbjct: 228 EMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELF 287

Query: 149 SVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
           +  G ++S +I T  ET + + FG+V F         +DA+ G  ++   V +
Sbjct: 288 AKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 94/193 (48%), Gaps = 9/193 (4%)

Query: 205 SKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFG 264
           +KK +  + +E  + F      +ID E  + EFE +    G I + V+      + RG+G
Sbjct: 156 NKKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHI---GGVIGARVIYERGTDRSRGYG 212

Query: 265 FVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGV 324
           +V+FE+ + A KA++E+   + +G+ +    +  K     +  K++  +  E        
Sbjct: 213 YVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSE-----PSD 267

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKV-MRDDAGSSKGFGFVCFSTPEEATKAITE 383
            LF+ NL  + D + + E FA  G + SV++    +    KGFG+V FS  E+A KA+  
Sbjct: 268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDA 327

Query: 384 KNQQIVAGKPLYV 396
              + +  +P+ +
Sbjct: 328 LQGEYIDNRPVRL 340

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 76/159 (47%), Gaps = 7/159 (4%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAI 188
           +F+  L  +ID++ L   F   G ++  ++  +  T +SR +G+V F         I  +
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 189 NGMLLNGLEVYVAPHVSK----KDRQSKLDEVKSNFTN-VYVKNIDPETKQDEFEKLFSQ 243
            G  ++G  +      SK     DR  K  +  S  ++ +++ N+     +D   +LF++
Sbjct: 230 QGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAK 289

Query: 244 YGAITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAVEEL 281
           +G + S  + T  E +  +GFG+V F +   A KA++ L
Sbjct: 290 HGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL 328

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEATKAITEK 384
           +FV  L  SIDDE L++EF   G +   +V+ +     S+G+G+V F     A KAI E 
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 385 NQQIVAGKPLYVAIAQRK 402
             + + G+P+   ++  K
Sbjct: 230 QGKEIDGRPINCDMSTSK 247

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S +L++G L  +     +++LF+  G V S+R+     T+   G+ YV F +      A+
Sbjct: 266 SDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKAL 325

Query: 99  EKLNYTPIKGRPCRIMWSQRDPS 121
           + L    I  RP R+ +S   P+
Sbjct: 326 DALQGEYIDNRPVRLDFSSPRPN 348

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 122/270 (45%), Gaps = 37/270 (13%)

Query: 194 NGLEVYVAPHVSKKDRQSKLDE---------VKSNFTN----VYVKNIDPETKQDEFEKL 240
           NG  V   P VS + + S+  E         VK++ +     +++  ++ ET +D   + 
Sbjct: 90  NGSNVSSEPQVSNQTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREY 149

Query: 241 FSQYGAITS-AVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299
           FS+YG +    +++  N G+ RGFGF++F+    A  +V+E+  T    Q +  G+    
Sbjct: 150 FSKYGNVVELKIMKDPNTGRSRGFGFLSFD----APSSVDEVVKT----QHILDGK---- 197

Query: 300 YERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD- 358
              + + K+       +K  K     +FV  L   +  ++ +E F+ +GTI   ++M D 
Sbjct: 198 ---VIDPKRAIPREEQDKTGK-----IFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDK 249

Query: 359 DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQ 418
           D G S+GFGFV + +P+ A K + E   +   GK + +  A+ +  ++ Q  QQ  +   
Sbjct: 250 DTGRSRGFGFVTYDSPDAAEK-VCESRYREFKGKQIEIKRAEPRHQQK-QAGQQAVSPPV 307

Query: 419 MRYQQXXXXXXXXXGMPGQFMQPMFYGVMP 448
                          M G +  PM  G  P
Sbjct: 308 AGMGMNPMSNPMANPMAGMYQNPMMGGFNP 337

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 70/138 (50%), Gaps = 11/138 (7%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           +++G L+   TE  L + FS  G+V  +++ +D  T  S G+ +++F D  +    + K 
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSF-DAPSSVDEVVKT 190

Query: 102 NYTPIKGR---PCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCK 158
            +  + G+   P R +     P   +  +G +F+  L   +  K   + FS +G I+  +
Sbjct: 191 QHI-LDGKVIDPKRAI-----PREEQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQ 244

Query: 159 IATD-ETGKSRKFGFVHF 175
           +  D +TG+SR FGFV +
Sbjct: 245 LMLDKDTGRSRGFGFVTY 262

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 95/216 (43%), Gaps = 47/216 (21%)

Query: 128 GNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXID 186
           GN++I+ +   +    L   FS FG +LS KI  D  T +S  +GF+ +         I 
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK 276

Query: 187 AINGMLLNGLEVYVAPHVSKKDRQS-KLDEVKSN-----FTNVYVKNIDPETKQDEF--- 237
            +NG L+NG  +++  HV +K+R+   LD +K +     F  V+V N+  E +       
Sbjct: 277 ELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITP 336

Query: 238 EKLFSQYGAITSAV------------------------------------LETDNE-GKL 260
           E++F+++  I   V                                     ++ NE   L
Sbjct: 337 EQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPL 396

Query: 261 RGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRA 296
           +G+GF+ F  H+ A KA+++LN   + G  L V +A
Sbjct: 397 KGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 93/220 (42%), Gaps = 53/220 (24%)

Query: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEE 280
           N+Y++ I  +   D+   +FS++G + S  +  D N  +  G+GF+++   + AA+ ++E
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKE 277

Query: 281 LNDTDFNGQKLYVGRAQKKYER----LQELKKQYESSRMEKLAKYQGVNLFVKNLDDSID 336
           LN    NG  L++    ++ ER    L  LK+  +  R      ++GV  FV NL    +
Sbjct: 278 LNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDER------FRGV--FVGNLPTEYE 329

Query: 337 DEKL---QEEFAPFGTITS-VKVM------------------------------------ 356
           D  L   ++ F  F  I   V ++                                    
Sbjct: 330 DGTLITPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDS 389

Query: 357 RDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           +++    KG+GF+ FST + A KAI + N     G  L V
Sbjct: 390 QNEDSPLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVV 429

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 54/98 (55%), Gaps = 17/98 (17%)

Query: 322 QGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMR--------------DDA--GSSKG 365
           Q  NL+VK++  S  DE L + ++ +G I S K++               +D   G+S+G
Sbjct: 597 QESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRG 656

Query: 366 FGFVCFSTPEEATKAITEKNQ-QIVAGKPLYVAIAQRK 402
           +GFVCF  P +A++A+   ++ Q+     LYV+ AQ++
Sbjct: 657 YGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 2/100 (2%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITE 383
           NL+++ +   +  + L   F+ FGT+ S+K++ D +   S G+GF+ +    +A + I E
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKE 277

Query: 384 KNQQIVAGKPLYVAI-AQRKEVRRSQLAQQIQARNQMRYQ 422
            N  ++ G PL++    +RKE  R  L    +  +  R++
Sbjct: 278 LNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFR 317

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 17/96 (17%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSA----------------VLETDNEGKLRGFG 264
           +N+YVK+I    + ++    +SQYG I SA                 LE    G  RG+G
Sbjct: 599 SNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYG 658

Query: 265 FVNFEDHNAAAKAVEELNDTDF-NGQKLYVGRAQKK 299
           FV F++   A++A+   +         LYV  AQK+
Sbjct: 659 FVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            +LY+  +   ++   L  +FS  G+V S+++  D  T+ SLGY ++++   +     I+
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK 276

Query: 100 KLNYTPIKGRPCRIMW 115
           +LN   + G P  I +
Sbjct: 277 ELNGNLMNGSPLFINY 292

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A+++VG L  S+ +  L   F  IG V S RV  +  +  S GY YV+F D +    A++
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 100 KLNYTPIKGRP--CRIMWSQ-----RDPSLRKKG------SGNVFIKNLHPAIDNKALHD 146
           +++   I GRP  C +  S+     RD   +K G      S  +F+ NL    D   L +
Sbjct: 233 EMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFE 292

Query: 147 TFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEV 198
            FS  G ++S +I T  ET + + FG+V +          +A+ G  ++   V
Sbjct: 293 IFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPV 345

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 87/182 (47%), Gaps = 19/182 (10%)

Query: 220 FTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
           F      +ID E  + EF+ +    G +++ V+      + RG+G+V+FED + A KAV+
Sbjct: 176 FVGRLSWSIDDEWLKTEFDHIG---GVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 280 ELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGV------NLFVKNLDD 333
           E++  + +G+ +    +           K   + R ++  K+  V       LF+ NL  
Sbjct: 233 EMHGKEIDGRPINCDMS---------TSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSF 283

Query: 334 SIDDEKLQEEFAPFGTITSVKV-MRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGK 392
           + D + L E F+  G + SV++    +    KGFG+V + + ++A KA      + +  +
Sbjct: 284 NADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNR 343

Query: 393 PL 394
           P+
Sbjct: 344 PV 345

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEATKAIT 382
             +FV  L  SIDDE L+ EF   G + S +V+ +     S+G+G+V F     A KA+ 
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 383 EKNQQIVAGKPLYVAIAQRK 402
           E + + + G+P+   ++  K
Sbjct: 233 EMHGKEIDGRPINCDMSTSK 252

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S +L++G L  +     L+++FS  G V S+R+     T+   G+ YV +   +    A 
Sbjct: 273 SDTLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAF 332

Query: 99  EKLNYTPIKGRPCRIMWS 116
           E L    I  RP R+ +S
Sbjct: 333 EALQGEYIDNRPVRLDYS 350

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 92/181 (50%), Gaps = 15/181 (8%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAI 188
           +FI  L+     + L D FS +G +   KI  D  TG+SR FGF+ F         +   
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 189 NGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAIT 248
           +  +L+G +V        ++ Q K  ++       +V  I P+ +  EFE+ FSQ+G+I 
Sbjct: 248 H--ILDG-KVIDPKRAIPREEQDKTGKI-------FVGGIGPDVRPKEFEEFFSQWGSII 297

Query: 249 SAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELK 307
            A L  D + G+ RGFGF+ ++  +A  +  +     +F G+++ + RA+ +  +LQ+ K
Sbjct: 298 DAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQN-KFIEFKGKQIEIKRAEPR--QLQKQK 354

Query: 308 K 308
           +
Sbjct: 355 Q 355

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 114/256 (44%), Gaps = 45/256 (17%)

Query: 215 EVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNA 273
           ++  +   +++  ++ ET ++     FS+YGA+    +  D   G+ RGFGF+ FE+   
Sbjct: 180 DLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN--- 236

Query: 274 AAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDD 333
            A +V+E+  T    Q +  G+       + + K+       +K  K     +FV  +  
Sbjct: 237 -ASSVDEVVKT----QHILDGK-------VIDPKRAIPREEQDKTGK-----IFVGGIGP 279

Query: 334 SIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGK 392
            +  ++ +E F+ +G+I   ++M D D G S+GFGF+ + TP+   +    K  +   GK
Sbjct: 280 DVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQNKFIEF-KGK 338

Query: 393 PLYVAIAQRKEVRRSQLAQQIQARNQ------MRYQQXXXXXXXXXGMPGQFMQPMFYGV 446
            + +  A+ +++++ +  Q  Q   Q       +YQ               F  PM  G 
Sbjct: 339 QIEIKRAEPRQLQKQKQPQMTQPMGQNMSNPMQQYQ--------------MFQNPMMAGG 384

Query: 447 MPPRGVPFNGPNPQQM 462
             P  +   G NPQ M
Sbjct: 385 FNP--MMATGFNPQSM 398

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 73/138 (52%), Gaps = 11/138 (7%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           +++G L+   TE  L D FS  G+V+ +++ +D  T  S G+ ++ F + ++    ++  
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 102 NYTPIKGR---PCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCK 158
           +   + G+   P R +     P   +  +G +F+  + P +  K   + FS +G+I+  +
Sbjct: 248 HI--LDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQ 300

Query: 159 IATD-ETGKSRKFGFVHF 175
           +  D +TG+SR FGF+ +
Sbjct: 301 LMLDKDTGRSRGFGFITY 318

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 297 QKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVM 356
           Q+   +LQ+   Q+E   ++         +F+  L+    +E L++ F+ +G +  VK+M
Sbjct: 159 QQTMSQLQQTASQHEPKAIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIM 218

Query: 357 RDDA-GSSKGFGFVCFSTPEEATKAITEKNQQIVAGK 392
           +D A G S+GFGF+ F       + +  K Q I+ GK
Sbjct: 219 KDTATGRSRGFGFLTFENASSVDEVV--KTQHILDGK 253

>Scas_598.1
          Length = 516

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 18/177 (10%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAI 188
           +FI  L+       L D FS +GN++  KI  D  TG+SR FGF+ F         +   
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 261

Query: 189 NGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAIT 248
           +  +L+G +V        ++ Q K  ++       +V  I P+ +  EFE+ F+Q+G I 
Sbjct: 262 H--ILDG-KVIDPKRAIPREEQDKTGKI-------FVGGIGPDVRPKEFEEFFAQWGTII 311

Query: 249 SA-----VLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
            A     +L+ D  G+ RGFGF+ + D + A   V +    DF G+++ + RA  ++
Sbjct: 312 DAQLMLLMLDKDT-GRSRGFGFITY-DSSEAVDRVCQNKYIDFKGKQIEIKRAAPRH 366

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 97/210 (46%), Gaps = 34/210 (16%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEEL 281
           +++  ++ ET +D+ +  FS+YG +    +  DN  G+ RGFGF+ FE     + +V+E+
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFE----LSSSVDEV 257

Query: 282 NDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQ 341
             T    Q +  G+       + + K+       +K  K     +FV  +   +  ++ +
Sbjct: 258 VKT----QHILDGK-------VIDPKRAIPREEQDKTGK-----IFVGGIGPDVRPKEFE 301

Query: 342 EEFAPFGTITSVKVM----RDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 397
           E FA +GTI   ++M      D G S+GFGF+ + +  EA   + +       GK + + 
Sbjct: 302 EFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITYDS-SEAVDRVCQNKYIDFKGKQIEIK 360

Query: 398 IAQRKEVRRS--------QLAQQIQARNQM 419
            A  + +++         Q   Q+QA  QM
Sbjct: 361 RAAPRHMQKGANNGRNPRQFQNQMQAPPQM 390

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 70/141 (49%), Gaps = 14/141 (9%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           L++G L+   TE  L D FS  G+V  +++ +D  T  S G+ ++ F + ++    + K 
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTF-ELSSSVDEVVKT 260

Query: 102 NYTPIKGR---PCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCK 158
            +  + G+   P R +     P   +  +G +F+  + P +  K   + F+ +G I+  +
Sbjct: 261 QHI-LDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 314

Query: 159 IA----TDETGKSRKFGFVHF 175
           +       +TG+SR FGF+ +
Sbjct: 315 LMLLMLDKDTGRSRGFGFITY 335

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 76/135 (56%), Gaps = 5/135 (3%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           +++G L+   TE  L + FS  G+V+ +++ RD  T  S G+ +++F D ++    ++  
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT 161
           +   + G+   I   + DP+ R + +G +F+  + P +  K   + FS +G+I+  ++  
Sbjct: 225 HI--LDGKV--IDPKESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLML 280

Query: 162 D-ETGKSRKFGFVHF 175
           D +TG+SR FGF+ +
Sbjct: 281 DKDTGRSRGFGFITY 295

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 83/175 (47%), Gaps = 19/175 (10%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDA- 187
           +FI  L+       L + FS +GN+   KI  D  TG+SR FGF+ F         +   
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 188 --INGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYG 245
             ++G +++  E        K  +             ++V  I P+ +  EFE+ FSQ+G
Sbjct: 225 HILDGKVIDPKESDPTGRARKAGK-------------IFVAGIGPDVRPKEFEEFFSQWG 271

Query: 246 AITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299
           +I  A L  D + G+ RGFGF+ ++  +A  +  +     +F G+++ + RA+ +
Sbjct: 272 SIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQN-KFIEFKGKRIEIKRAEPR 325

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 101/200 (50%), Gaps = 24/200 (12%)

Query: 209 RQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSA-VLETDNEGKLRGFGFVN 267
           +Q K D +  +   +++  ++ ET +D   + FS+YG +T   ++     G+ RGFGF++
Sbjct: 152 KQVKAD-LSRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLS 210

Query: 268 FEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLF 327
           F D    A +V+E+  T    Q +  G+       + + K+   + R  K  K     +F
Sbjct: 211 FAD----ASSVDEVVKT----QHILDGK-------VIDPKESDPTGRARKAGK-----IF 250

Query: 328 VKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQ 386
           V  +   +  ++ +E F+ +G+I   ++M D D G S+GFGF+ + +P+   +    K  
Sbjct: 251 VAGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQNKFI 310

Query: 387 QIVAGKPLYVAIAQRKEVRR 406
           +   GK + +  A+ ++V++
Sbjct: 311 EF-KGKRIEIKRAEPRQVQK 329

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            +LY+G +DP+VT+ LLY+LF  +  +S IR  RD I  T  GYA++ F         ++
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 100 KLNYT------PIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFG 152
            +N T       +K R      +   PS   +    +F+KNL   +D  AL   F  FG
Sbjct: 70  VMNNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFG 128

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 25/191 (13%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSA------VLETDNEGKLRGFGFVNFEDHNAA 274
           T +Y+ NIDP   +D   +LF Q   I+        +L+T      +G+ F+ F     A
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTH-----QGYAFIEFFTKEDA 64

Query: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ--GVNLFVKNLD 332
              V+ +N+T             + Y R  ++++   ++   + +K+   G  LFVKNLD
Sbjct: 65  DYVVKVMNNT------------VQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLD 112

Query: 333 DSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGK 392
           D +D   L + F  FG  +    +     +     ++ ++T +++ +A+ + N QIV  +
Sbjct: 113 DLVDVAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLNNQIVFNR 172

Query: 393 PLYVAIAQRKE 403
            + V  A + E
Sbjct: 173 SISVDYAFKDE 183

>Scas_637.2
          Length = 377

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 109/299 (36%), Gaps = 44/299 (14%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           +++G L    TE  L D FS +G V +  V   +    S G   V F +      AI + 
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM--SYRGRSKGMGTVEFTNPADAEEAIRQY 137

Query: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGN--------VFIKNLHPAIDNKALHDTFSVFGN 153
           N  P  GR   +   Q  P  R++   +         F+ NL  +I  + L D F   G+
Sbjct: 138 NGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGD 197

Query: 154 ILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG--LEV------------- 198
           ++   +  D  G SR FG V +         ID+ NG  L G  LEV             
Sbjct: 198 VIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREGKFNHPRDTFD 257

Query: 199 --------YVAPHVSKKDRQSKLDEVKSNFT-----------NVYVKNIDPETKQDEFEK 239
                        V K++          +FT            VY  N+   T   +   
Sbjct: 258 DRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPLSTTVPDLYD 317

Query: 240 LFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQK 298
           LF   G I  A L  D  G   G   V +   +AA   + +LN  ++ G+ L++  A +
Sbjct: 318 LFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYASR 376

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 9/180 (5%)

Query: 217 KSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAK 276
           K +   +++ N+  +  +++    FSQ G + +A + +   G+ +G G V F +   A +
Sbjct: 74  KHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMS-YRGRSKGMGTVEFTNPADAEE 132

Query: 277 AVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSID 336
           A+ + N   F G+ ++V + Q      QE K    +         QG   FV NL  SI 
Sbjct: 133 AIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQ--------QGYEAFVVNLPYSIT 184

Query: 337 DEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
            + L++ F   G +    V  D  G S+GFG V ++  E+  KAI   N   + G+ L V
Sbjct: 185 WQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV 244

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/331 (21%), Positives = 128/331 (38%), Gaps = 31/331 (9%)

Query: 99  EKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCK 158
           E+ + + +   P R      +  + K     +FI NL      + L D FS  G +++ +
Sbjct: 49  ERFHPSRVGPPPRRTYDRPYESGVEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAE 108

Query: 159 IATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV----APHVSKKDRQSKLD 214
           + +   G+S+  G V F         I   NG+   G +++V     P  S+++ +S   
Sbjct: 109 VMS-YRGRSKGMGTVEFTNPADAEEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSS-- 165

Query: 215 EVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAA 274
           E        +V N+         + +F + G +  A +E D  G  RGFG V + +    
Sbjct: 166 EPTQQGYEAFVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDM 225

Query: 275 AKAVEELNDTDFNGQKLYVGRAQKKY----------------------ERLQELKKQYES 312
            KA++  N  +  G+ L V   +  +                      E    L   +  
Sbjct: 226 FKAIDSFNGAELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNP 285

Query: 313 SRMEKLAKYQGVN--LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVC 370
           S  E ++     N  ++  NL  S     L + F   G I   +++ D+ G+S G   V 
Sbjct: 286 SFTEGVSGDGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVE 345

Query: 371 FSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
           +++ + A   I + N     G+ L++  A R
Sbjct: 346 YASQDAADVCINKLNGYNYGGRDLHITYASR 376

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 85/178 (47%), Gaps = 13/178 (7%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXX 183
           K S  +FI  L+       L + F  +G +   KI  D  TG+SR FGF+ F        
Sbjct: 156 KESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDE 215

Query: 184 XIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQ 243
            +   +  +L+G +V        +D Q K  ++       +V  I P+ +  EFE+ FSQ
Sbjct: 216 VVKTQH--ILDG-KVIDPKRAIPRDEQDKTGKI-------FVGGIGPDVRPKEFEEFFSQ 265

Query: 244 YGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           +G I  A L  D + G+ RGFGFV ++  +A  +  +     DF  +K+ + RA+ ++
Sbjct: 266 WGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQN-KFIDFKDRKIEIKRAEPRH 322

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 79/156 (50%), Gaps = 13/156 (8%)

Query: 26  TSTDSESTKGEAS--SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
           T T  E +K + S  S  +++G L+   TE  L + F   G+V+ +++ +D  T  S G+
Sbjct: 143 TQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGF 202

Query: 84  AYVNFHDHNAGTTAIEKLNYTPIKGR---PCRIMWSQRDPSLRKKGSGNVFIKNLHPAID 140
            +++F   ++    ++  +   + G+   P R +     P   +  +G +F+  + P + 
Sbjct: 203 GFLSFEKPSSVDEVVKTQHI--LDGKVIDPKRAI-----PRDEQDKTGKIFVGGIGPDVR 255

Query: 141 NKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHF 175
            K   + FS +G I+  ++  D +TG+SR FGFV +
Sbjct: 256 PKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY 291

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 98/205 (47%), Gaps = 34/205 (16%)

Query: 207 KDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS-AVLETDNEGKLRGFGF 265
           K+ +SK D  K +   +++  ++ +T +D   + F +YG +T   +++    G+ RGFGF
Sbjct: 146 KEERSKADLSKES-CKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGF 204

Query: 266 VNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVN 325
           ++FE       +V+E+  T    Q +  G+       + + K+       +K  K     
Sbjct: 205 LSFE----KPSSVDEVVKT----QHILDGK-------VIDPKRAIPRDEQDKTGK----- 244

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEK 384
           +FV  +   +  ++ +E F+ +GTI   ++M D D G S+GFGFV + + +   +    K
Sbjct: 245 IFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNK 304

Query: 385 NQQIVAGKPLYVAIAQRK-EVRRSQ 408
                     ++    RK E++R++
Sbjct: 305 ----------FIDFKDRKIEIKRAE 319

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 129/318 (40%), Gaps = 62/318 (19%)

Query: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVS-SIRVCRDAITKTSLGYAYVNFHDHNAG 94
           + SS  LY+G+LDPS TE  +  +++ +G  +  +++ +++    + GY +V F  + A 
Sbjct: 48  DTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAA 107

Query: 95  TTAIEKLNYTPI---KGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTF-SV 150
           T A+ K    PI     R  ++ W+    +   + S  +F+ +L P +    L + F S 
Sbjct: 108 TNALLKTGL-PIPVDASRTLKLNWASFATTPGSEFS--IFVGDLAPNVTESQLFELFISR 164

Query: 151 FGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDR 209
           + + L+ KI  D+ TG S+ +GFV F         +  + G+ LNG  + V+     K R
Sbjct: 165 YSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSR 224

Query: 210 ------------------------------QSKLDEVK----------------SNFTNV 223
                                         Q+ L + +                 N T V
Sbjct: 225 FQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTV 284

Query: 224 YVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELND 283
           ++  +     +DE    F  +G I    +        +G GFV + D ++A  A+ ++  
Sbjct: 285 FIGGLSSLVTEDELRAYFQPFGQIVYVKIPVG-----KGCGFVQYVDRSSAENAIAKMQG 339

Query: 284 TDFNGQ--KLYVGRAQKK 299
                   +L  GR+ K+
Sbjct: 340 FPIGNSRVRLSWGRSAKQ 357

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 113/297 (38%), Gaps = 51/297 (17%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFG--NILSCKIATDETGKSRKFGFVHFXXXXXXXXX 184
           S  +++ +L P+     +   ++  G  N+    I     G +  + FV F         
Sbjct: 51  STQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSN------ 104

Query: 185 IDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDE-FEKLFSQ 243
           + A N +L  GL + V    + K   +       +  +++V ++ P   + + FE   S+
Sbjct: 105 LAATNALLKTGLPIPVDASRTLKLNWASFATTPGSEFSIFVGDLAPNVTESQLFELFISR 164

Query: 244 YGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYER 302
           Y +  +A +  D   G  +G+GFV F +     +++ E+     NG+ + V    K   R
Sbjct: 165 YSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSR 224

Query: 303 ---------------------------------LQELKKQYESSRMEKLAKYQGVN---L 326
                                            LQ+ +  Y   +   L+++   N   +
Sbjct: 225 FQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTV 284

Query: 327 FVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITE 383
           F+  L   + +++L+  F PFG I  VK+        KG GFV +     A  AI +
Sbjct: 285 FIGGLSSLVTEDELRAYFQPFGQIVYVKIPVG-----KGCGFVQYVDRSSAENAIAK 336

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 89/189 (47%), Gaps = 20/189 (10%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGA--ITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           T +Y+ ++DP   + + +++++  G   +   +++  + G   G+ FV F  + AA  A+
Sbjct: 52  TQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAATNAL 111

Query: 279 EELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDE 338
            +       G  + V       +  + LK  + S      +++   ++FV +L  ++ + 
Sbjct: 112 LK------TGLPIPV-------DASRTLKLNWASFATTPGSEF---SIFVGDLAPNVTES 155

Query: 339 KLQEEF-APFGTITSVKVMRDDA-GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           +L E F + + +  + K++ D   G SKG+GFV F    E  +++ E     + G+ + V
Sbjct: 156 QLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRV 215

Query: 397 AIAQRKEVR 405
           +   + + R
Sbjct: 216 STTSKNKSR 224

>Scas_558.1
          Length = 435

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 106/243 (43%), Gaps = 17/243 (6%)

Query: 214 DEVKSNFTN-VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHN 272
           ++V  N+ N ++V N+  +   ++    FS  G +  A + T ++G  RG G V F +  
Sbjct: 97  EKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADIIT-SKGHHRGMGTVEFTNSR 155

Query: 273 AAAKAVEELNDTDFNGQKLYVGRAQ-----KKYERLQELKKQYESSRMEKLAK------- 320
              +A+ + + + F  ++++V +        + ER    +    SSR + ++        
Sbjct: 156 DVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQS 215

Query: 321 --YQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEAT 378
              QG  +FV NL  SI+ + L++ F   G +    V  D AG S+GFG V F T ++  
Sbjct: 216 NMKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDME 275

Query: 379 KAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMRYQQXXXXXXXXXGMPGQF 438
           +AI   N+  V G+ L V        R   +  Q Q +N M              +P Q 
Sbjct: 276 RAIDRYNRFEVDGRTLDVREGHSNN-RNDDMNIQHQTQNAMTNDATSDATSNERSLPTQP 334

Query: 439 MQP 441
            +P
Sbjct: 335 SEP 337

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 121/336 (36%), Gaps = 85/336 (25%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHNAGTTAI 98
           S++VG L    T   L D FS IG V    V  D IT      G   V F +      AI
Sbjct: 106 SIFVGNLTYDCTPEDLRDYFSGIGEV----VRADIITSKGHHRGMGTVEFTNSRDVEEAI 161

Query: 99  EKLNYT---------------PIKGR----PCRIMWSQRDPSLRKK--GSG--------- 128
            + + +               P  GR    P R   +   PS R++   SG         
Sbjct: 162 RQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTA---PSSRQQDISSGAYSMQSNMK 218

Query: 129 ---NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXI 185
               +F+ NL  +I+ +AL D F   G+++   +  D  G+SR FG V F         I
Sbjct: 219 QGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDMERAI 278

Query: 186 DAINGMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFTN--------------------- 222
           D  N   ++G  L+V      ++ D  +   + ++  TN                     
Sbjct: 279 DRYNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTNDATSDATSNERSLPTQPSEPA 338

Query: 223 --------------------VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRG 262
                               +Y  N+ P T + +   LF   G + +A L+ D  G+  G
Sbjct: 339 SNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTG 398

Query: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQK 298
              V F   + A   +E LN  ++ G  L +  A++
Sbjct: 399 VAIVEFISQDDADVCIERLNKYNYGGCDLEISYAKR 434

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 51/120 (42%), Gaps = 6/120 (5%)

Query: 4   VTDKTAEQLEQLRIQDEQPTGPTSTDSES-----TKGEASSASLYVGELDPSVTEALLYD 58
             D T++     R    QP+ P S  + +      +G   +  +Y   L PS   + LYD
Sbjct: 316 TNDATSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYD 375

Query: 59  LFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118
           LF  IG V +  +  D   +T+ G A V F   +     IE+LN     G    I +++R
Sbjct: 376 LFESIGKVRNAELKYDRNGETT-GVAIVEFISQDDADVCIERLNKYNYGGCDLEISYAKR 434

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 306 LKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKG 365
           L ++ +S+  EK+ +    ++FV NL      E L++ F+  G +    ++    G  +G
Sbjct: 87  LARELDSTYEEKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADII-TSKGHHRG 145

Query: 366 FGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
            G V F+   +  +AI + +      + ++V
Sbjct: 146 MGTVEFTNSRDVEEAIRQYDSSYFMDRQIFV 176

>Scas_635.7
          Length = 581

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 85/175 (48%), Gaps = 13/175 (7%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAI 188
           +FI  L+       L + FS +GN++  KI  D  TG+SR FGF+ F         +   
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 189 NGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAIT 248
           +  +L+G  +          ++S   E +     ++V  I  + +  EFE  F+QYG I 
Sbjct: 258 H--ILDGKVI--------DPKRSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTII 307

Query: 249 SAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYER 302
            A L  D + G+ RGFGFV ++  +A  +  +     +F G+++ + RA+ ++ +
Sbjct: 308 DAQLMLDKDTGRSRGFGFVTYDSGDAVDRVCQNKY-IEFKGKQIEIKRAEPRHNQ 361

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 97/208 (46%), Gaps = 27/208 (12%)

Query: 212 KLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS-AVLETDNEGKLRGFGFVNFED 270
           K D  K N   +++  ++ ET +D  +  FS+YG +    +++    G+ RGFGF+ FE+
Sbjct: 188 KADISKDN-CKMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFEN 246

Query: 271 HNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKN 330
            ++  + V+         Q +  G+       + + K+       +K  K     +FV  
Sbjct: 247 PSSVDEVVKT--------QHILDGK-------VIDPKRSIPREEQDKTGK-----IFVGG 286

Query: 331 LDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIV 389
           +   +  ++ ++ FA +GTI   ++M D D G S+GFGFV + + +   +    K  +  
Sbjct: 287 IGTDVRPKEFEDFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSGDAVDRVCQNKYIEF- 345

Query: 390 AGKPLYVAIAQRKEVRRSQLAQQIQARN 417
            GK + +   +R E R +Q A   Q  N
Sbjct: 346 KGKQIEI---KRAEPRHNQRAAASQPMN 370

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 70/138 (50%), Gaps = 11/138 (7%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           +++G L+   TE  L + FS  G+V  +++ +D  T  S G+ ++ F + ++    ++  
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 102 NYTPIKGR---PCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCK 158
           +   + G+   P R +     P   +  +G +F+  +   +  K   D F+ +G I+  +
Sbjct: 258 HI--LDGKVIDPKRSI-----PREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQ 310

Query: 159 IATD-ETGKSRKFGFVHF 175
           +  D +TG+SR FGFV +
Sbjct: 311 LMLDKDTGRSRGFGFVTY 328

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 91/191 (47%), Gaps = 8/191 (4%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +   ++V++I  +   +EF   FSQ+  I  +V+  D+E + RGFGFV+F   +   +A+
Sbjct: 24  DMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEAL 83

Query: 279 EELNDTDFNGQKLYVG------RAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLD 332
            +     F  + L +       R+++   R +   K Y+ S  E+L K +   L ++N+ 
Sbjct: 84  AQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKP-KLIIRNMP 142

Query: 333 DSIDDEK-LQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAG 391
            S  D   L++ F+ FGT+   K+ +   G   GF FV         +AI E     + G
Sbjct: 143 WSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDG 202

Query: 392 KPLYVAIAQRK 402
           + + +  A +K
Sbjct: 203 RQVAIDFAIQK 213

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 80/181 (44%), Gaps = 18/181 (9%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXI-DAI 188
           +F++++    +++   D FS F  I    I  D   +SR FGFV F         +  A 
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 189 NGMLLNG-LEVYVAPHVSKKDR-------------QSKLDEVKSNFTNVYVKNIDPETKQ 234
                N  L + +A    +  R             +S  +E+      + ++N+ P + +
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRNM-PWSCR 146

Query: 235 DE--FEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLY 292
           D    +KLFS++G +  A +     GKL GF FV  +  +A  +A+EE  D   +G+++ 
Sbjct: 147 DAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQVA 206

Query: 293 V 293
           +
Sbjct: 207 I 207

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 74/364 (20%), Positives = 135/364 (37%), Gaps = 57/364 (15%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +L+V  +     +    D FS    +    + +D+  K S G+ +V+F   +    A+ +
Sbjct: 27  TLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDS-EKQSRGFGFVSFAVEDDTKEALAQ 85

Query: 101 LNYTPIKGRPCRI-MWSQRDPSLRK--------------------KGSGNVFIKNL-HPA 138
                 K R  RI +  +R+ S R                     KG   + I+N+    
Sbjct: 86  ARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRNMPWSC 145

Query: 139 IDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEV 198
            D   L   FS FG ++  KI     GK   F FV           I+    M ++G +V
Sbjct: 146 RDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQV 205

Query: 199 YVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEG 258
            +   + K    +K +E K        K  +PE ++ E                +   E 
Sbjct: 206 AIDFAIQK----NKWEEHK--------KVQEPEDQESEDADNADDGDDDVDIDNDEKEEK 253

Query: 259 KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKL 318
                   N +D   +++  E  ++ + N             E ++E + +      +K 
Sbjct: 254 D----NLENSDDDEESSQQGESEDEVELNSD-----------EEVEEPQPR------QKK 292

Query: 319 AKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTIT-SVKVMRDDAGSSKGFGFVCFSTPEEA 377
            K +  ++FV+N+      E L+  F  FG +  ++ V+  + G +KG  FV F T E  
Sbjct: 293 NKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTEEAF 352

Query: 378 TKAI 381
           ++ +
Sbjct: 353 SECV 356

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           LFV+++    +DE+  + F+ F  I    +++D    S+GFGFV F+  ++  +A+ +  
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 386 QQIVAGKPLYVAIAQRKE 403
           +     + L + IA+R+E
Sbjct: 88  KAKFKNRLLRIDIAKRRE 105

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 258 GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVG 294
           G+ RG+GFV + DH AA   +  LN  +   Q++  G
Sbjct: 558 GRSRGYGFVEYRDHKAALMGLRWLNAHEVTRQEILEG 594

>Kwal_56.24709
          Length = 828

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 99/247 (40%), Gaps = 51/247 (20%)

Query: 96  TAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNIL 155
           +A+  L  +PI  +     WS    +      GN++++ +   +    L   FS FG +L
Sbjct: 214 SAVAALRASPIVSK-----WSVSVNAHALTHPGNLYVRGIPKDLTIDDLVPVFSKFGPVL 268

Query: 156 SCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQS--- 211
           S KI  D  +G S  +GF+ +         I  +NG L+NG  +++  HV +K+R+    
Sbjct: 269 SLKIICDSHSGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSALFINYHVERKERERIHW 328

Query: 212 ---KLDEVKSNFTNVYVKN----------IDPETK----QDEFEKLFSQYGAITSAVLET 254
              K D     F  V++ N          + PE      QD+      Q   I S  L  
Sbjct: 329 DHFKEDNDDDRFKGVFIGNLPTNHPDGSLVTPEHVIAKFQDQLRSKGEQPVHIVSYYLPK 388

Query: 255 DN-------------------------EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQ 289
            N                         E  L+G+GF+ F  H+ A  A++  N+ ++ G 
Sbjct: 389 RNSESDIEYRDDDDKTDDIETCISKHEESPLKGYGFIKFVSHDQALTAIDLFNNFEWLGN 448

Query: 290 KLYVGRA 296
           KL V +A
Sbjct: 449 KLVVNKA 455

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (52%), Gaps = 22/102 (21%)

Query: 322 QGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVM-----RDDA--------------GS 362
           Q  NL+VK+L  S  DE   + +  FG I S K++     ++D               GS
Sbjct: 608 QESNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGS 667

Query: 363 SKGFGFVCFSTPEEATKA--ITEKNQQIVAGKPLYVAIAQRK 402
           SKG+GFVCF  P +A++A  IT++  Q+     LYV+ AQ++
Sbjct: 668 SKGYGFVCFKNPLDASRAMMITDR-YQVDENHTLYVSFAQKR 708

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITE 383
           NL+V+ +   +  + L   F+ FG + S+K++ D  +G S G+GF+ +    +A++ I E
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 384 KNQQIVAGKPLYVAI-AQRKEVRR 406
            N  ++ G  L++    +RKE  R
Sbjct: 302 LNGNLMNGSALFINYHVERKERER 325

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEE 280
           N+YV+ I  +   D+   +FS++G + S  +  D+  G   G+GF+++   + A++ ++E
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 281 LNDTDFNGQKLYVGRAQKKYER 302
           LN    NG  L++    ++ ER
Sbjct: 302 LNGNLMNGSALFINYHVERKER 323

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 21/116 (18%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            +LYV  +   +T   L  +FS  G V S+++  D+ +  SLGY ++++   +  +  I+
Sbjct: 241 GNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIK 300

Query: 100 KLNYTPIKGRPC------------RIMWS---QRDPSLRKKGSGNVFIKNL---HP 137
           +LN   + G               RI W    + +   R KG   VFI NL   HP
Sbjct: 301 ELNGNLMNGSALFINYHVERKERERIHWDHFKEDNDDDRFKG---VFIGNLPTNHP 353

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 22/104 (21%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLET----DNEG---------------KLR 261
           +N+YVK++    + ++F + +  +G I SA + T     N+G                 +
Sbjct: 610 SNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSK 669

Query: 262 GFGFVNFEDHNAAAKA--VEELNDTDFNGQKLYVGRAQKKYERL 303
           G+GFV F++   A++A  + +    D N   LYV  AQK+ + +
Sbjct: 670 GYGFVCFKNPLDASRAMMITDRYQVDEN-HTLYVSFAQKRAKSI 712

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 88/197 (44%), Gaps = 14/197 (7%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +   ++V+NI  +    E    FSQ+  I  AV+  DN G  RGFGFV+F   +    A+
Sbjct: 14  DLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAAL 73

Query: 279 EELNDTDFNGQKLYVGRAQKKYERLQ---ELKKQYESSRMEK--------LAKYQGV-NL 326
           ++   T F G+ L V  A K+ ER +   E + Q  +   EK         A  +G   L
Sbjct: 74  DKGRKTQFKGRLLRVDVA-KRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKL 132

Query: 327 FVKNLDDSIDD-EKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
            ++N+  S  D  KL++ F  FG +    + R   G   GF FV         KAI E  
Sbjct: 133 IIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECK 192

Query: 386 QQIVAGKPLYVAIAQRK 402
              + G+ + V  A +K
Sbjct: 193 GLKIDGREVAVDFAVQK 209

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 81/190 (42%), Gaps = 30/190 (15%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +F++N+     +  L D FS F  I    I  D  G SR FGFV F         +D   
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 190 GMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFT----------------------NVYV 225
                G  L V VA    +++R  K DE ++  +                       + +
Sbjct: 78  KTQFKGRLLRVDVA---KRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLII 134

Query: 226 KNIDPETKQD--EFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELND 283
           +N+ P + +D  + +K+F ++G +  A +    +GKL GF FV  +  +   KA+EE   
Sbjct: 135 RNM-PWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKG 193

Query: 284 TDFNGQKLYV 293
              +G+++ V
Sbjct: 194 LKIDGREVAV 203

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (57%), Gaps = 2/90 (2%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           LFV+N+     D +L + F+ F  I    +++D+AGSS+GFGFV F+   +   A+ +  
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 386 QQIVAGKPLYVAIAQRKEVRRSQLAQQIQA 415
           +    G+ L V +A+R+E  RS+   + +A
Sbjct: 78  KTQFKGRLLRVDVAKRRE--RSKKGDEAEA 105

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 69/188 (36%), Gaps = 29/188 (15%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +L+V  +    T+A L D FS    +    + +D    +S G+ +V+F   +    A++K
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAG-SSRGFGFVSFAVESDTQAALDK 75

Query: 101 LNYTPIKGRPCRIMWSQRDPSLRK---------------------------KGSGNVFIK 133
              T  KGR  R+  ++R    +K                           +G   + I+
Sbjct: 76  GRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIR 135

Query: 134 NL-HPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGML 192
           N+     D   L   F  FG +    I     GK   F FV           I+   G+ 
Sbjct: 136 NMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLK 195

Query: 193 LNGLEVYV 200
           ++G EV V
Sbjct: 196 IDGREVAV 203

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 217 KSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKL-RGFGFVNFEDHN 272
           + NF+ V+V+N+  +  Q+  E  FS++G +  A+   D E  L +G  FV F+D +
Sbjct: 285 RENFS-VFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDES 340

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 96/209 (45%), Gaps = 22/209 (10%)

Query: 215 EVKSNF---TNVYVKNIDPETKQDEFEKLFSQYG-AITSAVLETDNEGKLRGFGFVNFED 270
           E+  NF     ++V N  P +  +  + LFSQYG ++ S  L +      R F +++F  
Sbjct: 174 EIVVNFLKDATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKFDSNRRFAYIDFAS 233

Query: 271 HNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKN 330
            + A  A+ +LN+T  +G  L V ++             +E S+    A  +   +F++ 
Sbjct: 234 SDEANTAMSKLNNTSHDGYILVVKKSN-----------PHEKSKRTDAATLEKREIFIRK 282

Query: 331 LD-DSIDDEKLQEEFAPFGTITSVKV--MRDDAGSSK---GFGFVCFSTPEEATKAITEK 384
           LD   +   KL +    +G +  V +    D   S+K   GF FV ++  E A KA+ E 
Sbjct: 283 LDFYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKAL-EL 341

Query: 385 NQQIVAGKPLYVAIAQRKEVRRSQLAQQI 413
           N  +  G+ L V+IA RK     Q  ++I
Sbjct: 342 NMSVFEGRVLAVSIADRKPYLERQEVKRI 370

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIG-SVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           A+L+V    P+ T   L  LFS  G SV S+R+       ++  +AY++F   +   TA+
Sbjct: 183 ATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKF-DSNRRFAYIDFASSDEANTAM 241

Query: 99  EKLNYTPIKG 108
            KLN T   G
Sbjct: 242 SKLNNTSHDG 251

>Kwal_23.3985
          Length = 876

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 92/200 (46%), Gaps = 11/200 (5%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGK------SRKFGFVHFXXXXXXX 182
           ++F+KNL+ +   K L + F  FG  +  ++ T    K      S  FGF  F       
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 183 XXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFS 242
             IDA++G +L+G  + +     +  + S   + K     + VKN+  E ++ +  +LFS
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 243 QYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYER 302
            +G + S  L    +   RGF FV F     A  A+E+L      G++L +  A+++ + 
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829

Query: 303 LQELKKQYESSRMEKLAKYQ 322
            +E     + +RM K  + Q
Sbjct: 830 AEE-----QIARMTKKVRSQ 844

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 101/420 (24%), Positives = 163/420 (38%), Gaps = 74/420 (17%)

Query: 38  SSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA 97
           ++  L++  +  + TE     LF+P G +  + V  D  T  S G+AYV F +      A
Sbjct: 331 ATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANA 390

Query: 98  IEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKAL-------HDTFSV 150
             +L+    +GR   I+  ++  S R        +KNL P    ++L       HDTFS 
Sbjct: 391 YVELDKQIFQGRLLHILPGEQKKSHR---LDEFDLKNL-PLKKQRSLKRKANASHDTFS- 445

Query: 151 FGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN--GMLLNGL-EVYVAPHV--- 204
           + ++   + A          G V           IDA +    +   L E +V   V   
Sbjct: 446 WNSLYMNQDAV--------LGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKY 497

Query: 205 --SKKDRQSKLDEVKS----NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEG 258
             SK    +K ++ KS    + T + VKN    T   E   LF  +G +   +L      
Sbjct: 498 FESKGMDLTKFEQFKSPSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPP---- 553

Query: 259 KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK-YERLQE-----LKKQYES 312
             +    V + D  +A  A  +L+   F    LY+ +  K  + R  E     + +    
Sbjct: 554 -AQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQ 612

Query: 313 SRMEKLAKYQG-------------------------VNLFVKNLDDSIDDEKLQEEFAPF 347
           S   K A+  G                         V++FVKNL+ S   ++L E+F  F
Sbjct: 613 STNVKEARTTGDEIMQTATASKPEDDGTDDVVDGPTVSIFVKNLNFSTTGKELTEKFKTF 672

Query: 348 G--TITSVKVMRDDAGSSK----GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
           G   +  VK   D   S+K    GFGF  F T E+A   I   +  ++ G  + + ++ R
Sbjct: 673 GGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHR 732

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEK 384
           LF++N+  +  ++  ++ FAPFG +  V V  D   G SKGF +V F  P +A  A  E 
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 385 NQQIVAGKPLYVAIAQRKEVRR 406
           ++QI  G+ L++   ++K+  R
Sbjct: 395 DKQIFQGRLLHILPGEQKKSHR 416

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 86/186 (46%), Gaps = 16/186 (8%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLET------DNEGKLRGFGFVNFEDHNAA 274
            +++VKN++  T   E  + F  +G    A ++T       N+    GFGF  F+    A
Sbjct: 649 VSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQA 708

Query: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDS 334
              ++ ++    +G ++          +L+   +Q   S     +K     + VKNL   
Sbjct: 709 LAVIDAMDGAVLDGHRI----------QLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFE 758

Query: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
           ++ +++ E F+ FG + SV++ +    S++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 759 VERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818

Query: 395 YVAIAQ 400
            +  A+
Sbjct: 819 VMQHAE 824

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/168 (19%), Positives = 66/168 (39%), Gaps = 11/168 (6%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVC-----RDAITKTSLGYAYVNFHDHNA 93
           + S++V  L+ S T   L + F   G     +V      +++    S+G+ +  F     
Sbjct: 648 TVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQ 707

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGN------VFIKNLHPAIDNKALHDT 147
               I+ ++   + G   ++  S R          +      + +KNL   ++ K + + 
Sbjct: 708 ALAVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFEL 767

Query: 148 FSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG 195
           FS FG + S ++       +R F FV F         ++ + G+ L G
Sbjct: 768 FSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLG 815

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%)

Query: 349 TITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
           ++T VK++++ AG S+ F FV F + E+A  A+   +Q  +    + V++A+
Sbjct: 38  SLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAK 89

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           + V  L   V    +++LFS  G + S+R+ +    K++ G+A+V F        A+E+L
Sbjct: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808

Query: 102 NYTPIKGRPCRIMWSQRDP 120
               + GR   +  ++ +P
Sbjct: 809 QGVHLLGRRLVMQHAEEEP 827

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXX 183
           + +G +F++N+            F+ FG +    +A D  TGKS+ F +V F        
Sbjct: 330 EATGRLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAAN 389

Query: 184 XIDAINGMLLNGLEVYVAPHVSKKDRQSKLDE 215
               ++  +  G  +++ P   KK    +LDE
Sbjct: 390 AYVELDKQIFQGRLLHILPGEQKKSH--RLDE 419

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 4/179 (2%)

Query: 219 NFTN-VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKA 277
           N++N V++ N+  +T  ++  +LF + G +  A + T + G  RG G V + +     +A
Sbjct: 4   NYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIIT-SRGHHRGMGTVEYTNAQDVDEA 62

Query: 278 VEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDD 337
           +   N  DF  ++L+V R       + E +++     + +     G  +FV NL  SI  
Sbjct: 63  IRRFNGMDFMHRELFVRRDNPP--PVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISW 120

Query: 338 EKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           + L++ F     +    V  D  G S+GFG V  +T E    AI   N   + G+ L V
Sbjct: 121 QTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 66/181 (36%), Gaps = 28/181 (15%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHNAGTT 96
           S S+++G L    T   L  LF  +G V    V  D IT      G   V + +      
Sbjct: 6   SNSVFIGNLTYDTTPEDLRQLFGEVGHV----VRADIITSRGHHRGMGTVEYTNAQDVDE 61

Query: 97  AIEKLNYTPIKGRPCRIMWSQRD-----------------PSLRKKGSGNVFIKNLHPAI 139
           AI + N      R    ++ +RD                 P     G   +F+ NL  +I
Sbjct: 62  AIRRFNGMDFMHRE---LFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSI 118

Query: 140 DNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG--LE 197
             + L D F     ++   ++ D  G SR FG V+          I+  NG  L G  LE
Sbjct: 119 SWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILE 178

Query: 198 V 198
           V
Sbjct: 179 V 179

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           +Y +N+   T + +   LF   G +  A L+ D+EG   G     FE    A + +E LN
Sbjct: 261 IYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLN 320

Query: 283 DTDFNGQKL 291
           +  + G  L
Sbjct: 321 NYHYGGCDL 329

>Scas_645.14
          Length = 717

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 91/222 (40%), Gaps = 37/222 (16%)

Query: 111 CRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRK- 169
           C   WS           GN+FI  ++  ID   +   F  FG+ILS K+  D    S   
Sbjct: 164 CIEKWSISINKHALTHPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTN 223

Query: 170 ---------FGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQS-KLDEVKSN 219
                    +GF+ F         I+  NG ++ G ++++  HV +K+R+  +   +K N
Sbjct: 224 NSTSSNPIGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKEN 283

Query: 220 -----FTNVYVKNIDPETKQD-EFEKLFSQYGAITSAVLET------------------- 254
                F  +++ N+ P T  D   + +  +     S VL +                   
Sbjct: 284 NDDEKFKCIFIGNL-PTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNIN 342

Query: 255 DNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRA 296
           +    L+G+GFVN   H  A K ++ L+  ++ G +L V +A
Sbjct: 343 NKSSPLKGYGFVNLGSHEQALKVIQTLDGLEWKGNRLVVNKA 384

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 11/98 (11%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSK----------GFGFVCFSTP 374
           N+F+  ++  ID+ K++  F  FG+I S+K+  D   +S           G+GF+ F   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 375 EEATKAITEKNQQIVAGKPLYVAI-AQRKEVRRSQLAQ 411
            +A++ I E N +I+ G  L++    +RKE  R Q + 
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSH 279

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 50/131 (38%)

Query: 322 QGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVM------------------------- 356
           Q  NL+VK++  S  D++L + F+ FG I S KV+                         
Sbjct: 522 QESNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQE 581

Query: 357 ---RDD---------------------AGSSKGFGFVCFSTPEEATKAITEKNQQIVA-G 391
              ++D                      G S+G+GFVCF  P +A++AI   +  I++  
Sbjct: 582 HNDKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPN 641

Query: 392 KPLYVAIAQRK 402
             L V+ AQ++
Sbjct: 642 NILNVSFAQKR 652

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 84/193 (43%), Gaps = 41/193 (21%)

Query: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLR----------GFGFVNFEDH 271
           N+++  I+ +  + +   LF ++G+I S  L  D                G+GF++F   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 272 NAAAKAVEELNDTDFNGQKLYVGR--AQKKYERLQELKKQYESSRMEKLAKYQGVNLFVK 329
           + A++ + E N     G KL++     +K+ ER+Q      E++  EK        +F+ 
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERKERERIQ-WSHIKENNDDEKFKC-----IFIG 295

Query: 330 NLDDSIDD-------EKLQEEFAPFGTITSVKVMR--------------DDAGSSKGFGF 368
           NL  ++ D       +K++ E +    + S++++               + +   KG+GF
Sbjct: 296 NLPTTLTDLTIDLILDKIKTELSE--VLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGF 353

Query: 369 VCFSTPEEATKAI 381
           V   + E+A K I
Sbjct: 354 VNLGSHEQALKVI 366

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/155 (18%), Positives = 62/155 (40%), Gaps = 25/155 (16%)

Query: 6   DKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASS----ASLYVGELDPSVTEALLYDLFS 61
           +K  + ++      E P+ P   +  S      +     ++++G ++  + E+ +  LF 
Sbjct: 143 EKCRDSIDTFLHSKEDPSFPNCIEKWSISINKHALTHPGNIFIGGINHKIDESKIRALFE 202

Query: 62  PIGSVSSIRVCRDAITKTS---------LGYAYVNFHDHNAGTTAIEKLNYTPIKGRPC- 111
             GS+ SI++  D +  ++         +GY +++F   +  +  I + N   I+G    
Sbjct: 203 KFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGSQASECINEFNGKIIEGTKLF 262

Query: 112 -----------RIMWSQRDPSLRKKGSGNVFIKNL 135
                      RI WS    +   +    +FI NL
Sbjct: 263 LNYHVERKERERIQWSHIKENNDDEKFKCIFIGNL 297

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 54/141 (38%), Gaps = 50/141 (35%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLET-------DNE---------------- 257
           +N+YVK+I    + DE    FSQ+G I S+ + T       DN+                
Sbjct: 524 SNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQEHN 583

Query: 258 --------------------------GKLRGFGFVNFEDHNAAAKAVEELNDTDFN-GQK 290
                                     G  RG+GFV FE+   A++A+   +    +    
Sbjct: 584 DKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPNNI 643

Query: 291 LYVGRAQKKYERLQELKKQYE 311
           L V  AQK+Y++L + K   E
Sbjct: 644 LNVSFAQKRYKKLAKDKNTSE 664

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 38  SSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA 97
           +  ++YVG LDP V++ LLY+LF  +  VS IR  +D + +   G+A+V          A
Sbjct: 5   TECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFA 64

Query: 98  IEKLNYT-PIKGRPCRIMWSQRDP--SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFG 152
           I+ LN T  + G+  ++  +  +   S        +F+KNL   ID   L   F  FG
Sbjct: 65  IKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFG 122

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 85/184 (46%), Gaps = 22/184 (11%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVE 279
             VYV N+DP+  ++   +LF Q   ++      D  + + +GF FV          A++
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIK 66

Query: 280 ELNDT-DFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDE 338
            LN+T    G+ L V R          L+    S+ +   AK     LFVKNLD +ID  
Sbjct: 67  SLNNTVSLFGKVLKVRRT---------LENAKNSAPVFARAK-----LFVKNLDSTIDAV 112

Query: 339 KLQEEFAPFGTITS---VKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 395
           +LQ+ F  FG +     +  ++D A       +V F+T   + +A+ + N QIVA + + 
Sbjct: 113 QLQKLFGKFGPLAKPPQLFTLKDGALRC---AYVYFTTFRHSDEALEKLNNQIVANQIIS 169

Query: 396 VAIA 399
           +  A
Sbjct: 170 IDYA 173

>Kwal_55.20154
          Length = 522

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/335 (21%), Positives = 132/335 (39%), Gaps = 58/335 (17%)

Query: 23  TGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVS-SIRVCRDAITK-TS 80
           +G  S    S      S SLY+G+LDP+  EA +  +++ +G  +  I++ R + +   +
Sbjct: 28  SGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHN 87

Query: 81  LGYAYVNFHDHNAGTTAIEK--LNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPA 138
            GY +V F  H   + A+ K  L       R  ++ W+    +   + S  VF+ ++ P 
Sbjct: 88  SGYCFVEFPSHTNASNALLKNGLVIPNTGNRILKLNWASFATTPGNEYS--VFVGDVAPN 145

Query: 139 IDNKALHDTF-SVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGL 196
           +    L + F S + + L+ KI  D+ TG S+ +GFV F         +  + G+ LNG 
Sbjct: 146 VTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGR 205

Query: 197 EVYV--------------------------------APHVSKKDRQSKL----------- 213
            + V                                AP  +    QS+            
Sbjct: 206 AIRVSTTSKNRPKFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLT 265

Query: 214 DEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNA 273
                N T V++  +     +DE    F  +G+I    +        +G GFV + D  +
Sbjct: 266 QYTDPNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVG-----KGCGFVQYVDRLS 320

Query: 274 AAKAVEELNDTDFNGQ--KLYVGRAQKKYERLQEL 306
           A  A+ ++          +L  GR+ K+   +Q++
Sbjct: 321 AETAIAKMQGFPIGNSRIRLSWGRSAKQAAVMQKV 355

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 117/295 (39%), Gaps = 49/295 (16%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFG--NI-LSCKIATDETGKSRKFGFVHFXXXXXXXX 183
           S ++++ +L P  D  A+   ++  G  N+ +    ++   G +  + FV F        
Sbjct: 44  SNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSH----- 98

Query: 184 XIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPE-TKQDEFEKLFS 242
             +A N +L NGL +    +   K   +       N  +V+V ++ P  T+   FE   S
Sbjct: 99  -TNASNALLKNGLVIPNTGNRILKLNWASFATTPGNEYSVFVGDVAPNVTEAQLFELFIS 157

Query: 243 QYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYE 301
           +Y +  +A +  D   G  +G+GFV F   +   +++ E+     NG+ + V    K   
Sbjct: 158 RYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRP 217

Query: 302 RLQELKKQ------------------------------YESSRMEKLAKYQGVN---LFV 328
           + Q+++                                Y   +   L +Y   N   +F+
Sbjct: 218 KFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFI 277

Query: 329 KNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITE 383
             L   + +++L+  F PFG+I  VK+        KG GFV +     A  AI +
Sbjct: 278 GGLSSLVTEDELRAFFQPFGSIVYVKIPVG-----KGCGFVQYVDRLSAETAIAK 327

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 13/96 (13%)

Query: 20  EQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKT 79
           +QPT    TD  +T       ++++G L   VTE  L   F P GS+  +++        
Sbjct: 260 QQPTLTQYTDPNNT-------TVFIGGLSSLVTEDELRAFFQPFGSIVYVKI------PV 306

Query: 80  SLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMW 115
             G  +V + D  +  TAI K+   PI     R+ W
Sbjct: 307 GKGCGFVQYVDRLSAETAIAKMQGFPIGNSRIRLSW 342

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 88/204 (43%), Gaps = 22/204 (10%)

Query: 204 VSKKDRQSKLDEVKSNFTN-VYVKNIDPETKQDEFEKLFSQYG---AITSAVLETDNEGK 259
           +S    QS   E  S  +N +Y+ ++DP   +     +++  G        +  + + G 
Sbjct: 27  MSGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGH 86

Query: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319
             G+ FV F  H  A+ A+ +      NG  L +     +      LK  + S       
Sbjct: 87  NSGYCFVEFPSHTNASNALLK------NG--LVIPNTGNRI-----LKLNWASFATTPGN 133

Query: 320 KYQGVNLFVKNLDDSIDDEKLQEEF-APFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEA 377
           +Y   ++FV ++  ++ + +L E F + + +  + K++ D   G SKG+GFV F    E 
Sbjct: 134 EY---SVFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQ 190

Query: 378 TKAITEKNQQIVAGKPLYVAIAQR 401
            +++ E     + G+ + V+   +
Sbjct: 191 QRSLLEMQGVFLNGRAIRVSTTSK 214

>Scas_665.4
          Length = 219

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 77/170 (45%), Gaps = 17/170 (10%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            ++YVG +DP VT+  LY+LF  +  +S +R  +D I +   GYA++ F+        I+
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQ 69

Query: 100 KLNYT-PIKGRPCRIMWSQRDPSLRKKGS--------------GNVFIKNLHPAIDNKAL 144
            +N T  +  R  ++  S ++P+    G+                +F+KNL  +I+N  L
Sbjct: 70  VMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQL 129

Query: 145 HDTFSVFGNILS-CKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLL 193
              F  FG +    +I     GK R   +++F         I  +N  L+
Sbjct: 130 IKLFQKFGPLFKDPEIFFLSNGKLR-CAYIYFKFYENSDMAIAKLNNELI 178

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 24/191 (12%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAVE 279
           T VYV NIDP+  +++  +LF Q   I+      D   ++ +G+ F+ F         ++
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQ 69

Query: 280 ELNDTDFNGQKLYVGRAQKKYERLQELKK--QYESSRMEKLAKYQGVN---------LFV 328
            +N+T               Y+R  ++++  Q  +S M      +  N         LFV
Sbjct: 70  VMNNT------------VALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFV 117

Query: 329 KNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQI 388
           KNLD+SI++ +L + F  FG +     +   +       ++ F   E +  AI + N ++
Sbjct: 118 KNLDESIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRCAYIYFKFYENSDMAIAKLNNEL 177

Query: 389 VAGKPLYVAIA 399
           +  K + V  A
Sbjct: 178 IVNKRINVDYA 188

>Kwal_27.12337
          Length = 209

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 22/126 (17%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           ++YVG +DP VT  +LY+LF  I  V+ IR  +D I +T  G+A+V F++      A + 
Sbjct: 11  TVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKC 70

Query: 101 LNYTPIKGRPCRIMWSQRDPSLRK-KGSGN-------------VFIKNLHPAIDNKALHD 146
           LN +        +    R   +RK  G+G+             +F+KN+   +D  AL  
Sbjct: 71  LNNS--------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTR 122

Query: 147 TFSVFG 152
            FS FG
Sbjct: 123 IFSKFG 128

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 81/181 (44%), Gaps = 27/181 (14%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSA------VLETDNEGKLRGFGFVNFEDHNAAAK 276
           VYV N+DP+  ++   +LF Q   +         +L+T      +GF FV F +      
Sbjct: 12  VYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTH-----QGFAFVEFYNAQDCEY 66

Query: 277 AVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRM--EKLAKYQGVNLFVKNLDDS 334
           A + LN++             + Y+R  +++K   +      + A   G  LFVKN+D+ 
Sbjct: 67  ATKCLNNS------------LRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDEL 114

Query: 335 IDDEKLQEEFAPFGTITSV-KVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 393
           +D   L   F+ FG +    ++     G  K   +V ++T E + KA+ + N Q+V  K 
Sbjct: 115 VDATALTRIFSKFGPLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKC 173

Query: 394 L 394
           +
Sbjct: 174 I 174

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 18/201 (8%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +   ++V+ +  E+  +EF   FSQ+  I  AV+  D EG  RGFGFV+F   +    A+
Sbjct: 13  DLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTAL 72

Query: 279 EELNDTDFNGQKLYVGRAQKKYERLQELKKQYESS--------RMEKLAKYQGVN----- 325
            +   T F G+ L +  A K+ ER +  K   E S        + E+ +K +  N     
Sbjct: 73  NQARKTKFMGRLLRIDIA-KRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKG 131

Query: 326 ---LFVKNLDDSIDD-EKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
              L ++N+  S  D  KL++ F  +GT+    + R   G   GF FV  +       AI
Sbjct: 132 KPKLIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAI 191

Query: 382 TEKNQQIVAGKPLYVAIAQRK 402
                  + G+ + V  A +K
Sbjct: 192 EGTKDLKIDGRKVAVDFAIQK 212

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 53/96 (55%), Gaps = 3/96 (3%)

Query: 316 EKLAKYQGVNL---FVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFS 372
           +K+ K +G++L   FV+ +     DE+    F+ F  I    +++D  G+S+GFGFV F+
Sbjct: 4   KKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFA 63

Query: 373 TPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQ 408
             ++   A+ +  +    G+ L + IA+R+E  R +
Sbjct: 64  VEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGK 99

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 74/190 (38%), Gaps = 27/190 (14%)

Query: 148 FSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG--LEVYVAPHVS 205
           FS F  I    I  D  G SR FGFV F         ++        G  L + +A    
Sbjct: 35  FSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRIDIAKRRE 94

Query: 206 KKDRQSKLDEVKSNFTNVYVKNID---PETKQD---------------------EFEKLF 241
           +   +   DEV S  +   VK+ +   PE   D                     + +K+F
Sbjct: 95  RSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPTKLKKIF 154

Query: 242 SQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYE 301
             YG +  A +    +G+L GF FV     +    A+E   D   +G+K+ V  A +K  
Sbjct: 155 GLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAVDFAIQK-N 213

Query: 302 RLQELKKQYE 311
           R ++ K +++
Sbjct: 214 RWEDYKNEHK 223

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 228 IDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           I+ + K+D+ + +  Q   I    ++  + G+ RG+GFV F DH AA   +  LN
Sbjct: 528 IEAQKKKDKKQGIVRQSKIIME--IKGSSGGRSRGYGFVEFRDHKAALMCLRWLN 580

>KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181
           Saccharomyces cerevisiae YOR319w HSH49 essential yeast
           splicing factor, start by similarity
          Length = 203

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 4/121 (3%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCR---DAITKTSLGYAYVNFHDHNAGT 95
           S ++YVG LD  V ++LLY+LF   G +S I+  +   D        YA++ F + +   
Sbjct: 2   SNTVYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDY 61

Query: 96  TAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSG-NVFIKNLHPAIDNKALHDTFSVFGNI 154
                 N   + G+P ++  S + P       G  +F+KNL  +ID   L + F +FG +
Sbjct: 62  VCKLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKL 121

Query: 155 L 155
           L
Sbjct: 122 L 122

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 90/192 (46%), Gaps = 25/192 (13%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVL----ETDNEGKLRGFGFVNF--EDHNAAAK 276
           VYV N+D    +    +LF Q G I+        + +++ +   + F+ F  +D +   K
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 277 AVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSID 336
             +  N     G+ L V R+ K          Q E++  +      G  LFVKNLD+SID
Sbjct: 65  LFD--NRVSLYGKPLKVRRSNK----------QPETTDFD-----VGAKLFVKNLDESID 107

Query: 337 DEKLQEEFAPFGTITSV-KVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 395
             +L   F  FG +    +V     G+ +   +V F+T + + +A+ + N+  +A K +Y
Sbjct: 108 VPQLSNIFKIFGKLLRKPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIY 166

Query: 396 VAIAQRKEVRRS 407
           +  A + +++++
Sbjct: 167 IDYAYKDDMQKT 178

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 93/418 (22%), Positives = 155/418 (37%), Gaps = 73/418 (17%)

Query: 38  SSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA 97
           ++  L++  +    TE     LFSP G +  + V  D  T  S G+AYV F D      A
Sbjct: 299 ATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANA 358

Query: 98  IEKLNYTPIKGRPCRIMWS--------------------QRDPSLRKKGSGNVFIKNLHP 137
             +L+    +GR   I+ +                    QR+   +   +   F  N   
Sbjct: 359 YIELDKQIFQGRLLHILPADAKKTHRLDEFDLKNLPLKKQRELKRKATAAQQTFSWNSLF 418

Query: 138 AIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLE 197
              +  L    +  G   S  I  + +G + K                +A  G+ L   E
Sbjct: 419 MNQDAVLSSVAAKLGMEKSQLIDPENSGSAVKQALAEAHVIGDVRKYFEA-RGVDLTQFE 477

Query: 198 VYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE 257
            +    V+++D     D +      + VKN    T ++E  +LF  +G I   ++     
Sbjct: 478 KF--KKVTERD-----DRI------ILVKNFPHGTTREELAELFLPFGKIERMLMPPSG- 523

Query: 258 GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY----------------- 300
                   + + D  AA  A  +L+   F    LY+ +  K                   
Sbjct: 524 ----TIAIIQYRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFSREPRGDELLEGDAAP 579

Query: 301 ERLQELKKQYESSRMEKLAKYQG----------VNLFVKNLDDSIDDEKLQEEFAPFG-- 348
           E ++E+KK  E   M+  +K             V++FVKNL+ S    +L E+F PF   
Sbjct: 580 EDVKEIKKSVEDV-MDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGF 638

Query: 349 TITSVKVMRDDAGSSK----GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
            +  VK   D   S K    GFGF+ F T E+A   I   +  ++ G  + + I+ ++
Sbjct: 639 VVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQ 696

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 96/206 (46%), Gaps = 17/206 (8%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGK------SRKFGFVHFXXXXXXX 182
           ++F+KNL+ +  +  L + F  F   +  ++ T    K      S  FGF+ F       
Sbjct: 613 SIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAG 672

Query: 183 XXIDAINGMLLNGLEVYVA-PHVSKKDRQSKLDEVKSNFTNVYVKNIDPE-TKQDEFEKL 240
             I A++G +++G ++ +   H      ++     K     + VKN+  E T++D FE L
Sbjct: 673 AVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFE-L 731

Query: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300
           FS +G + S  +    +   RGF FV F   + A  A+++L      G++L +  A+++ 
Sbjct: 732 FSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQES 791

Query: 301 ERLQE--------LKKQYESSRMEKL 318
           + ++E        +KKQ   S+M  L
Sbjct: 792 DDVEEQISKMTMKMKKQAAVSKMGAL 817

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 88/204 (43%), Gaps = 14/204 (6%)

Query: 6   DKTAEQLEQLR--IQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSP- 62
           D   E +++++  ++D       +  SE+T  +  + S++V  L+ S T A L + F P 
Sbjct: 576 DAAPEDVKEIKKSVEDVMDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPF 635

Query: 63  ----IGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118
               +  V +    +++  K S+G+ ++ F         I  ++   I G   ++  S +
Sbjct: 636 SGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHK 695

Query: 119 DPSLRK-------KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFG 171
             SL K       K SG + +KNL      K + + FS FG + S ++       +R F 
Sbjct: 696 QSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFA 755

Query: 172 FVHFXXXXXXXXXIDAINGMLLNG 195
           FV F         +D + G+ L G
Sbjct: 756 FVEFLLPSEAENAMDQLQGVHLLG 779

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEK 384
           LF++N+     +E  ++ F+P+G +  V V  D   G SKGF +V F  PE A  A  E 
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 385 NQQIVAGKPLYVAIAQRKEVRR 406
           ++QI  G+ L++  A  K+  R
Sbjct: 363 DKQIFQGRLLHILPADAKKTHR 384

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 87/192 (45%), Gaps = 23/192 (11%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLET-----DNEGKLR-GFGFVNFEDHNAA 274
            +++VKN++  T   +  + F  +     A ++T     +++ KL  GFGF+ F     A
Sbjct: 612 VSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQA 671

Query: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLF----VKN 330
              +  ++    +G K+             +LK  ++ S + K +K     +     VKN
Sbjct: 672 GAVIAAMDGAVIDGHKI-------------QLKISHKQSSLPKTSKGSKKKISGKIIVKN 718

Query: 331 LDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVA 390
           L      + + E F+ FG + SV+V +    S++GF FV F  P EA  A+ +     + 
Sbjct: 719 LPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLL 778

Query: 391 GKPLYVAIAQRK 402
           G+ L +  A+++
Sbjct: 779 GRRLVMQYAEQE 790

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 99/241 (41%), Gaps = 39/241 (16%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXX 183
           + +G +F++N+      +     FS +G +    +A D  TG+S+ F +V F        
Sbjct: 298 RATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAAN 357

Query: 184 XIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEK---- 239
               ++  +  G  +++ P  +KK    +LDE         +KN+ P  KQ E ++    
Sbjct: 358 AYIELDKQIFQGRLLHILPADAKK--THRLDEFD-------LKNL-PLKKQRELKRKATA 407

Query: 240 ---------LFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAK-AVEELNDTDFNGQ 289
                    LF    A+ S+V       K +    ++ E+  +A K A+ E +       
Sbjct: 408 AQQTFSWNSLFMNQDAVLSSVAAKLGMEKSQ---LIDPENSGSAVKQALAEAH------- 457

Query: 290 KLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGT 349
              +G  +K +E       Q+E  + +K+ +     + VKN       E+L E F PFG 
Sbjct: 458 --VIGDVRKYFEARGVDLTQFE--KFKKVTERDDRIILVKNFPHGTTREELAELFLPFGK 513

Query: 350 I 350
           I
Sbjct: 514 I 514

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (60%)

Query: 350 ITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
           IT VK+++D +G+S+ F F+ + + ++A  AI   N   +    + VA+A+
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAK 87

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 154 ILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA 201
           I   KI  D++G SR+F F+ +         I+  NG  ++   + VA
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVA 84

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 122/316 (38%), Gaps = 79/316 (25%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +F++++   + ++ L D FS F  I    +  D   +SR FGFV F         +    
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 190 GMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFT-------------------------- 221
               NG  L V +A    ++DR  K  EV    T                          
Sbjct: 88  KTKFNGHILRVDIA---KRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLK 144

Query: 222 ---NVYVKNIDPETKQD--EFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAK 276
               + ++N+ P + +D  + +K+F +YG +  A +    +GKL GF FV  +  +    
Sbjct: 145 GKPKLIIRNM-PWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRI 203

Query: 277 AVEELNDTDFNGQKLYVGRAQKKYERLQELKK---------------------------- 308
           A+E   D   +G+K+ V  A +K  R ++ KK                            
Sbjct: 204 ALENTKDLKIDGRKVAVDFAVQK-NRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDE 262

Query: 309 ------QYESSRMEKLAKYQGVN------LFVKNLDDSIDDEKLQEEFAPFGTIT-SVKV 355
                 Q + +   K +K +  N      +FV+N+     +E L   F+ FG++  ++ V
Sbjct: 263 NEEEDRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPV 322

Query: 356 MRDDAGSSKGFGFVCF 371
           +    G +KG  FV F
Sbjct: 323 IDKSTGLAKGTAFVAF 338

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 85/204 (41%), Gaps = 21/204 (10%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +   ++V++I  +   ++    FS +  I  AV+  D   + RGFGFV+F   +   +A+
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEAL 83

Query: 279 EELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVN------------- 325
            +   T FNG  L V  A K+ +R ++  +  E S  E   K  G N             
Sbjct: 84  AKARKTKFNGHILRVDIA-KRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSM 142

Query: 326 ------LFVKNLDDSIDDE-KLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEAT 378
                 L ++N+  S  D  KL++ F  +GT+    + R   G   GF FV         
Sbjct: 143 LKGKPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCR 202

Query: 379 KAITEKNQQIVAGKPLYVAIAQRK 402
            A+       + G+ + V  A +K
Sbjct: 203 IALENTKDLKIDGRKVAVDFAVQK 226

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           LFV+++   + DE+L + F+ F  I    V++D    S+GFGFV F+  ++  +A+ +  
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 386 QQIVAGKPLYVAIAQRKEVRRSQLAQQI 413
           +    G  L V IA+R++  RS+   ++
Sbjct: 88  KTKFNGHILRVDIAKRRD--RSKKTSEV 113

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 111/332 (33%), Gaps = 86/332 (25%)

Query: 25  PTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYA 84
           P+S  S+         +L+V  +   VT+  L D FS    +    V +D   K S G+ 
Sbjct: 11  PSSNVSKQNDDGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFG 69

Query: 85  YVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRK-------------------- 124
           +V+F   +    A+ K   T   G   R+  ++R    +K                    
Sbjct: 70  FVSFAVEDDTKEALAKARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQN 129

Query: 125 --------------KGSGNVFIKNL-HPAIDNKALHDTFSVFGNILSCKIATDETGKSRK 169
                         KG   + I+N+     D   L   F  +G ++   I     GK   
Sbjct: 130 NEDEDDADGEDSMLKGKPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCG 189

Query: 170 FGFVHFXXXXXXXXXIDAINGMLLNGLEVYV---------------APHVSKKD------ 208
           F FV           ++    + ++G +V V                P ++ KD      
Sbjct: 190 FAFVTMKKISNCRIALENTKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKDDNESGN 249

Query: 209 ------------------RQ----SKLDEVKSNFTN------VYVKNIDPETKQDEFEKL 240
                             RQ    SK  E K    N      V+V+N+  +  ++     
Sbjct: 250 EDAEENHDDEEDENEEEDRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPH 309

Query: 241 FSQYGAITSAVLETD-NEGKLRGFGFVNFEDH 271
           FS++G++  A+   D + G  +G  FV F+D 
Sbjct: 310 FSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQ 341

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 228 IDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           I+ + K+D+   +  Q   I    ++    G+ RG+GFV F DH  A   +  LN
Sbjct: 522 IEAQKKKDKKSGVVKQAKVIME--VKGSTAGRSRGYGFVEFRDHKNALMGLRWLN 574

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 118/310 (38%), Gaps = 58/310 (18%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHNAGTTAI 98
           S++V  L    T   L +LF  +G V    V  D IT      G   V F  + +   AI
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEV----VEADIITSKGHHRGMGTVEFTKNESVQDAI 178

Query: 99  EKLNYTPIKGRPCRIMWSQRDP------SLRKKGSGN-------VFIKNLHPAIDNKALH 145
            K +      R  ++M  Q +P         KK +         VFI NL  +++ ++L 
Sbjct: 179 SKFDGALFMDR--KLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLK 236

Query: 146 DTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG--LEVYVAPH 203
           D F   G++L   +  D  G SR FG V +         ID  NGM + G  LEV     
Sbjct: 237 DMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRF 296

Query: 204 VSKK------------------------DRQSKLDEVKSNFTN-----------VYVKNI 228
             +K                        D    +DE  + FT            +Y  N+
Sbjct: 297 NKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNL 356

Query: 229 DPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNG 288
              T + +   LF   G I +A L+    G+  G   V +E+   A   +++LN+ ++ G
Sbjct: 357 PFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGG 416

Query: 289 QKLYVGRAQK 298
             L +  A++
Sbjct: 417 CSLQISYARR 426

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 1/71 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           +FV+NL      E L+E F   G +    ++    G  +G G V F+  E    AI++ +
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIIT-SKGHHRGMGTVEFTKNESVQDAISKFD 182

Query: 386 QQIVAGKPLYV 396
             +   + L V
Sbjct: 183 GALFMDRKLMV 193

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 78/167 (46%), Gaps = 14/167 (8%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A++YVG +D  VT+ LLY+LF+ +G V  ++  +D I++   G+A++ F         + 
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLN 65

Query: 100 KL-NYTPIKGRPCRIMWS----QRDPSLRKKG-------SGNVFIKNLHPAIDNKALHDT 147
            + N   +  +  +I  S    Q+D + +K            VF+K++   ++ + L   
Sbjct: 66  VMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 148 FSVFGNILSC-KIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLL 193
           FS FG +    ++ T   G+ R   F++F         I  +NG  +
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVR-CAFIYFKFYDNADLAIQTLNGQFI 171

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 82/191 (42%), Gaps = 15/191 (7%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEEL 281
           +YV NID +  ++   +LF+Q G +       D    + +GF F+ F     A   +  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 282 NDTDFNGQKLY-----VGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSID 336
           N    N  KLY     + R+ +  ++    KK    + +  +AK     +FVK++ D+++
Sbjct: 68  N----NNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAK-----VFVKDIADTVE 118

Query: 337 DEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
              L + F+ FG +     +   +       F+ F   + A  AI   N Q +  K   +
Sbjct: 119 VRHLTQLFSKFGPLAKTPEVFTVSNGEVRCAFIYFKFYDNADLAIQTLNGQFIMNKKASL 178

Query: 397 AIAQRKEVRRS 407
             A ++  R++
Sbjct: 179 EYAFKENGRKN 189

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 75/164 (45%), Gaps = 11/164 (6%)

Query: 128 GNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRK-FGFVHFXXXXXXXXXID 186
             +++ N+   +  + L++ F+  G +   K   D+  +  + F F+ F         ++
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLN 65

Query: 187 AING---MLLNGLEVYVAPHVSKKDRQSKLDEVKSNF---TNVYVKNIDPETKQDEFEKL 240
            +N    +    L++  +    +KD  +K  E+ ++      V+VK+I    +     +L
Sbjct: 66  VMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 241 FSQYG--AITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282
           FS++G  A T  V    N G++R   F+ F+ ++ A  A++ LN
Sbjct: 126 FSKFGPLAKTPEVFTVSN-GEVRC-AFIYFKFYDNADLAIQTLN 167

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 91/191 (47%), Gaps = 8/191 (4%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGN--ILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDA 187
           +++ N  P  D   L +  S + +  ILS ++ +      R+F +V            + 
Sbjct: 115 IWVTNFPPGYDASKLRNLLSQYIDSPILSIRLPSLAFNSRRRFAYVDLVSPEVAKKATNR 174

Query: 188 INGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAI 247
           +NG+ +N  ++ VA   +  +R  + D   S+   + VKN+  +   D+  K+F+++G  
Sbjct: 175 LNGIEINNYKL-VAKISNVNERTERTDNAISDGREIIVKNLPDDITIDDLIKMFNEFGDT 233

Query: 248 TSAVLETDNE---GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK-YERL 303
             A + T +E   G+   + F+ F++  +A  A+  LN    NG+ L+V +  +K Y   
Sbjct: 234 EKARIVTGDETNPGRHSRYAFITFKNKASADNAL-SLNGAVMNGKPLHVSKVMRKAYLER 292

Query: 304 QELKKQYESSR 314
           QE+K+   S +
Sbjct: 293 QEVKRLLASRK 303

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 110/291 (37%), Gaps = 34/291 (11%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           V +KNL P  ++  +   F   G+IL   + TD T    K   + F         + A++
Sbjct: 39  VLVKNLPPNYNHHKVRRYFKTCGSILQIDV-TDSTDGDSKLARIEFSSYDQA---LTAVS 94

Query: 190 GMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQY--GAI 247
             L             KK    ++   +   + ++V N  P     +   L SQY    I
Sbjct: 95  RTL-------------KKIGFHQITVEQLTDSTIWVTNFPPGYDASKLRNLLSQYIDSPI 141

Query: 248 TSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELK 307
            S  L +      R F +V+      A KA   LN  + N  KL V +     ER +   
Sbjct: 142 LSIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKL-VAKISNVNERTERTD 200

Query: 308 KQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA---GSSK 364
                      A   G  + VKNL D I  + L + F  FG     +++  D    G   
Sbjct: 201 N----------AISDGREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHS 250

Query: 365 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQA 415
            + F+ F     A  A++  N  ++ GKPL+V+   RK     Q  +++ A
Sbjct: 251 RYAFITFKNKASADNALS-LNGAVMNGKPLHVSKVMRKAYLERQEVKRLLA 300

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 79/168 (47%), Gaps = 13/168 (7%)

Query: 38  SSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA 97
           S  ++YVG +DP +T+  LY+LF  I  V  I+  +D + +   GYA++ F++      A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 98  IEKLNYTP-IKGRPCRI------MWSQRDPSLRKKGS----GNVFIKNLHPAIDNKALHD 146
           I+ +N T  +  R  ++        +   PS   K        +FIKNL  +ID+  L  
Sbjct: 67  IKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVK 126

Query: 147 TFSVFGNIL-SCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLL 193
            F+ FG ++   +I     GK  K  +V+F         I ++N  L+
Sbjct: 127 IFNKFGKLIREPEIFYLSNGK-LKCAYVYFEDFEKADLAIKSLNNQLV 173

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 83/186 (44%), Gaps = 22/186 (11%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK-LRGFGFVNFEDHNAAAKAVEEL 281
           VYV NIDP   +++  +LF Q   +       D   +  +G+ F+ F +   A  A++ +
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 282 NDTDFNGQKLYVGRAQKKYERLQELKKQYES-------SRMEKLAKYQGVNLFVKNLDDS 334
           N+T             + Y+RL ++++   S       S + K        LF+KNL DS
Sbjct: 71  NNT------------VRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADS 118

Query: 335 IDDEKLQEEFAPFG-TITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 393
           ID ++L + F  FG  I   ++     G  K   +V F   E+A  AI   N Q+VA   
Sbjct: 119 IDSDQLVKIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNR 177

Query: 394 LYVAIA 399
           + V  A
Sbjct: 178 ITVDYA 183

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 82/194 (42%), Gaps = 35/194 (18%)

Query: 127 SGN-VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRK-FGFVHFXXXXXXXXX 184
           SGN V++ N+ P I  + L++ F     +L  K   D+  ++ + + F+ F         
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 185 IDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSN-----------------FTNVYVKN 227
           I  +N    N + +Y        DR  K+ +V ++                    +++KN
Sbjct: 67  IKIMN----NTVRLY--------DRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKN 114

Query: 228 IDPETKQDEFEKLFSQYGAITSA--VLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTD 285
           +      D+  K+F+++G +     +    N GKL+   +V FED   A  A++ LN+  
Sbjct: 115 LADSIDSDQLVKIFNKFGKLIREPEIFYLSN-GKLKC-AYVYFEDFEKADLAIKSLNNQL 172

Query: 286 FNGQKLYVGRAQKK 299
               ++ V  A K+
Sbjct: 173 VANNRITVDYAFKE 186

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 74/342 (21%), Positives = 133/342 (38%), Gaps = 77/342 (22%)

Query: 32  STKGEASSASLYVGELDPSVTEALLYDLFSPIGSVS-SIRVCR--DA-ITKTSLGYAYVN 87
           ST      + LY+G+LDPS  EA++  +++ +G  +  +R+    DA   + +LGY +V 
Sbjct: 76  STGASTPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVE 135

Query: 88  FHDHNAGTTAIEKLNYTPIKG---RPCRIMWSQRDPSLRKKGSG---------------N 129
           F      + A+ K N   I G   +  ++ WS +       GSG               +
Sbjct: 136 FPSPAHASNALMK-NGMEIPGFVHKKLKLNWSAQS---VNNGSGASVANGAVANQQTNNS 191

Query: 130 VFIKNLHPAIDNKALHDTF-SVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDA 187
           +F+ +L P++    L D F + + + +  K+  D+ TG S+ +GFV F         +  
Sbjct: 192 IFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVE 251

Query: 188 INGMLLNGLEVYVA-----------------------------------------PHVSK 206
           + G  LNG  + +                                            V+ 
Sbjct: 252 MQGCFLNGRAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNA 311

Query: 207 KDRQSKLDEVKS-NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGF 265
             +Q  L+     N T V+V  + P   +DE    F  +G I    +        +G GF
Sbjct: 312 TPQQPVLNHFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAG-----KGCGF 366

Query: 266 VNFEDHNAAAKAVEELNDTDFNGQ--KLYVGRAQKKYERLQE 305
           V + + ++A  A+ ++          +L  GR+ KK   +Q+
Sbjct: 367 VQYVERSSAETAITKMQGFPIANSRVRLSWGRSAKKTALIQK 408

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/342 (20%), Positives = 135/342 (39%), Gaps = 66/342 (19%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFG--NILSCKIATDETGKSRK---FGFVHFXXXXXXXXX 184
           +++ +L P+ D   +   ++  G  NI    +   +    RK   + FV F         
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPA----- 140

Query: 185 IDAINGMLLNGLEV-----------YVAPHVSKKDRQSKLDEVKSN---FTNVYVKNIDP 230
             A N ++ NG+E+           + A  V+     S  +   +N     +++V ++ P
Sbjct: 141 -HASNALMKNGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLAP 199

Query: 231 ETKQDEFEKLF-SQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNG 288
              + +   LF ++Y +   A +  D   G  +G+GFV F+      +A+ E+     NG
Sbjct: 200 SVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNG 259

Query: 289 QKLYVGRA---------------------------QKKYERLQELKKQYESSR-----ME 316
           + + +G A                           Q+      +L +Q+ ++      + 
Sbjct: 260 RAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLN 319

Query: 317 KLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEE 376
                    +FV  L   + +++L+  F PFGTI  VK+    AG  KG GFV +     
Sbjct: 320 HFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKI---PAG--KGCGFVQYVERSS 374

Query: 377 ATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQ 418
           A  AIT+     +A     V ++  +  +++ L Q+   R++
Sbjct: 375 AETAITKMQGFPIANS--RVRLSWGRSAKKTALIQKALLRSR 414

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 109/299 (36%), Gaps = 28/299 (9%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAI 188
           ++FI NL      + LHD F   G +L   I T   G+ R  G V F         I   
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSR-GRHRGMGTVEFTSPEGVDNAIRDF 178

Query: 189 NGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTN-----------VYVKNIDPETKQDEF 237
           NG+   G  ++V       +    L  ++  F +           V++ N+         
Sbjct: 179 NGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQTL 238

Query: 238 EKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQ 297
           + LF + G +  A +E D  G  RGFG V +        A+E  N  D +G+ L V   +
Sbjct: 239 KDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQVREGK 298

Query: 298 KK-------------YERLQELKKQYESSRMEKLAKYQG---VNLFVKNLDDSIDDEKLQ 341
                           E+  E++     S+  +     G     ++  NL  +     L 
Sbjct: 299 NSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTTATGDLY 358

Query: 342 EEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
           + F   G +   ++  D++G+  G   + +   E+A   I   N     G  L ++ A+
Sbjct: 359 DLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLNNYNYGGCDLDISYAK 417

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 104/302 (34%), Gaps = 49/302 (16%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHNAGTTAI 98
           S+++G L    T   L+D F   G V    +  D IT      G   V F        AI
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEV----LRADIITSRGRHRGMGTVEFTSPEGVDNAI 175

Query: 99  EKLNYTPIKGRPCRIMWS-------QRDPSLRKKGSG----------NVFIKNLHPAIDN 141
              N     GRP  +          +  P +R++ +            VFI NL  ++  
Sbjct: 176 RDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTW 235

Query: 142 KALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG------ 195
           + L D F   G+++   I  D  G SR FG V +         I+  NG  ++G      
Sbjct: 236 QTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQVR 295

Query: 196 --------------------LEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQD 235
                                E+ + P          +       T +Y  N+   T   
Sbjct: 296 EGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTTATG 355

Query: 236 EFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
           +   LF   G +  A L+ D  G   G   + +E+   A   ++ LN+ ++ G  L +  
Sbjct: 356 DLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLNNYNYGGCDLDISY 415

Query: 296 AQ 297
           A+
Sbjct: 416 AK 417

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 306 LKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKG 365
           + ++ E    EK+ +    ++F+ NL      E L + F   G +    ++    G  +G
Sbjct: 101 MAREMEPPYEEKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIIT-SRGRHRG 159

Query: 366 FGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
            G V F++PE    AI + N     G+PL+V
Sbjct: 160 MGTVEFTSPEGVDNAIRDFNGVEFMGRPLFV 190

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 35/86 (40%), Gaps = 1/86 (1%)

Query: 17  IQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAI 76
           I+ E PTGP+        G   S  +Y   L  +     LYDLF  IG V    +  D  
Sbjct: 318 IEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDE- 376

Query: 77  TKTSLGYAYVNFHDHNAGTTAIEKLN 102
           +    G A + + +       I++LN
Sbjct: 377 SGAPTGIAVIEYENVEDADFCIQRLN 402

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 94/222 (42%), Gaps = 53/222 (23%)

Query: 128 GNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDET-GKSRKFGFVHFXXXXXXXXXID 186
           GN+F+  +  ++    L   FS +G ILS K+  D+T G+   +GF+ +         I 
Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254

Query: 187 AINGMLLNGLEVYVAPHVSKKDRQS-KLDEVK-----SNFTNVYVKNI---DPE------ 231
            +NG  +NG  +++  HV +K+R+    D VK      NF  +++ N+   +PE      
Sbjct: 255 ELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLI 314

Query: 232 TKQDEFEKL-------------------------------FSQYGAITSAVLETDNEGK- 259
           T ++  E +                               F++ G++ S     +  G  
Sbjct: 315 TPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNA 374

Query: 260 -----LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRA 296
                L+G+GF+   +H  A  A+E  N   ++G +L V +A
Sbjct: 375 QDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKA 416

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 21/106 (19%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVM------------RDDA----- 360
           ++  Q  NL+VK++  S  DE L + +  FG I SVKV+             +D+     
Sbjct: 534 MSNQQESNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDND 593

Query: 361 ---GSSKGFGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 402
              GSS+G+GFV F +P +A KAI   +  Q+   + L V+ AQ++
Sbjct: 594 LPVGSSRGYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEE 280
           N++V  I       E   LFS+YG I S  L  D  +G+  G+GF+++   + A+  ++E
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 281 LNDTDFNGQKLYVGRAQKKYER 302
           LN    NG  L++    ++ ER
Sbjct: 256 LNGRTVNGSTLFINYHVERKER 277

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 44/108 (40%), Gaps = 12/108 (11%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
            +++VG +  S++   L  LFS  G + S+++  D       GY ++++   +  +  I+
Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254

Query: 100 KLNYTPIKGRPC------------RIMWSQRDPSLRKKGSGNVFIKNL 135
           +LN   + G               RI W     +        +FI NL
Sbjct: 255 ELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNL 302

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 84/172 (48%), Gaps = 9/172 (5%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRK------FGFVHFXXXXXXX 182
           ++FIKNL+    ++ L D F VF   +  ++ T    K +       FGFV F       
Sbjct: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700

Query: 183 XXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPE-TKQDEFEKLF 241
             I A++G +++G ++ +     + +  S+ ++ K+    + VKN+  E T++D FE LF
Sbjct: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EKKKAKNGKIIVKNLPFEATRKDVFE-LF 758

Query: 242 SQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
           + +G + S  +    +   RGF FV F     A  A+++L      G++L +
Sbjct: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 93/223 (41%), Gaps = 24/223 (10%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGS--VSSIRVCRDAITKT---SLGYAYVNFHDHNA 93
           + S+++  L+   T   L D F       V+ ++   D   K    S+G+ +V F     
Sbjct: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPSL-----RKKGSGNVFIKNLHPAIDNKALHDTF 148
            T  I  ++ T I G   ++  S R  +      +K  +G + +KNL      K + + F
Sbjct: 699 ATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEKKKAKNGKIIVKNLPFEATRKDVFELF 758

Query: 149 SVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAP------ 202
           + FG + S ++       +R F FV F         +D + G+ L G  + + P      
Sbjct: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPAEQEAA 818

Query: 203 -------HVSKKDR-QSKLDEVKSNFTNVYVKNIDPETKQDEF 237
                   ++KK R Q+ + E+ +   N   + +D E +++EF
Sbjct: 819 NAEEELERMTKKVRKQAAVSEIAAMTRNAGKRKLDMEDEEEEF 861

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 2/84 (2%)

Query: 318 LAKYQGV-NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPE 375
           +AK Q    LF++N+  S  ++  ++ F+P+G +  V V  D   G+SKGF +V F+ PE
Sbjct: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377

Query: 376 EATKAITEKNQQIVAGKPLYVAIA 399
           EA +A  E ++QI  G+ L++  A
Sbjct: 378 EAVQAYIELDKQIFQGRLLHILAA 401

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 85/188 (45%), Gaps = 21/188 (11%)

Query: 204 VSKKDRQSKLDE----VKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK 259
           VS K  + K DE    V     ++++KN++ +T   +    F  +     A ++T  + K
Sbjct: 619 VSSKKTEDKEDEDEQVVDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPK 678

Query: 260 LR------GFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESS 313
            +      GFGFV F     A   +  ++ T  +G K+ +  + ++     + KK+ ++ 
Sbjct: 679 QKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEKKKAKNG 738

Query: 314 RMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFST 373
           +           + VKNL      + + E F  FG + SV+V +    S++GF FV F  
Sbjct: 739 K-----------IIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVL 787

Query: 374 PEEATKAI 381
           P+EA  A+
Sbjct: 788 PKEAENAM 795

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFG--TITSVKVMRDDAGSSK----GFGFVCFSTPEEA 377
           V++F+KNL+     ++L + F  F    +  VK   D    +K    GFGFV F T E+A
Sbjct: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699

Query: 378 TKAITEKNQQIVAGKPLYVAIAQRK 402
           T  I+  +  ++ G  + + ++ R+
Sbjct: 700 TAVISAMDGTVIDGHKIQLKLSHRQ 724

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           +  L++  +  S TE     LFSP G +  + V  D  T  S G+AYV F        A 
Sbjct: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383

Query: 99  EKLNYTPIKGRPCRIM 114
            +L+    +GR   I+
Sbjct: 384 IELDKQIFQGRLLHIL 399

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 145 HDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLL--NGLEVYVA- 201
           H T +V G I   +I  +  GKSR+F F+ +         ++  +G  +  + +EV +A 
Sbjct: 30  HATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAK 89

Query: 202 ----PHVSKKDRQSK 212
               P V K  ++ K
Sbjct: 90  SFADPRVPKSMKEKK 104

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 125/317 (39%), Gaps = 77/317 (24%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +F++++  ++ ++ L D FS F  I    +  D   KSR FGFV F         +    
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 190 GMLLNG--LEVYVAPHVSK------KDRQSKLDEVKSNFT-------------------- 221
              L+G  L+V +A    +      K  Q ++D   S  +                    
Sbjct: 84  KTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLKGK 143

Query: 222 -NVYVKNIDPETKQD--EFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
             + ++N+ P + +D  + +K+F +YG +  A +    +GKL GF FV     +   KA+
Sbjct: 144 PKLIIRNM-PWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKAL 202

Query: 279 EELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA------------------- 319
           E+  +   +G+K+ V  A +K  + +E K +YE    E                      
Sbjct: 203 EDTKNLTIDGRKVAVDFAVQK-NKWEEYKTKYEKEDDEAKDDGSDSSSDKEDKISVSDSE 261

Query: 320 ------------------------KYQGVNLFVKNLDDSIDDEKLQEEFAPFGTIT-SVK 354
                                   + +  ++FV+N+     +E L + F+ FG +  ++ 
Sbjct: 262 GDEDGEDVEEEEEVEEEKPRKQKNRREDFSVFVRNVPYDATEESLFDHFSKFGPVKYALP 321

Query: 355 VMRDDAGSSKGFGFVCF 371
           V+  + G +KG  FV F
Sbjct: 322 VIDKNTGLAKGTAFVAF 338

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 86/205 (41%), Gaps = 22/205 (10%)

Query: 219 NFTNVYVKNIDPETKQDE-FEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKA 277
           +   ++V++I PE+  DE     FS +  I  AV+  D   K RGFGFV+F   +    A
Sbjct: 20  DMKTLFVRSI-PESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIA 78

Query: 278 VEELNDTDFNGQKLYV--GRAQKKYERLQELKKQYESSRMEKLAKYQGVN---------- 325
           ++E   T  +G +L V   R + +  + ++   Q E  R      Y   N          
Sbjct: 79  LKEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESS 138

Query: 326 -------LFVKNLDDSIDD-EKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEA 377
                  L ++N+  S  D  KL++ F  +G +    + R   G   GF FV  +     
Sbjct: 139 LLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNC 198

Query: 378 TKAITEKNQQIVAGKPLYVAIAQRK 402
            KA+ +     + G+ + V  A +K
Sbjct: 199 KKALEDTKNLTIDGRKVAVDFAVQK 223

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           LFV+++ +S+ DE+L + F+ F  I    V++D    S+GFGFV F+  ++   A+ E  
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 386 QQIVAGKPLYVAIAQRKE 403
           +  + G  L V IA+R++
Sbjct: 84  KTKLDGAQLKVDIARRRD 101

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 81/216 (37%), Gaps = 41/216 (18%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +L+V  +  SVT+  L D FS    +    V +D + K S G+ +V+F   +    A+++
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKD-VNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 101 LNYTPIKGRPCRIMWSQR--------DPSLRK---------------------------K 125
              T + G   ++  ++R        D S +K                           K
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 126 GSGNVFIKNL-HPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXX 184
           G   + I+N+     D   L   F  +G ++   I     GK   F FV           
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 185 IDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNF 220
           ++    + ++G +V V   V K    +K +E K+ +
Sbjct: 202 LEDTKNLTIDGRKVAVDFAVQK----NKWEEYKTKY 233

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 26/47 (55%)

Query: 258 GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQ 304
           G+ RG+GFV ++DH  A   +  LN      +++  G  +++ + +Q
Sbjct: 550 GRSRGYGFVEYKDHKHALMGLRWLNAHMVTTEEILEGMTEEEQKSIQ 596

>Scas_376.1
          Length = 404

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 104/211 (49%), Gaps = 25/211 (11%)

Query: 223 VYVKNIDPETKQDEFEKLFS------QYGAITSAVLE------TDNEGKL---RGFGFVN 267
           V++ N+  +T ++E  KLF+      + G +T   +         N+GK    +GF +++
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 268 FEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVN-L 326
           F+  N   +++ +L+++  NG+ + + +  K YE       + + + +  L+K      L
Sbjct: 189 FKT-NEQMESIIKLSESQLNGRNMLI-KDSKSYE------GRPDKNDLVSLSKNPPSRIL 240

Query: 327 FVKNLDDSIDDEKLQEEFAPFGTITSVKVMR-DDAGSSKGFGFVCFSTPEEATKAITEKN 385
           FV NL     DE L++ F   G I  +++    D+G  KGF F+ F + E AT A+ +K 
Sbjct: 241 FVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKT 300

Query: 386 QQIVAGKPLYVAIAQRKEVRRSQLAQQIQAR 416
            + +A +P+ +   + +  R+ +    ++ R
Sbjct: 301 CRKIAARPIRMEYGEDRSKRQVKRRDPVEPR 331

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 50/126 (39%), Gaps = 15/126 (11%)

Query: 7   KTAEQLEQL-RIQDEQPTG--------------PTSTDSESTKGEASSASLYVGELDPSV 51
           KT EQ+E + ++ + Q  G              P   D  S      S  L+VG L    
Sbjct: 190 KTNEQMESIIKLSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFVGNLSFDT 249

Query: 52  TEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPC 111
           T+ LL   F   G +  IR+     +    G+A+++F      T A++      I  RP 
Sbjct: 250 TDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKTCRKIAARPI 309

Query: 112 RIMWSQ 117
           R+ + +
Sbjct: 310 RMEYGE 315

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 83/159 (52%), Gaps = 16/159 (10%)

Query: 256 NEGKL---RGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYES 312
           N+GK    +GF +V+F+       A++ L+++  NG+ L + +  K YE       + + 
Sbjct: 159 NDGKQIKNKGFCYVDFKTQEQVEAAIK-LSESQLNGRNLLI-KNSKSYE------GRPDK 210

Query: 313 SRMEKLAKYQGVN-LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMR-DDAGSSKGFGFVC 370
           + +  ++K      LFV NL     DE L++ F   G I  +++    D+G  KGF FV 
Sbjct: 211 TDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVD 270

Query: 371 FSTPEEATKAITEKNQQIVAGKPLYVAIAQ---RKEVRR 406
           F   E AT A+ +K+ + +AG+PL +   +   +++VR+
Sbjct: 271 FKNEEGATNALKDKSCRKIAGRPLRMEFGEDRSKRQVRK 309

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%)

Query: 25  PTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYA 84
           P  TD  S      S  L+VG L    T+ LL   F   G +  IR+     +    G+A
Sbjct: 208 PDKTDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFA 267

Query: 85  YVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQ 117
           +V+F +    T A++  +   I GRP R+ + +
Sbjct: 268 FVDFKNEEGATNALKDKSCRKIAGRPLRMEFGE 300

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 91/204 (44%), Gaps = 33/204 (16%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETD------------NEGKL---RGFGFVN 267
           V++ N+  +T Q+E  +      A   A   TD            N+GK    +GF +V+
Sbjct: 107 VWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYVD 166

Query: 268 FEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYER-----LQELKKQYESSRMEKLAKYQ 322
           F   +A   AV  L++   NG+ L +  A+    R     L  + K    SR+       
Sbjct: 167 FA-TSAQMDAVIGLSEAQLNGRNLLIKNAKSYDGRPAKNDLISMSKN-PPSRI------- 217

Query: 323 GVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMR-DDAGSSKGFGFVCFSTPEEATKAI 381
              LFV NL     DE L++ F   G I  +++    D+G  KGF FV F     AT A+
Sbjct: 218 ---LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAAL 274

Query: 382 TEKNQQIVAGKPLYVAIAQRKEVR 405
           T+++ + +AG+PL +   + +  R
Sbjct: 275 TDRSCRAIAGRPLRMEYGEDRSKR 298

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 40/93 (43%)

Query: 25  PTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYA 84
           P   D  S      S  L+VG L    T+ LL   F   G +  IR+     +    G+A
Sbjct: 201 PAKNDLISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFA 260

Query: 85  YVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQ 117
           +V+F D    T A+   +   I GRP R+ + +
Sbjct: 261 FVDFRDEAGATAALTDRSCRAIAGRPLRMEYGE 293

>Scas_705.22
          Length = 869

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 3/93 (3%)

Query: 315 MEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFST 373
           MEK++K     LF++N+  +  ++  ++ F PFG +  V V  D   G SKGF ++ F  
Sbjct: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377

Query: 374 PEEATKAITEKNQQIVAGKPLYVAIAQRKEVRR 406
           P+EA +A  E ++QI  G+ L++  A  K+  R
Sbjct: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 100/224 (44%), Gaps = 15/224 (6%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGK------SRKFGFVHFXXXXXXX 182
           ++FIKNL+    +  L   F  F   +  ++ T    K      S  FGF  F       
Sbjct: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701

Query: 183 XXIDAINGMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPE-TKQDEFEK 239
             I A++G +++G  +++ ++      +  S     K     + VKN+  E T++D FE 
Sbjct: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVFE- 760

Query: 240 LFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299
           LF+ +G + S  +    +   RGF FV F     A  A+++L      G++L +     +
Sbjct: 761 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM-----Q 815

Query: 300 YERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEE 343
           Y + +    + E +RM K  K Q V+  +  L +S   +KL+ E
Sbjct: 816 YAQEEAADAEEEIARMTKKVKKQVVSSELAALRNSGGRKKLELE 859

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 14/182 (7%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK------LRGFGFVNFEDHNAA 274
            ++++KN++  T   E  K F  +     A ++T  + K        GFGF  F     A
Sbjct: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700

Query: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDS 334
              +  L+ T  +G ++ +        +L   +    ++   K  K +   + VKNL   
Sbjct: 701 NAVISALDGTVIDGHRIQL--------KLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFE 752

Query: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
              + + E F  FG + SV+V +    S++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812

Query: 395 YV 396
            +
Sbjct: 813 VM 814

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%)

Query: 37  ASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTT 96
           + +  L++  +  + TE     LF P G +  + V  D  T  S G+AY+ F D      
Sbjct: 324 SKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQ 383

Query: 97  AIEKLNYTPIKGRPCRIM 114
           A  +L+    +GR   I+
Sbjct: 384 AYIELDKQIFQGRLLHIL 401

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 316 EKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFG--TITSVKVMRD----DAGSSKGFGFV 369
           E +A    V++F+KNL+ +    +L + F  F    +  VK   D    D   S GFGF 
Sbjct: 633 EHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFA 692

Query: 370 CFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
            F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 693 EFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 326 LFVKNLDDSIDDEKLQEEFA----------PFGT-ITSVKVMRDDAGSSKGFGFVCFSTP 374
           + VK L   + D+ L++ F           P  + IT VK++R+  G S+ F F+ +   
Sbjct: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63

Query: 375 EEATKAITEKNQQIVAGKPLYVAIAQ 400
           E+A  A+   N   +    L V++A+
Sbjct: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 79/214 (36%), Gaps = 20/214 (9%)

Query: 2   SDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEAS-------SASLYVGELDPSVTEA 54
           +D+ +  A +   + ++D       STD  S +           + S+++  L+ + T  
Sbjct: 596 ADLIEADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSV 655

Query: 55  LLYDLFSPIGS--VSSIRVCRD---AITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGR 109
            L   F       V+ ++   D   A    S+G+ +  F         I  L+ T I G 
Sbjct: 656 ELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGH 715

Query: 110 PCRIMWSQRDPSLRKKGSG--------NVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT 161
             ++  S R  S     S          + +KNL      K + + F+ FG + S ++  
Sbjct: 716 RIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPK 775

Query: 162 DETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG 195
                +R F FV F         +D + G+ L G
Sbjct: 776 KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLG 809

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXI 185
           +G +F++N+            F  FG +    +A D  TGKS+ F ++ F          
Sbjct: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385

Query: 186 DAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEK 239
             ++  +  G  +++ P  +KK    +LDE         +KN+ P  KQ E +K
Sbjct: 386 IELDKQIFQGRLLHILPADAKK--SHRLDEFD-------LKNM-PLKKQRELKK 429

>Scas_157.1
          Length = 232

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 81/176 (46%), Gaps = 8/176 (4%)

Query: 32  STKGEASSASLYVGELDPSVTEALLYDLFSPIG-SVSSIRVCRDAITKTSLGYAYVNFHD 90
           +T     S+ LY+G+LDP+  E ++  ++  +G S   +++  ++    + GY +V F  
Sbjct: 39  ATDYNTGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPS 98

Query: 91  HNAGTTAIEKLNYTPIKGRPCR---IMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDT 147
              G  A+ K N   I G P R   + W+    +    G  +VF+ +L P +    L + 
Sbjct: 99  MEHGNNALLK-NGIVIPGFPQRRLKLNWASAGANGNNSGF-SVFVGDLSPNVTEAQLFEL 156

Query: 148 F-SVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA 201
           F   + +    K+  D+ TG S+ +GFV F         +  + G+ LNG  + V 
Sbjct: 157 FIGRYPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVG 212

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 30  SESTKGEASSASLYVGELDPSVTEALLYDLFSPIG---SVSSIRVCRDAITKTSLGYAYV 86
           S    G  S  S++VG+L P+VTEA L++LF  IG   S    +V  D +T  S  Y +V
Sbjct: 127 SAGANGNNSGFSVFVGDLSPNVTEAQLFELF--IGRYPSTCHAKVVHDQLTGVSKCYGFV 184

Query: 87  NFHDHNAGTTAIEKLNYTPIKGRPCRI 113
            F+        + ++    + GR  ++
Sbjct: 185 KFNSATDQQRVLVEMQGVFLNGRSIKV 211

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 69/177 (38%), Gaps = 17/177 (9%)

Query: 126 GSGNVFIKNLHPAIDNKALHDTFSVFG--NILSCKIATDETGKSRKFGFVHFXXXXXXXX 183
           GS  +++ +L P  D   +   +   G  N+    +     G ++ + FV F        
Sbjct: 45  GSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGN- 103

Query: 184 XIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTN----VYVKNIDPE-TKQDEFE 238
                N +L NG+   V P   ++  +       +N  N    V+V ++ P  T+   FE
Sbjct: 104 -----NALLKNGI---VIPGFPQRRLKLNWASAGANGNNSGFSVFVGDLSPNVTEAQLFE 155

Query: 239 KLFSQYGAITSA-VLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVG 294
               +Y +   A V+     G  + +GFV F       + + E+     NG+ + VG
Sbjct: 156 LFIGRYPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVG 212

>Kwal_27.11832
          Length = 686

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 87/194 (44%), Gaps = 13/194 (6%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +   ++V++I  +   +E    FS    I  AV+  D++   RGFGFV+F   +    A+
Sbjct: 19  DMKTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDAL 78

Query: 279 EELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGV---------NLFVK 329
           ++   T F G+ L V  A++   R +  K Q  ++  E  +  Q            L V+
Sbjct: 79  DKARKTKFKGRLLRVDIAKR---RDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVR 135

Query: 330 NLDDSIDD-EKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQI 388
           N+  S+ + ++L++ F  +GT+   K+ +   G   GF FV          AI E     
Sbjct: 136 NMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLK 195

Query: 389 VAGKPLYVAIAQRK 402
           + G+ + V  A +K
Sbjct: 196 IGGRQVAVDFAVQK 209

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 72/162 (44%), Gaps = 12/162 (7%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           LFV+++     DE+L   F+    I    +++DD  +S+GFGFV F+  ++   A+ +  
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 386 QQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMRYQQXXXXXXXXXGMPGQFMQPMFYG 445
           +    G+ L V IA+R++  R++  Q   A ++              G P   +      
Sbjct: 83  KTKFKGRLLRVDIAKRRD--RTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIV------ 134

Query: 446 VMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFGRPNGPMYG 487
               R +P++  NP ++  +       V  +   RP+G + G
Sbjct: 135 ----RNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCG 172

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 258 GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVG 294
           G+ RG+GFV F DH AA   +  LN  +    +L  G
Sbjct: 551 GRSRGYGFVEFRDHKAALMGLRWLNAHEVTKSELLEG 587

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 320 KYQGVNLFVKNLDDSIDDEKLQEEFAPFGTIT-SVKVMRDDAGSSKGFGFVCFSTPE 375
           K + + +FV+N+      E L+E F  FG +  ++ V   + G +KG  FV F T E
Sbjct: 287 KKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 117/302 (38%), Gaps = 55/302 (18%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHNAGTT 96
           S S++VG L        L + FS IG V    V  D IT      G   V F + +    
Sbjct: 161 SNSIFVGNLTYDCQPEDLKEYFSQIGEV----VRADIITSRGHHRGMGTVEFTNADDVDE 216

Query: 97  AIEKLNYTPIKGRPCRIMWSQRDP--------------SLRKKGSG-NVFIKNLHPAIDN 141
           AI + + + +  R   I   Q +P               ++    G  VFI NL  +++ 
Sbjct: 217 AIRRFDGSTLLDR--EIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNW 274

Query: 142 KALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG--LEVY 199
           +AL D F   G++L   +  D  G SR +G V++         I+  NG  L G  L+V+
Sbjct: 275 QALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

Query: 200 ------VAPHVSKKDRQSKLDE-------------VKSNFT-----------NVYVKNID 229
                  + H  ++++    D+             + + FT            ++V N+ 
Sbjct: 335 EGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATGGGDQSSTIFVDNLP 394

Query: 230 PETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQ 289
             T Q +   LF   G +  A L+    GK  G   V +++   A   +  LN  ++ G+
Sbjct: 395 WSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISRLNSYNYGGR 454

Query: 290 KL 291
            L
Sbjct: 455 DL 456

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/318 (20%), Positives = 117/318 (36%), Gaps = 30/318 (9%)

Query: 109 RPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSR 168
           R  R + S  +  + +  S ++F+ NL      + L + FS  G ++   I T   G  R
Sbjct: 143 RLARELDSTYEEKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIITSR-GHHR 201

Query: 169 KFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA-----PHVSKKDRQSKLDEVKSNF--T 221
             G V F         I   +G  L   E++V      P   +   + +   ++++    
Sbjct: 202 GMGTVEFTNADDVDEAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGY 261

Query: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEEL 281
            V++ N+         + +F + G +  A ++ D +G  RG+G V ++       A+E  
Sbjct: 262 EVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERY 321

Query: 282 NDTDFNGQKLYV-----GRAQKKY-----------ERLQELKKQYESSRMEKLAKY---- 321
           N  +  G+ L V     G A +             E + +   Q   S   +  +     
Sbjct: 322 NGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATGG 381

Query: 322 --QGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATK 379
             Q   +FV NL  S     L + F   G +   ++     G   G   V +  P +A  
Sbjct: 382 GDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEV 441

Query: 380 AITEKNQQIVAGKPLYVA 397
            I+  N     G+ L ++
Sbjct: 442 CISRLNSYNYGGRDLDIS 459

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 82/174 (47%), Gaps = 10/174 (5%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD----ETGK--SRKFGFVHFXXXXXXX 182
           ++FIKNL+ +  ++ L + F  F   +  ++ T     + GK  S  FGF  F       
Sbjct: 652 SIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQAN 711

Query: 183 XXIDAINGMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPE-TKQDEFEK 239
             I A+ G +L+G  L++ ++         +   + K N   + VKN+  E T++D FE 
Sbjct: 712 AVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFE- 770

Query: 240 LFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
           LFS +G + S  +    +   RGF FV F     A  A+++L      G++L +
Sbjct: 771 LFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 824

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 9/101 (8%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           ++++NI     +D+F KLFS YG +    +  D   G+ +GF +V F++ + AA A  EL
Sbjct: 332 LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL 391

Query: 282 NDTDFNGQKLYVGRAQ-KKYERLQE-------LKKQYESSR 314
           +   F G+ L++  A  KK  +L E       LKKQ E  R
Sbjct: 392 DKQIFQGRLLHILPADAKKSHKLDEFDLKNLPLKKQRELKR 432

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 305 ELKKQYESSRMEKLAKYQGV-NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGS 362
           E++   ES   + L K +    LF++N+  +  ++  ++ F+P+G +  V +  D   G 
Sbjct: 310 EVETSQESEEEKSLKKIRETGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQ 369

Query: 363 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKE 403
           SKGF +V F   + A  A  E ++QI  G+ L++  A  K+
Sbjct: 370 SKGFAYVLFKNADNAATAFVELDKQIFQGRLLHILPADAKK 410

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 84/187 (44%), Gaps = 14/187 (7%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK------LRGFGFVNFEDHNAA 274
            ++++KN++  T   +  + F  +     A ++T  + K        GFGF  F+    A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDS 334
              +  +  T  +G KL +  + ++            ++  +K  K QG  + VKNL   
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQ-------GTSTTNASSKKKKKNQG-KIIVKNLPFE 762

Query: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
              + + E F+ FG + SV+V +    S++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 763 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 822

Query: 395 YVAIAQR 401
            +   ++
Sbjct: 823 VMEFVEQ 829

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 69/170 (40%), Gaps = 13/170 (7%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGS--VSSIRVCRDAIT--KT-SLGYAYVNFHDHNA 93
           + S+++  L+ S T   L + F P     V+ ++   D     KT S+G+ +  F     
Sbjct: 650 TVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQ 709

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPS--------LRKKGSGNVFIKNLHPAIDNKALH 145
               I  +  T + G   ++  S R  +         +KK  G + +KNL      K + 
Sbjct: 710 ANAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVF 769

Query: 146 DTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG 195
           + FS FG + S ++       +R F FV F         +D + G+ L G
Sbjct: 770 ELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLG 819

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%)

Query: 20  EQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKT 79
           E  T   S + +S K    +  L++  +  + TE     LFSP G +  + +  D  T  
Sbjct: 310 EVETSQESEEEKSLKKIRETGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQ 369

Query: 80  SLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIM 114
           S G+AYV F + +   TA  +L+    +GR   I+
Sbjct: 370 SKGFAYVLFKNADNAATAFVELDKQIFQGRLLHIL 404

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFG--TITSVKVMRDDAGSSK----GFGFVCFSTPEEA 377
           V++F+KNL+ S   ++L E+F PF    +  VK   D     K    GFGF  F T E+A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 378 TKAITEKNQQIVAGKPLYVAIAQRK 402
              I+     I+ G  L + ++ R+
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQ 735

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%), Gaps = 3/107 (2%)

Query: 14  QLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCR 73
           QL++   Q  G ++T++ S K + +   + V  L    T   +++LFS  G + S+RV +
Sbjct: 728 QLKLSHRQ--GTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPK 785

Query: 74  DAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120
               K++ G+A+V F        A+++L    + GR   + + ++DP
Sbjct: 786 -KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMEFVEQDP 831

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 108/255 (42%), Gaps = 49/255 (19%)

Query: 116 SQRDPSLRK-KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFV 173
           S+ + SL+K + +G +F++N+            FS +G +    IA D  TG+S+ F +V
Sbjct: 317 SEEEKSLKKIRETGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYV 376

Query: 174 HFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETK 233
            F            ++  +  G  +++ P  +KK    KLDE         +KN+ P  K
Sbjct: 377 LFKNADNAATAFVELDKQIFQGRLLHILPADAKKSH--KLDEFD-------LKNL-PLKK 426

Query: 234 QDEFEK-------------LFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAK-AVE 279
           Q E ++             L+    A+ S+V   D  G ++    ++ E+ ++A K A+ 
Sbjct: 427 QRELKRKANSAQQTFSWNSLYMNQDAVLSSV--ADKLG-MKKSELIDAENSSSAVKQALA 483

Query: 280 ELNDTDFNGQKLYVGRAQKKYER----LQELKKQYESSRMEKLAKYQGVNLFVKNLDDSI 335
           E +          +G  +K +E     L +  +   S R +++       + VKN     
Sbjct: 484 EAS---------VIGDVRKFFETRGVDLTKFAQLKNSERDDRV-------ILVKNFPYGT 527

Query: 336 DDEKLQEEFAPFGTI 350
             E++ E F PFG +
Sbjct: 528 TREEIAELFLPFGKL 542

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/317 (22%), Positives = 130/317 (41%), Gaps = 40/317 (12%)

Query: 115 WSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFV 173
           WS  +        GN++++ +   +  + L   F+ FG IL  KI  D  T +S  FGFV
Sbjct: 178 WSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFV 237

Query: 174 HFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQS-KLDEVKSN-------FTNVYV 225
            +         I  +NG L+NG  ++V  HV +K+R+    D+ K N       F  V+V
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKGVFV 297

Query: 226 KN----------IDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAA 275
            N          + P    ++F+K       ++    +T+++        V + + +  +
Sbjct: 298 GNLPIFTTENKLLTPSIVLEKFKKALPDCEMVSYFFPKTNSQTN------VEYSETDEDS 351

Query: 276 KAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ---GVNLFVKNLD 332
           K+   L+    N +   V       E  +   ++ E  +++ + K+      ++ +KN  
Sbjct: 352 KSESPLH---LNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGDEDIVMKNDA 408

Query: 333 DSIDDEKLQEEFAPFGTITSVKVMRDDAGSS-------KGFGFVCFSTPEEATKAITEKN 385
            +  D ++ +  +   +    +   ++  SS       KG+GF  F+T E A K I   N
Sbjct: 409 TTSSDTEVPKSSS--SSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFN 466

Query: 386 QQIVAGKPLYVAIAQRK 402
                G  L V  A +K
Sbjct: 467 DSQWYGHQLVVNKAIQK 483

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 17/98 (17%)

Query: 322 QGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVM--------RDDA--------GSSKG 365
           Q  NL+VK+L     DE L + F  FG I S K++        +DD         G SKG
Sbjct: 728 QESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKG 787

Query: 366 FGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 402
           +GFVCF  P +A++A+   +  ++ +   L+V+ AQR+
Sbjct: 788 YGFVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRR 825

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%)

Query: 257 EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQE 305
           E  L+G+GF  F  H  A K +E  ND+ + G +L V +A +K+ + Q 
Sbjct: 441 ESPLKGYGFFRFATHEMALKCIETFNDSQWYGHQLVVNKAIQKFHQHQH 489

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 54/104 (51%), Gaps = 17/104 (16%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSA--------VLETDNE--------GKLRGFG 264
           +N+YVK++  + + ++  + F ++G I SA        + E D++        GK +G+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 265 FVNFEDHNAAAKAVEELNDTDFNG-QKLYVGRAQKKYERLQELK 307
           FV F++   A++A+   +    N    L+V  AQ++ + +  +K
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSKSIDSIK 833

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 53/121 (43%), Gaps = 16/121 (13%)

Query: 30  SESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89
           SE+        +LYV  +  ++T+  L  +F+  G +  +++  D+ T  S+G+ +V++ 
Sbjct: 181 SENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYA 240

Query: 90  DHNAGTTAIEKLNYTPIKGRPCRI---------------MWSQRDPSLRKKGSGNVFIKN 134
             +  +  I++LN   + G P  +                W Q +     K  G VF+ N
Sbjct: 241 LGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKG-VFVGN 299

Query: 135 L 135
           L
Sbjct: 300 L 300

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 20/112 (17%)

Query: 128 GNVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT---------------DET-GKSRKFG 171
            N+++K+L     ++ L+  F  FG I+S KI T               DE  GKS+ +G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 172 FVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSK-LDEVKSNFTN 222
           FV F         +   +G+ LN         VS   R+SK +D +K   +N
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLF---VSFAQRRSKSIDSIKGPVSN 838

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 85/205 (41%), Gaps = 10/205 (4%)

Query: 201 APHVSKKDRQSKLDEVKSNFTN-VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK 259
            P ++++   +  ++V  N+TN ++V N+  +   ++ +  FSQ G +  A + T + G 
Sbjct: 86  GPRLARELDSTYEEKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIIT-SRGH 144

Query: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319
            RG G V F       +A+ + +      ++++V +     E          S     + 
Sbjct: 145 HRGMGTVEFTSGEEVDEAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVT 204

Query: 320 K--------YQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCF 371
           K         +G  L + NL  SI  + L+  F  FG +    V  D  G S G G V F
Sbjct: 205 KPKKAVKPQKKGYELMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIF 264

Query: 372 STPEEATKAITEKNQQIVAGKPLYV 396
              E+  KA    N   + GK L V
Sbjct: 265 KNQEDMVKAYEHFNGFEIEGKVLEV 289

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 66/189 (34%), Gaps = 38/189 (20%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTS--LGYAYVNFHDHNAGTTAI 98
           S++VG L    T   L D FS +G V    V  D IT      G   V F        AI
Sbjct: 108 SIFVGNLTYDCTPEDLKDFFSQVGKV----VRADIITSRGHHRGMGTVEFTSGEEVDEAI 163

Query: 99  EKLNYTPIKGRPCRIMWSQRDP---------------------------SLRKKGSGNVF 131
            K +   +  R  +I   Q +P                             +KKG   + 
Sbjct: 164 RKFDGAYLMNR--QIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGY-ELM 220

Query: 132 IKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGM 191
           I NL  +I  + L   F  FG++L   +  D TG S   G V F          +  NG 
Sbjct: 221 ILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGF 280

Query: 192 LLNG--LEV 198
            + G  LEV
Sbjct: 281 EIEGKVLEV 289

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 38/58 (65%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITE 383
           LFV  L  ++D+ +LQ+ F  +G I S +++RD  G S+G+GFV F++ E++ +   E
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRE 174

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 30/46 (65%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHF 175
           +F+  LH A+D   L  +F  +G+I SC+I  D+ GKSR +GFV F
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQF 162

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%)

Query: 220 FTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
           +  ++V  +     + E +K F +YG I S  +  D +GK RG+GFV F  +  + +   
Sbjct: 114 YRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFR 173

Query: 280 EL 281
           EL
Sbjct: 174 EL 175

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 44/94 (46%)

Query: 20  EQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKT 79
           E   G  S  +   K     A +Y G L+  +TE  +  +FS  G    I++ RD  T+ 
Sbjct: 14  ELECGILSAKASWHKEYEEQAYIYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRE 73

Query: 80  SLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRI 113
           S G+ Y+ + D  +   A++ LN   I GR  ++
Sbjct: 74  SKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKV 107

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK-LRGFGFVNFEDHNAAAKAVEEL 281
           +Y  +++ E  + +   +FSQYG      L  D E +  +GFG++ +ED  +   AV+ L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 282 NDTDFNGQKLYVGRA 296
           N     G+ + V  A
Sbjct: 96  NGATIAGRTIKVDHA 110

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 344 FAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           F+ +G    +K++RD +   SKGFG++ +        A+   N   +AG+ + V
Sbjct: 54  FSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKV 107

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 7/85 (8%)

Query: 316 EKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPE 375
           E+  +Y    L VK     +++ +L E F+P+G +  VK+M        GF FV F  PE
Sbjct: 29  EQEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLM-------SGFAFVEFEKPE 81

Query: 376 EATKAITEKNQQIVAGKPLYVAIAQ 400
            A +AI + N ++ A  PL V+ ++
Sbjct: 82  SAEQAIKDVNGKMFADMPLTVSYSR 106

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T ++VK   P+ ++ E +++FS YGA+    L       + GF FV FE   +A +A+++
Sbjct: 37  TRLHVKPFPPDVEEHELDEIFSPYGALKEVKL-------MSGFAFVEFEKPESAEQAIKD 89

Query: 281 LNDTDFNGQKLYVGRAQKKYERLQ 304
           +N   F    L V  ++    R +
Sbjct: 90  VNGKMFADMPLTVSYSRMPMPRFR 113

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 15/114 (13%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           +GE S+  L+V    P V E  L ++FSP G++  +++          G+A+V F    +
Sbjct: 31  EGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLMS--------GFAFVEFEKPES 82

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRD-PSLRKKGSGNVFIKNLHPAIDNKALHD 146
              AI+ +N       P  + +S+   P  R K      I+NL   I  + L D
Sbjct: 83  AEQAIKDVNGKMFADMPLTVSYSRMPMPRFRIK------IRNLPEGIAWQELKD 130

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 84/170 (49%), Gaps = 22/170 (12%)

Query: 256 NEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKL-------YVGRAQKKYERLQELKK 308
           N  K +GF ++ F++     KAV EL+++  NG+ +       Y GR  K  + L  + K
Sbjct: 178 NAMKNKGFCYMFFKNV-EQMKAVLELSESHLNGRNMLIKDSENYSGRPDK--DDLVAMSK 234

Query: 309 QYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMR-DDAGSSKGFG 367
               SR+          LFV NL   + D+ L++ F   G I  +++   +D+G  KGF 
Sbjct: 235 N-PPSRI----------LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFA 283

Query: 368 FVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARN 417
           F+ F   E +T  + +K+ + +AG+PL +   + +  R+ +   +  +RN
Sbjct: 284 FIDFKNEEGSTNELKDKSCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRN 333

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           L+VG L   VT+ LL   F   G +  IR+     +    G+A+++F +    T  ++  
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 102 NYTPIKGRPCRIMWSQ 117
           +   I GRP R+ + +
Sbjct: 301 SCRKIAGRPLRMEYGE 316

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 79/402 (19%), Positives = 146/402 (36%), Gaps = 128/402 (31%)

Query: 128 GNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDA 187
           GN+FI  +   +    L +TF  FG I S KI  D   K+   GF+ F         I  
Sbjct: 139 GNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFD--NKNVGIGFLSFMLGSEAAECIRC 196

Query: 188 INGMLL---NGLE--VYVAPHVSKKDRQSKL----------------------------- 213
           +NG  +   NG E  +++  H+ +K+R+                                
Sbjct: 197 MNGTKIRSDNGDEGTLFINYHIERKERERLFLSHESSDSSASSLSVRNMRVNTHHRGKHN 256

Query: 214 -DEVKSNFTN-----------VYVKNIDPETKQ-----DEFEKLFSQYGAITSAVLETDN 256
             E+ S  TN           V++ N+  + +      D+  + F     I+       +
Sbjct: 257 SPELNSWSTNNSSDDLTINNCVFIGNLPTDIQNEGEFIDDLTEAFPSVTVISYYFPYDHS 316

Query: 257 EGKLRGFGFVNFEDHNAAAKAVEELNDT--DFNGQKLYVGRAQKK----------YERLQ 304
             + +G+GF+  ++++ A + + E++    +F G  +   +A  K          Y +  
Sbjct: 317 LNQYKGYGFIKLQNNDQARRIIHEISTDCFEFCGNHIIANKASNKDNKTTSHFTLYTKTT 376

Query: 305 ELKKQYESSRMEKLAKYQG----------------------------------------- 323
           E   +  ++ +E+ + Y G                                         
Sbjct: 377 ETNPKTRNNYLEQTSPYAGGINTFPPSMNNYTFGYDLYPPIKRGSHNLPYIYGLPVPLEG 436

Query: 324 ---VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVM------RDDA-----------GSS 363
               N++VK++     D+ L   + PFG I S K++      R++            G S
Sbjct: 437 QQESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGIS 496

Query: 364 KGFGFVCFSTPEEATKAITEKNQQIVAG--KPLYVAIAQRKE 403
           +G+GFV F+ P +A  AI   +   + G  + L V+ AQ+K+
Sbjct: 497 RGYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKK 538

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 25/139 (17%)

Query: 122 LRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT--------------DET--- 164
           L  +   N+++K++     +K L + +  FGNI+SCKI T              DE    
Sbjct: 434 LEGQQESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPF 493

Query: 165 GKSRKFGFVHFXXXXXXXXXIDAINGMLLNG----LEVYVAPHVSKKDRQSKLDEVKSNF 220
           G SR +GFV+F         I + +G  L G    L V  A    KKD QS LDE  SN 
Sbjct: 494 GISRGYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYA-QKKKKDGQSLLDESLSNE 552

Query: 221 TNVYVKNIDPETKQDEFEK 239
           ++     ID   K +E EK
Sbjct: 553 SS---DQIDNSEKTNEKEK 568

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 19/105 (18%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLET--------------DNE---GKLRGF 263
           +N+YVK++  +    +    +  +G I S  + T              D +   G  RG+
Sbjct: 440 SNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGY 499

Query: 264 GFVNFEDHNAAAKAVEELNDTDFNG--QKLYVGRAQKKYERLQEL 306
           GFV F +   AA A+   +     G  QKL V  AQKK +  Q L
Sbjct: 500 GFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSL 544

>Kwal_55.20972
          Length = 135

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A ++VG L   +TE  +  +FS  G    +++ RD  +  S G+AY+ + D  +   A++
Sbjct: 34  AYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVD 93

Query: 100 KLNYTPIKGRPCRI---MWSQRD 119
            LN   I GR  R+   M++ RD
Sbjct: 94  NLNGVKIAGRSIRVDHTMFTPRD 116

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           ++V  +  +  + +   +FSQYG      L  D E G+ +GF ++ +ED  +   AV+ L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 282 NDTDFNGQKLYV 293
           N     G+ + V
Sbjct: 96  NGVKIAGRSIRV 107

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 11/112 (9%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXX 183
           K    +F+  LH  +    +   FS +G  +  K+  D E+G+S+ F ++ +        
Sbjct: 31  KDQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVL 90

Query: 184 XIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQD 235
            +D +NG+ + G  + V  H     R    D         Y + ++ E K+D
Sbjct: 91  AVDNLNGVKIAGRSIRV-DHTMFTPRDDDYD---------YARAVEKELKKD 132

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEK 384
           +FV  L   + +  +   F+ +G    +K++RD ++G SKGF ++ +        A+   
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 385 NQQIVAGKPLYV 396
           N   +AG+ + V
Sbjct: 96  NGVKIAGRSIRV 107

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 41  SLYVGELDPSVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           SL+VG+L P+ TEA L  LF +   SV ++RV  D IT  S  + +V F D      A+ 
Sbjct: 163 SLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALA 222

Query: 100 KLNYTPIKGRPCRIMWS 116
           ++N    +GR  R+ ++
Sbjct: 223 EMNGVWCQGRQLRVAYA 239

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 94/238 (39%), Gaps = 64/238 (26%)

Query: 20  EQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCR------ 73
           E P+    T SE  +      +L++G+LDPS  EA +  ++  +G    +++ R      
Sbjct: 8   EPPSTTVQTSSEPPR------TLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLL 61

Query: 74  -DAITKTSLGYAYVN----------FHD------HNAGTTAIE-----------KLNYTP 105
               T ++L  ++V+          F D      H+AG   ++           +LN TP
Sbjct: 62  IPCSTSSTLSASHVDEERIQINGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQLNATP 121

Query: 106 IKG---------------RPCRIMWS-----QRDPSLRKKGSGNVFIKNLHPAIDNKALH 145
           +                 R  R+ W+     Q D     + S  +F+ +L P      L 
Sbjct: 122 LPNVVSPTTRNPTNPTGKRNFRLNWASGATLQSDIPATPEFS--LFVGDLSPTATEAHLL 179

Query: 146 DTFSV-FGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA 201
             F   F ++ + ++ TD  TG SR FGFV F         +  +NG+   G ++ VA
Sbjct: 180 SLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVA 237

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 325 NLFVKNLDDSIDDEKLQEEF-APFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAIT 382
           +LFV +L  +  +  L   F   F ++ +V+VM D   G+S+ FGFV F+  +E  +A+ 
Sbjct: 163 SLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALA 222

Query: 383 EKNQQIVAGKPLYVAIA 399
           E N     G+ L VA A
Sbjct: 223 EMNGVWCQGRQLRVAYA 239

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 222 NVYVKNIDPETKQDEFEKLF-SQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVE 279
           +++V ++ P   +     LF +++ ++ +  + TD   G  R FGFV F D     +A+ 
Sbjct: 163 SLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALA 222

Query: 280 ELNDTDFNGQKLYVGRAQKKYERL 303
           E+N     G++L V  A  +   L
Sbjct: 223 EMNGVWCQGRQLRVAYATPRNNLL 246

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 319 AKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEAT 378
           A      +F+  L + I + +L   F PFG I SVKV        +G GFV F    +A 
Sbjct: 321 ADTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV-----PPGRGCGFVRFENRMDAE 375

Query: 379 KAITEKNQQIVAGKPLYVA 397
            AI      IV G  + ++
Sbjct: 376 AAIQGMQGFIVGGNAIRLS 394

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 27/67 (40%), Gaps = 5/67 (7%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAI 188
            VFI  L   I    LH  F  FGNILS K+        R  GFV F         I  +
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKVP-----PGRGCGFVRFENRMDAEAAIQGM 381

Query: 189 NGMLLNG 195
            G ++ G
Sbjct: 382 QGFIVGG 388

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 39/83 (46%), Gaps = 6/83 (7%)

Query: 35  GEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAG 94
            + ++ ++++G L   ++E  L+ LF P G++ S++V          G  +V F +    
Sbjct: 321 ADTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDA 374

Query: 95  TTAIEKLNYTPIKGRPCRIMWSQ 117
             AI+ +    + G   R+ W +
Sbjct: 375 EAAIQGMQGFIVGGNAIRLSWGR 397

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 13/99 (13%)

Query: 298 KKYERLQELKKQYESSRMEKLAKY--------QGVN----LFVKNLDDSIDDEKLQEEFA 345
           ++YE L+ +  + E    E+LAK+        QG +    +FV  L   +D+ +LQ+ F 
Sbjct: 69  QRYEELKTINSRKEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFI 128

Query: 346 PFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITE 383
            FG I  V+++RD      +G+ FV F  PE + KA  E
Sbjct: 129 KFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +++VG L   V E  L   F   G +  +R+ RD IT    GYA+V F D      A  +
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 101 L 101
           +
Sbjct: 168 I 168

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 4/76 (5%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFX---XXXXXXXX 184
            +F+  LH  +D   L   F  FG I   +I  D+ T K R + FV F            
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 185 IDAINGMLLNGLEVYV 200
           I    G+++ G    V
Sbjct: 168 IGVHRGLMIRGRSAIV 183

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 220 FTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAV 278
           F  ++V  +  +  + E +K F ++G I    +  D    K RG+ FV F D   + KA 
Sbjct: 106 FRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAY 165

Query: 279 EEL 281
            E+
Sbjct: 166 REI 168

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 85/171 (49%), Gaps = 28/171 (16%)

Query: 256 NEGKL---RGFGFVNFEDHNAAAKAVEELNDTDFNGQKL-------YVGRAQKKYERLQE 305
           N+GK    +GF +++F++      AV  L+++  NG+ +       Y GR  K    L  
Sbjct: 165 NDGKKIRNKGFAYMDFKNKEQM-NAVIGLSESQLNGRNMLIKNSSSYEGRPDKND--LIA 221

Query: 306 LKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMR-DDAGSSK 364
           + K    SR+          LFV NL     DE L++ F   G I  V++    D+G  K
Sbjct: 222 MSKN-PPSRI----------LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCK 270

Query: 365 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ---RKEVRRSQLAQQ 412
           GF F+ F   +  T+A+T+K+ + +AG+PL +   +   +++V+R + + Q
Sbjct: 271 GFAFIDFKDEKGPTEALTDKSCRKIAGRPLRMEFGEDRSKRQVKRRENSSQ 321

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           L+VG L    T+ LL   F   G +  +R+     +    G+A+++F D    T A+   
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 102 NYTPIKGRPCRIMWSQ 117
           +   I GRP R+ + +
Sbjct: 291 SCRKIAGRPLRMEFGE 306

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 126/321 (39%), Gaps = 26/321 (8%)

Query: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT 161
           +Y P+  R     + ++   + +  S ++F+ NL      + L + FS  G ++   I T
Sbjct: 113 DYGPLLARELDSTYEEK---VNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIIT 169

Query: 162 DETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA-----PHVSKKDRQSKLD-- 214
              G  R  G V F         I   +G      +++V      P  + K+R++ LD  
Sbjct: 170 -SRGHHRGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKA-LDRG 227

Query: 215 EVKSNFTN--VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHN 272
           E++ N     V VKN+         + +F + G +  A +E D +G   G G V+F D  
Sbjct: 228 ELRHNRKTHEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIK 287

Query: 273 AAAKAVEELNDTDFNGQKLYVGRAQKKYERL--QELKKQYESSRMEKLAKYQGVN----- 325
              +A+E+ N     G  L V   +  +      ++    + S + + A+    N     
Sbjct: 288 DLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGG 347

Query: 326 -----LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKA 380
                ++  NL  S     L + F   G + + ++  D  G+  G   V +   ++A   
Sbjct: 348 ERNRLIYCSNLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADVC 407

Query: 381 ITEKNQQIVAGKPLYVAIAQR 401
           I   N     G  L ++ A+R
Sbjct: 408 IERLNNYNYGGCDLDISYAKR 428

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           S+++G LD    E  L+  FSP G V  IR+ RD+ T    G+AYV F D  +   A+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKAL-L 366

Query: 101 LNYTPIKGRPCRIMWSQRDPSLRK 124
           LN   I G   ++  S R  ++RK
Sbjct: 367 LNEKKINGNGRKLRVS-RCKNMRK 389

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEATKAITE 383
           ++F+ NLD    +E L + F+P G +  ++++RD   +  KGF +V F   +   KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALL- 366

Query: 384 KNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMRY 421
            N++ + G    + +++ K +R+SQ AQ     N  RY
Sbjct: 367 LNEKKINGNGRKLRVSRCKNMRKSQPAQ-----NSSRY 399

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKL-RGFGFVNFEDHNAAAKA 277
           N  +V++ N+D E  ++   K FS  G +    +  D++  + +GF +V F+D  +  KA
Sbjct: 305 NKRSVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKA 364

Query: 278 VEELNDTDF--NGQKLYVGRAQ 297
           +  LN+     NG+KL V R +
Sbjct: 365 L-LLNEKKINGNGRKLRVSRCK 385

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

Query: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEG 258
           ++PH      QS  +E K N   +Y+ N++ E  + +   +FS+YG     +L  D N G
Sbjct: 17  LSPH------QSWHNEYKDN-AYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTG 69

Query: 259 KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRME 316
           + +GF ++ +ED  +   AV+ LN     G+ L +     + +R   L+K YE+ + E
Sbjct: 70  ESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKR--SLQKYYEAVKEE 125

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           +A +Y+G L+  +TE  +  +FS  G    + + RD  T  S G+AY+ + D  +   A+
Sbjct: 30  NAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAV 89

Query: 99  EKLNYTPIKGRPCRI 113
           + LN   I GR  +I
Sbjct: 90  DNLNGFKIGGRALKI 104

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXX 183
           K +  ++I NL+  +    +   FS +G  +   ++ DE TG+S+ F ++ +        
Sbjct: 28  KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTIL 87

Query: 184 XIDAINGMLLNG 195
            +D +NG  + G
Sbjct: 88  AVDNLNGFKIGG 99

>Kwal_33.14463
          Length = 393

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 73/159 (45%), Gaps = 25/159 (15%)

Query: 259 KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV-------GRAQKKYERLQELKKQYE 311
           K +GF  +NF+       AV  L+++  NG+ L +       GR  K    L  + K   
Sbjct: 177 KNKGFAHMNFKTQEQM-NAVVALSESHLNGRNLLIKDSSSFDGRPDKND--LISMSKN-P 232

Query: 312 SSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMR-DDAGSSKGFGFVC 370
            SR+          LFV NL     DE L++ F   G I  +++    D G  KGF FV 
Sbjct: 233 PSRI----------LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVD 282

Query: 371 FSTPEEATKAITEKNQQIVAGKPLYVAIAQ---RKEVRR 406
           F   E  T A+ +K  + +AG+PL +   +   +++VRR
Sbjct: 283 FKDEEGPTNALKDKTCRKIAGRPLRMEFGEDRSKRQVRR 321

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 50/124 (40%), Gaps = 18/124 (14%)

Query: 25  PTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYA 84
           P   D  S      S  L+VG L    T+ LL   F   G +  IR+     T    G+A
Sbjct: 220 PDKNDLISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFA 279

Query: 85  YVNFHDHNAGTTAIEKLNYTPIKGRPCRIMW------------------SQRDPSLRKKG 126
           +V+F D    T A++      I GRP R+ +                  S+ +PSLR++ 
Sbjct: 280 FVDFKDEEGPTNALKDKTCRKIAGRPLRMEFGEDRSKRQVRRRAPEAPVSRPEPSLREEH 339

Query: 127 SGNV 130
           S N 
Sbjct: 340 SSNA 343

>Kwal_0.250
          Length = 216

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 2/118 (1%)

Query: 264 GFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQG 323
           G V F +    +KA+++ +   F G++L+V   +     ++  +   +   +E+   + G
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERF--HPG 59

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
             +F+ NL  S   + L++ F   G  T   V  D  G SKGFG V F T +EA  A+
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTAL 117

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 82/215 (38%), Gaps = 34/215 (15%)

Query: 86  VNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP-SLRKKGSG-------------NVF 131
           V F +    + AI+K +     GR   +   +  P S+R + SG              +F
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 132 IKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGM 191
           I NL  +   ++L D F   GN     +  D  G+S+ FG V F         +D     
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQHF 123

Query: 192 LLNG--LEVY----------------VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETK 233
            L G  LE+                 V+  ++ +   +  +  KSN   +YV N+   T 
Sbjct: 124 DLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSN--TIYVDNLPYATA 181

Query: 234 QDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNF 268
           Q +   LF   G +  A L+ D + K  G   V++
Sbjct: 182 QSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 56/134 (41%)

Query: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ 322
            G V F +      A+ + +    NG+ ++V +       +             K A  +
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 323 GVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAIT 382
           G  +FV  L  S++ ++L++ F P G +    V+ D  G S+GFG V  +T E+   AI 
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIR 120

Query: 383 EKNQQIVAGKPLYV 396
                   G+ L V
Sbjct: 121 HWTGTEYKGRVLDV 134

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/261 (19%), Positives = 89/261 (34%), Gaps = 30/261 (11%)

Query: 170 FGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA---PHVSKKDRQSKLDEVKSNFTN---- 222
            G V F         I   +G  LNG  ++V    P  ++  R    +            
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 223 ---VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
              V+V  +       E + +F   G +  A + TD +GK RGFG V          A+ 
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIR 120

Query: 280 ELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSR----------------MEKLAKYQG 323
               T++ G+ L V   +    R           R                ++ LA   G
Sbjct: 121 HWTGTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTG 180

Query: 324 VN----LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATK 379
            +    +F +N+  S  +  L + F     +   K++ +  G      +  F TPE+A  
Sbjct: 181 GDRNSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADI 240

Query: 380 AITEKNQQIVAGKPLYVAIAQ 400
            I++ ++       L V  A+
Sbjct: 241 CISKLDKYSYGDHELKVTYAR 261

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 71/198 (35%), Gaps = 30/198 (15%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFV-------------HFX 176
           VF+  L  +++ + L D F   G++L   + TD  GKSR FG V             H+ 
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIRHWT 123

Query: 177 XXXXXXXXIDAING------MLLNGLEVYVA------PHVSKKDRQSKLDEVKSNF---- 220
                   +D   G          G + Y+       P  + K +   +D +        
Sbjct: 124 GTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTGGDR 183

Query: 221 -TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
            + ++ +N+   T + +   LF     +    L  + EG      +  FE    A   + 
Sbjct: 184 NSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADICIS 243

Query: 280 ELNDTDFNGQKLYVGRAQ 297
           +L+   +   +L V  A+
Sbjct: 244 KLDKYSYGDHELKVTYAR 261

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%)

Query: 29  DSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNF 88
           + E  KG     ++++G L   VTE  L   FS  G +  +RV RD  T  S GYA++ F
Sbjct: 46  NDEHIKGTDPFRTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVF 105

Query: 89  HDHNAGTTAIEKL 101
            D      A +++
Sbjct: 106 RDETGSRAACKEI 118

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 16/124 (12%)

Query: 298 KKYERLQELKKQYESSRMEKLAKYQGVN------------LFVKNLDDSIDDEKLQEEFA 345
           KKYE L+  K +      EK  ++   N            +F+  L   + + +LQ+ F+
Sbjct: 19  KKYEELESAKNEEMGKLHEKTLEWDPENDEHIKGTDPFRTVFIGRLPYEVTEVELQKHFS 78

Query: 346 PFGTITSVKVMRDDAGS-SKGFGFVCF---STPEEATKAITEKNQQIVAGKPLYVAIAQR 401
            FG I  V+V+RD + S S+G+ F+ F   +    A K I       + G+ + V I + 
Sbjct: 79  RFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKEIGVHRGLDIQGRSVIVDIERG 138

Query: 402 KEVR 405
           + V+
Sbjct: 139 RTVK 142

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 10/113 (8%)

Query: 220 FTNVYVKNIDPETKQDEFEKLFSQYGAITSA-VLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           F  V++  +  E  + E +K FS++G I    V+   +  K RG+ F+ F D   +  A 
Sbjct: 56  FRTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAAC 115

Query: 279 EEL---NDTDFNGQKLYV----GRAQKKYE--RLQELKKQYESSRMEKLAKYQ 322
           +E+      D  G+ + V    GR  K ++  RL         ++ EK+AK+Q
Sbjct: 116 KEIGVHRGLDIQGRSVIVDIERGRTVKYFKPRRLGGGLGGRGYTKREKMAKFQ 168

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 125/316 (39%), Gaps = 39/316 (12%)

Query: 116 SQRDPSLRKKGSGNVFIKNLHPAIDNKALHDT----FSVFGNILSCKIATDETGKSRKFG 171
           S  DPS  +  S  +F+ +L   + +  L+ +    F+ +G I+S K+  D     R + 
Sbjct: 109 SSDDPSFSRPSSC-IFVASLAATLSDSELNASVTKEFAKYGKIVSVKVLRDPAN--RPYA 165

Query: 172 FVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPE 231
           FV +         +    G  LN   +       ++ + ++   + S+F N     +  E
Sbjct: 166 FVQYASDDEALNALSQAQGTTLNNRNIRC-----ERAKVNRTVFISSSFANPLEGKLTVE 220

Query: 232 TKQDEFEKLFSQYGAITSAVLETDNEGKLRGF-------GFVNFEDHNAAAKAVEELNDT 284
              D    L S++G +   V   D   K   +        F+ +   + A +A  ++   
Sbjct: 221 KVVD----LMSKFGELEQVVPSRDQMYKKNYYPSEVANSWFIQYAYRDDAIRAYLQM--- 273

Query: 285 DFNGQKLYVGRAQK-----KYERLQELKKQYESSRMEK--LAK----YQGVNLFVKNLDD 333
             N + + V  AQ      ++  L    K  E  R+E+    K        ++F+  L+ 
Sbjct: 274 KLNYEYM-VEWAQNVDVPPRFNLLLSKAKICEKERLERERFGKQPIFIDNKSIFIGQLNF 332

Query: 334 SIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 393
            +    L E F+ +G I +  ++       K F F+ + TP  A KA+  +N  I   K 
Sbjct: 333 KVTKPLLLERFSKYGEIDNCNLIHKQE-QLKCFAFIKYKTPASAAKALERENHSIFVEKI 391

Query: 394 LYVAIAQRKEVRRSQL 409
           L+V I +    RRS +
Sbjct: 392 LHVQIREVSNSRRSSI 407

>Kwal_14.1851
          Length = 535

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 41  SLYVGELDPSVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           SL+VG+L P+ TEA L  LF     SV ++RV  D IT  S  + +V F D      A+ 
Sbjct: 175 SLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALV 234

Query: 100 KLNYTPIKGRPCRIMWS 116
           ++N    +GR  R+ ++
Sbjct: 235 EMNGVWCQGRNLRVAYA 251

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 66/154 (42%), Gaps = 5/154 (3%)

Query: 262 GFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYES--SRMEKLA 319
           G+ FV FE   A A+    LN +         G        L+  +  + S  + +  + 
Sbjct: 111 GYCFVEFESL-ADAQWALTLNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIP 169

Query: 320 KYQGVNLFVKNLDDSIDDEKLQEEF-APFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEA 377
                +LFV +L  +  +  L   F   F ++ +V+VM D   G+S+ FGFV F   +E 
Sbjct: 170 STPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQER 229

Query: 378 TKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQ 411
            +A+ E N     G+ L VA A  +     QL Q
Sbjct: 230 RRALVEMNGVWCQGRNLRVAYATPRNNVMWQLTQ 263

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           +F+  L   I + +L   F+PFG I +VK+        KG GFV ++   +A  AI    
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKI-----PPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 386 QQIVAGKPLYVA 397
             IV G P+ ++
Sbjct: 453 GFIVGGNPIRLS 464

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 222 NVYVKNIDPETKQDEFEKLF-SQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVE 279
           +++V ++ P   +     LF  ++ ++ +  + TD   G  R FGFV F D     +A+ 
Sbjct: 175 SLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALV 234

Query: 280 ELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSR 314
           E+N     G+ L V  A  +   + +L +    S+
Sbjct: 235 EMNGVWCQGRNLRVAYATPRNNVMWQLTQNSHQSQ 269

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 11/95 (11%)

Query: 21  QPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTS 80
           QPT P S  +       ++ ++++G L   ++E  L+ LFSP G++ ++++         
Sbjct: 382 QPTAPRSAFTN-----PNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKI------PPG 430

Query: 81  LGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMW 115
            G  +V +        AI+ +    + G P R+ W
Sbjct: 431 KGCGFVKYAYRIDAEAAIQGMQGFIVGGNPIRLSW 465

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 54/140 (38%), Gaps = 21/140 (15%)

Query: 82  GYAYVNFHDHNAGTTAIEKLNYTPIKGRPC---------------RIMWSQRDPSLRKKG 126
           GY +V F        A+  LN +P+    C               R+ W+     L    
Sbjct: 111 GYCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIP 169

Query: 127 SG---NVFIKNLHPAIDNKALHDTF-SVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXX 181
           S    ++F+ +L P      L   F   F ++ + ++ TD  TG SR FGFV F      
Sbjct: 170 STPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQER 229

Query: 182 XXXIDAINGMLLNGLEVYVA 201
              +  +NG+   G  + VA
Sbjct: 230 RRALVEMNGVWCQGRNLRVA 249

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           VFI  L   I  + LH  FS FG I++ KI        +  GFV +         I  + 
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKIP-----PGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 190 GMLLNGLEVYVAPHVSKKD--RQSKLDEVKS 218
           G ++ G  + ++   +  D  R S + ++ S
Sbjct: 453 GFIVGGNPIRLSWGRTSADTGRHSAMQDMPS 483

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 69/169 (40%), Gaps = 12/169 (7%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGS--VSSIRVCRDAITK---TSLGYAYVNFHDHNA 93
           + S+++  L+ S T   L D F       V+ ++   D   +    S+G+ +V F     
Sbjct: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPS-------LRKKGSGNVFIKNLHPAIDNKALHD 146
               I  ++ T I G   ++  S R  S          K SG + +KNL      K + +
Sbjct: 722 ANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFE 781

Query: 147 TFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG 195
            F+ FG + S ++       +R F FV F         +D ++G+ L G
Sbjct: 782 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLG 830

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEK 384
           LF++N+  +  +E  ++ F+PFG +  V V  D   G SKGF +V F   + A  A  E 
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 385 NQQIVAGKPLYVAIAQRKEVRR 406
           ++QI  G+ L++   + K+  R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHR 428

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 9/101 (8%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           ++++NI   +K+++F KLFS +G +    +  D   G+ +GF +V F+D   A  A  EL
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 282 NDTDFNGQKLYVGRA-QKKYERLQE-------LKKQYESSR 314
           +   F G+ L++    +KK  RL E       LKKQ E  R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKR 447

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 81/182 (44%), Gaps = 15/182 (8%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETD----NEGKL--RGFGFVNFEDHNAA 274
            ++++KN++  T        F  +     A ++T     ++GK    GFGFV F     A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDS 334
              +  ++ T  +G K+ +  + ++           +S   +  +  +   + VKNL   
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSHRQAS---------QSGNTKTKSNKKSGKIIVKNLPFE 773

Query: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
              + + E F  FG + SV+V +    S++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833

Query: 395 YV 396
            +
Sbjct: 834 VM 835

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 4/119 (3%)

Query: 9   AEQLEQLRIQ-DEQP--TGPTSTDSE-STKGEASSASLYVGELDPSVTEALLYDLFSPIG 64
            EQ E L  + +EQP    P  TD E + +    +  L++  +  +  E     LFSP G
Sbjct: 310 TEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFG 369

Query: 65  SVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLR 123
            +  + V  D  T  S G+AYV F D      A  +L+    +GR   I+  +   S R
Sbjct: 370 ELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR 428

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 350 ITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400
           IT VK++RD  G S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 50/102 (49%), Gaps = 4/102 (3%)

Query: 14  QLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCR 73
           QL++   Q +   +T ++S K    S  + V  L    T   +++LF+  G + S+RV +
Sbjct: 740 QLKLSHRQASQSGNTKTKSNK---KSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPK 796

Query: 74  DAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMW 115
               K++ G+A+V F        A+++L+   + GR   + +
Sbjct: 797 -KFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 11/96 (11%)

Query: 106 IKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETG 165
           +KG P  +     D +LR+  +  +  K+ H A+ N +  D       I   KI  D  G
Sbjct: 6   VKGLPVYLT----DDNLREHFTKRLRQKHSHQAV-NGSGPDL------ITDVKILRDRNG 54

Query: 166 KSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA 201
           +SR+FGF+ +         ++  NG  +N  ++ V+
Sbjct: 55  ESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 95/234 (40%), Gaps = 29/234 (12%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXI 185
           +G +F++N+      +     FS FG +    +A D  TG+S+ F +V F          
Sbjct: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403

Query: 186 DAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFE-KLFSQY 244
             ++  +  G  +++ P   KK    +LDE         +KN+ P  KQ E + K  +  
Sbjct: 404 VELDKQIFQGRLLHILPGEEKK--SHRLDEFD-------LKNM-PLKKQKELKRKAAASR 453

Query: 245 GAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQ 304
              +   L  + +  L   G V      AA   +E+    D       V +A  +   + 
Sbjct: 454 QTFSWNSLYMNQDAVL---GSV------AAKLGLEKSQLIDAENSSSAVKQALAEAHVIG 504

Query: 305 ELKKQYESS--RMEKLAKYQGVN------LFVKNLDDSIDDEKLQEEFAPFGTI 350
           +++K +ES    + K ++ +  N      + VKN       E+L E F P+G +
Sbjct: 505 DVRKYFESKGVDLTKFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKL 558

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 247 ITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQ 297
           IT   +  D  G+ R FGF+ + +   A  AVE  N +  N  K+ V  A+
Sbjct: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 41  SLYVGELDPSVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           SL+VG+L P+ TEA L  LF +   SV ++RV  D IT  S  + +V F +      A+ 
Sbjct: 235 SLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALI 294

Query: 100 KLNYTPIKGRPCRIMWS 116
           ++N    +GR  R+ ++
Sbjct: 295 EMNGVHFQGRTLRVAYA 311

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 88/426 (20%), Positives = 156/426 (36%), Gaps = 81/426 (19%)

Query: 18  QDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAIT 77
           Q++    P++T   ++   AS + +   E + S  + L  +    I  VS I      + 
Sbjct: 113 QEDTRDSPSNTTGSASNTPASDSGIQTSEGEQSTQQPLKIN----INGVSFIDPATTQLH 168

Query: 78  KTSLGYAYVNFHDHNAGTTAIEKLNYTPIKG---------------RPCRIMWSQ---RD 119
               GY +V F         +  LN TP+                 R  R+ W+      
Sbjct: 169 HA--GYCFVEFESQKDAQEGL-ALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQ 225

Query: 120 PSLRKKGSGNVFIKNLHPAIDNKALHDTFSV-FGNILSCKIATDE-TGKSRKFGFVHFXX 177
            S+      ++F+ +L P      L   F   F ++ + ++ TD  TG SR FGFV F  
Sbjct: 226 SSIPTTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGN 285

Query: 178 XXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEF 237
                  +  +NG+   G  + VA       R + +   + N  + +  ++     + E 
Sbjct: 286 EEERRRALIEMNGVHFQGRTLRVA---YATPRSTTVMHTQGNNPHDHHVDVRNTISKAEL 342

Query: 238 EKL-FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRA 296
           EK   SQY  + +A   +    +LR    ++   + +  +     ND + +G  L  G  
Sbjct: 343 EKSNLSQY--LMNASNNSQRANQLRSANKMHNYPNASGFQQTHYSNDIN-SGNGLQRGPP 399

Query: 297 QKKYERLQ---------------ELKKQYESSRMEKLAKYQGV----------------- 324
           Q+ Y   Q               ++   Y  +R + L +  G+                 
Sbjct: 400 QRSYNPGQLHYNSYNQPEVNYGTDMSGGYPPNRAD-LGRKDGMINTSFVNTQVSEAALND 458

Query: 325 ---------NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPE 375
                     +FV  L  ++ +++L++ F PFG I S+K+        K  GFV F    
Sbjct: 459 FFATDPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKI-----PPGKNCGFVKFEHKI 513

Query: 376 EATKAI 381
           +A  AI
Sbjct: 514 DAEAAI 519

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 64/147 (43%), Gaps = 15/147 (10%)

Query: 262 GFGFVNFEDHNAAAKAVEELNDTDF-------NGQKLYVGRAQKKYERLQELKKQYESSR 314
           G+ FV FE    A + +  LN T          GQ   +    ++  RL         S 
Sbjct: 171 GYCFVEFESQKDAQEGLA-LNSTPLPNFVSTTTGQD--INPTGQRTFRLNWASGATLQSS 227

Query: 315 MEKLAKYQGVNLFVKNLDDSIDDEKLQEEF-APFGTITSVKVMRDD-AGSSKGFGFVCFS 372
           +    +Y   +LFV +L  +  +  L   F   F ++ +V+VM D   G+S+ FGFV F 
Sbjct: 228 IPTTPEY---SLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFG 284

Query: 373 TPEEATKAITEKNQQIVAGKPLYVAIA 399
             EE  +A+ E N     G+ L VA A
Sbjct: 285 NEEERRRALIEMNGVHFQGRTLRVAYA 311

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 5/64 (7%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           VF+  L P +  + L   F  FGNILS KI        +  GFV F         I  + 
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIP-----PGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 190 GMLL 193
           G +L
Sbjct: 524 GFVL 527

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 58/134 (43%), Gaps = 15/134 (11%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T V+V  + P  ++ +  K+F  +G I S  +        +  GFV FE    A  A++ 
Sbjct: 467 TTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPG-----KNCGFVKFEHKIDAEAAIQG 521

Query: 281 LNDTDF--NGQKLYVGRAQKKYERLQELKKQYESS---RMEKLAKYQGVNLFVKNLDDSI 335
           L       N  +L  GR       + +L  QY SS   R E   +YQ  +  + N  ++I
Sbjct: 522 LQGFVLVENPIRLSWGRNHVAKNMINKLPPQYVSSGNQRQELRPQYQDPSTMLAN--NNI 579

Query: 336 DDEKL---QEEFAP 346
           +++      E+F P
Sbjct: 580 NNQAYTYQHEQFYP 593

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95
           + ++ +++VG L P+V E  L  +F P G++ SI++             +V F       
Sbjct: 463 DPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKI------PPGKNCGFVKFEHKIDAE 516

Query: 96  TAIEKLNYTPIKGRPCRIMW 115
            AI+ L    +   P R+ W
Sbjct: 517 AAIQGLQGFVLVENPIRLSW 536

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 22 PTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCR 73
          P  PTST   S   +    +L++G+LDPS  E  + +++S +G   ++++ R
Sbjct: 31 PLPPTSTIQTS---DEPPRTLWMGDLDPSYDEETIQEIWSHLGKHVTVKLIR 79

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           S++VG LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D  +   A+  
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL-L 338

Query: 101 LNYTPIKG 108
           LN  P+K 
Sbjct: 339 LNEKPMKS 346

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEATKAI 381
           ++FV NLD    +E L + F P G I  V+++RD   +  KGF +V F   +   KA+
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL 337

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 2/92 (2%)

Query: 41  SLYVGELDPSVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           SL+VG+L P  TEA L  LF +   SV ++RV  D IT  S  + +V F +      A+ 
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 100 KLNYTPIKGRPCRIMWSQ-RDPSLRKKGSGNV 130
           ++N    +GR  R+ ++  R+   ++  SGN+
Sbjct: 220 EMNGVQFQGRQLRVAYATPRNNVAQQHLSGNL 251

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 28  TDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRV-----CRDAITKTSLG 82
            ++ +     SS +++VG L+P++ E  L++LF P G+++ +++     C          
Sbjct: 433 VNNNAMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQC---------- 482

Query: 83  YAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQ 117
             +V +++      AI  L    I G P R+ W +
Sbjct: 483 -GFVKYNERLEAEAAINGLQGFIIMGSPIRLSWGR 516

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 81/215 (37%), Gaps = 55/215 (25%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRD------AITKTSL------------- 81
           +L++G+LDP   E ++  ++  +G    +++ +        I  TS+             
Sbjct: 21  TLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEING 80

Query: 82  --------------GYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQR--DPSLRK- 124
                         GY +V F        A+  LN TPI    C    S+R  D   RK 
Sbjct: 81  VSFIDPNKTNLHHAGYCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRKF 139

Query: 125 -----KGSG-----------NVFIKNLHPAIDNKALHDTFSV-FGNILSCKIATDE-TGK 166
                 G+            ++F+ +L P      L   F   + ++ + ++ TD  TG 
Sbjct: 140 RLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGA 199

Query: 167 SRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA 201
           SR FGFV F         +  +NG+   G ++ VA
Sbjct: 200 SRCFGFVRFANETERRNALIEMNGVQFQGRQLRVA 234

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 319 AKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEAT 378
           A      +FV  L+ +I++ +L E F PFGTIT VK+        K  GFV ++   EA 
Sbjct: 440 AGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKI-----PPGKQCGFVKYNERLEAE 494

Query: 379 KAITEKNQQIVAGKPLYVA 397
            AI      I+ G P+ ++
Sbjct: 495 AAINGLQGFIIMGSPIRLS 513

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 67/156 (42%), Gaps = 10/156 (6%)

Query: 262 GFGFVNFEDHNAAAKAVEELNDT---DFNGQKLYVGRAQKKYERLQELKKQYESSRMEKL 318
           G+ FV FE    A +A+  LN T   + +       R     +R   L     ++    +
Sbjct: 95  GYCFVEFESFEDAQQALT-LNATPIPNISCNTTASKRTNDDGKRKFRLNWANGATLHSTI 153

Query: 319 AKYQGVNLFVKNLDDSIDDEKLQEEF-APFGTITSVKVMRDD-AGSSKGFGFVCFSTPEE 376
                 +LFV +L     +  L   F   + ++ +V+VM D   G+S+ FGFV F+   E
Sbjct: 154 LPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETE 213

Query: 377 ATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQ 412
              A+ E N     G+ L VA A      R+ +AQQ
Sbjct: 214 RRNALIEMNGVQFQGRQLRVAYA----TPRNNVAQQ 245

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 223 VYVKNIDPETKQDEFEKLF-SQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEE 280
           ++V ++ P   + +   LF ++Y ++ +  + TD   G  R FGFV F +      A+ E
Sbjct: 161 LFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIE 220

Query: 281 LNDTDFNGQKLYVGRAQKKYERLQE 305
           +N   F G++L V  A  +    Q+
Sbjct: 221 MNGVQFQGRQLRVAYATPRNNVAQQ 245

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 5/69 (7%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXID 186
           S  VF+  L+P I+   L + F  FG I   KI        ++ GFV +         I+
Sbjct: 444 STTVFVGGLNPNINELQLFELFKPFGTITDVKIP-----PGKQCGFVKYNERLEAEAAIN 498

Query: 187 AINGMLLNG 195
            + G ++ G
Sbjct: 499 GLQGFIIMG 507

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI-- 98
           S++VG LD    E  L+  F P G +  +R+ RD+ T    G+AYV F D  + + A+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 99  -EKLNYTPIKGRPCRIMWSQRDPSLRK 124
            EK  +   K R  RI    R  ++RK
Sbjct: 420 HEKKIHEGKKARKLRI---SRCKNMRK 443

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 2/101 (1%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEATKAITE 383
           ++FV NLD    +E L + F P G I  V+++RD   +  KGF +V F   +  +KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 384 KNQQIVAGKPLY-VAIAQRKEVRRSQLAQQIQARNQMRYQQ 423
             ++I  GK    + I++ K +R++Q  Q     N++  QQ
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQQ 460

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 188 INGMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYG 245
           +NG + N   L V    H S  D++           +V+V N+D E  ++   K F   G
Sbjct: 334 LNGKVFNDHHLRVDSVTHPSPHDKRR----------SVFVGNLDFEEVEESLWKHFEPCG 383

Query: 246 AITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAV 278
            I    +  D++  + +GF +V F+D  + +KA+
Sbjct: 384 DIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKAL 417

>Scas_88.1
          Length = 256

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 344 FAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
           F+P+G +  V V  D   G SKGF ++ F  PE A  A  E ++QI  G+ L++  A+ K
Sbjct: 19  FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEAK 78

Query: 403 EVRR 406
           +  R
Sbjct: 79  KSHR 82

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 16/101 (15%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           ++ K ID       F +LFS YG +    +  D   G+ +GF ++ F++   A  A  EL
Sbjct: 8   IHCKGID-------FXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIEL 60

Query: 282 NDTDFNGQKLYVGRAQ-KKYERLQE-------LKKQYESSR 314
           +   F G+ L++  A+ KK  RL E       LKKQ E  R
Sbjct: 61  DKQIFQGRLLHILPAEAKKSHRLDEFDLKNLPLKKQRELKR 101

 Score = 35.4 bits (80), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 59  LFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118
           LFSP G +  + V  D  T  S G+AY+ F +      A  +L+    +GR   I+ ++ 
Sbjct: 18  LFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEA 77

Query: 119 DPSLR 123
             S R
Sbjct: 78  KKSHR 82

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 55/300 (18%), Positives = 120/300 (40%), Gaps = 34/300 (11%)

Query: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXX 182
           R +    V +KNL  + +   ++  F   G I+   +A D   K+ +F  + F       
Sbjct: 36  RNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVA-DSLKKNFRFARIEFARYDGAL 94

Query: 183 XXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFS 242
             I   + ++  G    +  H+++                +++ N  P   Q     L  
Sbjct: 95  AAITKTHKVV--GQNEIIVSHLTE--------------CTLWMTNFPPSYTQRNIRDLLQ 138

Query: 243 QYGAITSAV-LETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYE 301
               +  ++ L +      R F +++      A   VE+LN     G           Y 
Sbjct: 139 DINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEG-----------YT 187

Query: 302 RLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEK-LQEEFAPFGTITSVKV--MRD 358
            + ++    E S+    A  +G  + ++NL   + DE  L+E F  FG+I  + +   + 
Sbjct: 188 LVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQK 247

Query: 359 DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKE-VRRSQLAQQIQARN 417
           +   +    F+ F   + A +A+ + N+ ++  + + V++A +K  + R+++ + + +RN
Sbjct: 248 EHSFNNCCAFMVFENKDSAERAL-QMNRSLLGNREISVSLADKKPFLERNEVKRLLASRN 306

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 70/169 (41%), Gaps = 19/169 (11%)

Query: 3   DVTDKTAEQLEQLRIQDEQPTGPTSTDSESTK---------GEASSASLYVGELDPSVTE 53
           DV D   +     RI+  +  G  +  +++ K            +  +L++    PS T+
Sbjct: 71  DVADSLKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYTQ 130

Query: 54  ALLYDLFSPIGSVS-SIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCR 112
             + DL   I  V+ SIR+       TS  +AY++          +EKLN   I+G    
Sbjct: 131 RNIRDLLQDINVVALSIRLPSLRFN-TSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLV 189

Query: 113 ------IMWSQRDPSLRKKGSGNVFIKNLHP-AIDNKALHDTFSVFGNI 154
                 +  S+R  S   +G   + I+NL    +D   L ++F  FG+I
Sbjct: 190 TKVSNPLEKSKRTDSATLEGR-EIMIRNLSTELLDENLLRESFEGFGSI 237

>Scas_701.3
          Length = 321

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 5/111 (4%)

Query: 6   DKTAEQLEQLRIQ--DEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPI 63
           DK  E++E+ RI   +E        +  + K      ++++G L    TE  L  LF   
Sbjct: 70  DKQFEEVEKERISKMNESIRNWDPHNDPNIKDTDPYRTIFIGRLPYDTTELELQKLFVKF 129

Query: 64  GSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNY---TPIKGRPC 111
           G +  IR+ RD +T  S GYA++ F D  +   A +++       IKGR C
Sbjct: 130 GEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEIGVHRGIDIKGRTC 180

 Score = 35.4 bits (80), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITE 383
           +F+  L     + +LQ+ F  FG I  ++++RD     SKG+ F+ F  P  +  A  E
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A +++G L+  +TE  L  +FS  G    + + RD  T  S G+A++ + D  +   A++
Sbjct: 34  AYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVD 93

Query: 100 KLNYTPIKGRPCRI 113
            LN   + GR  ++
Sbjct: 94  NLNGITVAGRQIKV 107

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEG-KLRGFGFVNFEDHNAAAKAVEEL 281
           +++  ++ +  + +   +FSQYG     +L  D E  + +GF F+ +ED  +   AV+ L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 282 NDTDFNGQKLYV 293
           N     G+++ V
Sbjct: 96  NGITVAGRQIKV 107

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEK 384
           +F+  L+  + +  L   F+ +G    V ++RD +   SKGF F+ +        A+   
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 385 NQQIVAGKPLYV 396
           N   VAG+ + V
Sbjct: 96  NGITVAGRQIKV 107

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXX 183
           K    +FI  L+  +    L   FS +G  +   +  D ET +S+ F F+ +        
Sbjct: 31  KDQAYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTIL 90

Query: 184 XIDAINGMLLNGLEVYV 200
            +D +NG+ + G ++ V
Sbjct: 91  AVDNLNGITVAGRQIKV 107

>Kwal_47.18572
          Length = 363

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           LFV+     + D +L E F PFG +  VK++        GF FV F   + A +AI E N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKIL-------NGFAFVEFEEADSAARAIEEVN 136

Query: 386 QQIVAGKPLYVAIAQ 400
            +  A +PL V  ++
Sbjct: 137 GKTFANQPLEVVYSK 151

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 53/112 (47%), Gaps = 13/112 (11%)

Query: 35  GEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAG 94
           GE S+  L+V      V ++ L ++F P G +  +++          G+A+V F + ++ 
Sbjct: 77  GELSTTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKILN--------GFAFVEFEEADSA 128

Query: 95  TTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHD 146
             AIE++N      +P  +++S+  P   +     + ++NL   +  + L D
Sbjct: 129 ARAIEEVNGKTFANQPLEVVYSKVQPPRYR-----MILRNLPDGVAWQELKD 175

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T ++V+    + +  E  ++F  +G +    +       L GF FV FE+ ++AA+A+EE
Sbjct: 82  TRLFVRPFPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEFEEADSAARAIEE 134

Query: 281 LNDTDFNGQKLYV 293
           +N   F  Q L V
Sbjct: 135 VNGKTFANQPLEV 147

>Kwal_26.7179
          Length = 456

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI-- 98
           S++VG LD   TE  L+  F   G +  +R+ RD+ T    G+AYV F D      A+  
Sbjct: 294 SVFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLL 353

Query: 99  --EKLNYTPIKGRPCRI 113
             +KLN T   GR  R+
Sbjct: 354 DGQKLNGT---GRKLRV 367

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 57/134 (42%), Gaps = 20/134 (14%)

Query: 171 GFVHFXXXXXXXXXIDAINGMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNI 228
            +V +          + +NG L     L V    H ++ D          N  +V+V N+
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVDSVTHPTQHD----------NKRSVFVGNL 300

Query: 229 DPETKQDEFEKLFSQYGAITSAVLETDNEGKL-RGFGFVNFEDHNAAAKAV----EELND 283
           D E  ++   K F + G I    L  D++  + +GF +V F D     KA+    ++LN 
Sbjct: 301 DFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALLLDGQKLNG 360

Query: 284 TDFNGQKLYVGRAQ 297
           T   G+KL V R +
Sbjct: 361 T---GRKLRVTRCK 371

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 20/135 (14%)

Query: 264 GFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQG 323
            +V + D  A   A E+LN T F    L V               Q+++ R         
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVDSVTHPT--------QHDNKR--------- 293

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEATKAIT 382
            ++FV NLD    +E L + F   G I  V+++RD   +  KGF +V F   +   KA+ 
Sbjct: 294 -SVFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALL 352

Query: 383 EKNQQIV-AGKPLYV 396
              Q++   G+ L V
Sbjct: 353 LDGQKLNGTGRKLRV 367

>Scas_717.41
          Length = 379

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITE 383
             LFV+     + + +L E F PFG +  VK++        GF FV F   + A KAI E
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL-------NGFAFVEFEEADSAAKAIEE 135

Query: 384 KNQQIVAGKPLYVAIAQRKEVRRSQL 409
            N +  A +PL V +  +  V+R +L
Sbjct: 136 VNGKTFANQPLEV-VYSKLPVKRYRL 160

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T ++V+    + ++ E  ++F+ +G +    +       L GF FV FE+ ++AAKA+EE
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADSAAKAIEE 135

Query: 281 LNDTDFNGQKLYV 293
           +N   F  Q L V
Sbjct: 136 VNGKTFANQPLEV 148

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 8/84 (9%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           +GE S+  L+V      V EA L ++F+P G +  +++          G+A+V F + ++
Sbjct: 77  EGELSTTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKILN--------GFAFVEFEEADS 128

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQ 117
              AIE++N      +P  +++S+
Sbjct: 129 AAKAIEEVNGKTFANQPLEVVYSK 152

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 62/166 (37%), Gaps = 20/166 (12%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +F++     +    L++ F+ FG +   KI          F FV F         I+ +N
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEEVN 137

Query: 190 GMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS 249
           G       + V          SKL   +   T   ++N+       E + L  ++   T+
Sbjct: 138 GKTFANQPLEVV--------YSKLPVKRYRLT---LRNLPEGCSWQELKDLAREHSLETT 186

Query: 250 AVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
               + N     G G + F +      A+E+LN+ +F G  + V R
Sbjct: 187 --FSSVNTRDFDGTGALEFANEETLDTALEKLNNIEFRGSVITVER 230

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 41  SLYVGELDPSVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           SL+VG+L P+ TEA L  LF +   SV ++RV  D +T +S  + +V F D +    A+ 
Sbjct: 193 SLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALI 252

Query: 100 KLNYTPIKGRPCRIMWS 116
           +++    +GR  R+ ++
Sbjct: 253 EMSGKWFQGRALRVAYA 269

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 5/142 (3%)

Query: 262 GFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK--YERLQELKKQYESSRMEKLA 319
           G+ FV FE    A  A+  LN T           +Q    ++R   L     ++    + 
Sbjct: 129 GYCFVEFETQKDAKFALS-LNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIP 187

Query: 320 KYQGVNLFVKNLDDSIDDEKLQEEF-APFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEA 377
                +LFV +L  +  +  L   F   F ++ +V+VM D   GSS+ FGFV F   +E 
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 378 TKAITEKNQQIVAGKPLYVAIA 399
            +A+ E + +   G+ L VA A
Sbjct: 248 RRALIEMSGKWFQGRALRVAYA 269

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 48/116 (41%), Gaps = 13/116 (11%)

Query: 12  LEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRV 71
           +  +R+ D  P+   +TD  +T       +++VG L P  TE  L  LF P G + ++R+
Sbjct: 339 ISNMRVNDSLPSNTYNTDPTNT-------TVFVGGLVPKTTEFQLRSLFKPFGPILNVRI 391

Query: 72  CRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGS 127
                        +V F        +I+ L    + G P R+ W +   S  K  S
Sbjct: 392 PNGK------NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPSSSNAKTNS 441

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 223 VYVKNIDPETKQDEFEKLF-SQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEE 280
           ++V ++ P   + +   LF +++ ++ +  + TD   G  R FGFV F D +   +A+ E
Sbjct: 194 LFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIE 253

Query: 281 LNDTDFNGQKLYVGRAQKK 299
           ++   F G+ L V  A  +
Sbjct: 254 MSGKWFQGRALRVAYATPR 272

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 55/140 (39%), Gaps = 21/140 (15%)

Query: 82  GYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKK-----GSG-------- 128
           GY +V F        A+  LN TP+         SQ +P+ ++       SG        
Sbjct: 129 GYCFVEFETQKDAKFALS-LNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIP 187

Query: 129 -----NVFIKNLHPAIDNKALHDTFSV-FGNILSCKIATDE-TGKSRKFGFVHFXXXXXX 181
                ++F+ +L P      L   F   F ++ + ++ TD  TG SR FGFV F      
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 182 XXXIDAINGMLLNGLEVYVA 201
              +  ++G    G  + VA
Sbjct: 248 RRALIEMSGKWFQGRALRVA 267

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           +FV  L     + +L+  F PFG I +V++      + K  GFV F    +A  +I    
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPILNVRI-----PNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 386 QQIVAGKPLYVAIAQ 400
             IV G P+ ++  +
Sbjct: 417 GFIVGGSPIRLSWGR 431

>Scas_709.2*
          Length = 171

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           +Y+  +D E  + +   +FSQYG     +L  DN+ G+ +GF F+ +ED  +   A++ L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 282 N 282
           N
Sbjct: 96  N 96

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 7   KTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSV 66
           K+ +Q+ +  +Q    +G  +T+          A +Y+G LD  +TE  +  +FS  G  
Sbjct: 5   KSIQQINERELQ----SGILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVP 60

Query: 67  SSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLN 102
             + +  D  T  S G+A++ + D  +   AI+ LN
Sbjct: 61  VDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLN 96

 Score = 31.6 bits (70), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 59/127 (46%), Gaps = 7/127 (5%)

Query: 113 IMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFG 171
           I+ +++    + K    ++I  L   +    +   FS +G  +   +  D +TG+S+ F 
Sbjct: 19  ILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFA 78

Query: 172 FVHFXXXXXXXXXIDAINGMLL--NGLEV---YVAPHVSKKD-RQSKLDEVKSNFTNVYV 225
           F+ +         ID +NG+ +  N ++V   +  P   + D R++  +E++ +F    +
Sbjct: 79  FLKYEDQRSTVLAIDNLNGVKVGSNTIQVDHTFYEPRDEQWDYRETMKNELEKDFVVRGI 138

Query: 226 KNIDPET 232
            N+  ET
Sbjct: 139 PNLPSET 145

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 12/122 (9%)

Query: 289 QKLYVGRAQKKYERLQELK---KQYES--SRMEKLAKYQGVNLFVKNLDDSIDDEKLQEE 343
           ++ Y    +K YE+  E     + YE+  +R++   +     LFVK     + D +++E 
Sbjct: 12  EETYEKPYEKPYEKPYETAPPPQSYENFNNRVDDDEELSDTRLFVKPFPPDVTDAEMKEI 71

Query: 344 FAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKE 403
           F PFG +  +K++        GF FV F   E A++AI     ++ A  PL V  +++ +
Sbjct: 72  FEPFGALKEIKIL-------NGFAFVEFEEAESASQAIQNVAGKMFADYPLEVVFSKKLK 124

Query: 404 VR 405
            R
Sbjct: 125 PR 126

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 65/161 (40%), Gaps = 17/161 (10%)

Query: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95
           E S   L+V    P VT+A + ++F P G++  I++          G+A+V F +  + +
Sbjct: 48  ELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKILN--------GFAFVEFEEAESAS 99

Query: 96  TAIEKLNYTPIKGRPCRIMWSQR-DPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNI 154
            AI+ +        P  +++S++  P  R      V I+NL      + L D      N 
Sbjct: 100 QAIQNVAGKMFADYPLEVVFSKKLKPRFR------VIIRNLPEGCAWQELKDL--ARDNQ 151

Query: 155 LSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG 195
           L    ++  T      G + F         I+ +N +   G
Sbjct: 152 LETTFSSVNTRDFDGTGALEFPTEEILQEAIEKLNNIEFRG 192

 Score = 35.8 bits (81), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T ++VK   P+    E +++F  +GA+    +       L GF FV FE+  +A++A++ 
Sbjct: 52  TRLFVKPFPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAFVEFEEAESASQAIQN 104

Query: 281 LNDTDFNGQKLYVGRAQKKYERLQ 304
           +    F    L V  ++K   R +
Sbjct: 105 VAGKMFADYPLEVVFSKKLKPRFR 128

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 63/168 (37%), Gaps = 24/168 (14%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +F+K   P + +  + + F  FG +   KI          F FV F         I  + 
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKILN-------GFAFVEFEEAESASQAIQNVA 106

Query: 190 GMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLF--SQYGAI 247
           G +     + V    SKK        +K  F  V ++N+       E + L   +Q    
Sbjct: 107 GKMFADYPLEVV--FSKK--------LKPRF-RVIIRNLPEGCAWQELKDLARDNQLETT 155

Query: 248 TSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
            S+V    N     G G + F       +A+E+LN+ +F G  L V +
Sbjct: 156 FSSV----NTRDFDGTGALEFPTEEILQEAIEKLNNIEFRGSVLAVEK 199

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           ++   ++ E  + +   +FSQ+G  T   L  D E G+ RGFGF+ +ED  +   AV+ L
Sbjct: 36  IHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNL 95

Query: 282 NDTDFNGQKLYV 293
           N  +  G+ L V
Sbjct: 96  NGVNLCGRVLKV 107

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A ++   L+  +TE  +  +FS  G  + +++ RD  T  S G+ ++ + D  +   A++
Sbjct: 34  AYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVD 93

Query: 100 KLNYTPIKGRPCRI 113
            LN   + GR  ++
Sbjct: 94  NLNGVNLCGRVLKV 107

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 344 FAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           F+ FG  T +K++RD + G S+GFGF+ +        A+   N   + G+ L V
Sbjct: 54  FSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKV 107

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 4/100 (4%)

Query: 97  AIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILS 156
           +I+KL+ T ++     I+  +     + K    +    L+  +    +   FS FG    
Sbjct: 6   SIQKLSETELEHG---ILSEEASWHYQYKDQAYIHFSGLNVELTEGDILTVFSQFGVPTD 62

Query: 157 CKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG 195
            K+  D ETG+SR FGF+ +         +D +NG+ L G
Sbjct: 63  LKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCG 102

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 94/212 (44%), Gaps = 25/212 (11%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVS-SIRVCRDAIT----------KTSLGYAYVNFHD 90
           LY+G+LDP+  +  +  +++ +G  + ++R+  +             K + GY +V+F  
Sbjct: 56  LYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPS 115

Query: 91  HNAGTTAIEKLNYTPIKGRP---CRIMWS--------QRDPSLRKKGSGNVFIKNLHPAI 139
                 A+ K N   I   P    ++ W+            +++   + ++F+ +L P +
Sbjct: 116 STHAANALLK-NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNV 174

Query: 140 DNKALHDTF-SVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLE 197
               L + F + + +    KI  D+ TG S+ +GFV F         +  + G+ LNG  
Sbjct: 175 TESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRA 234

Query: 198 VYVAPHVSKKDRQSKLDEVKSNFTNVYVKNID 229
           + V P   ++   S  ++   + +++  +N+D
Sbjct: 235 IKVGPTSGQQQHVSGNNDYNRSSSSLNNENVD 266

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 82/191 (42%), Gaps = 24/191 (12%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVL----ETDNEGKL--------RGFGFVNFED 270
           +Y+ ++DP   ++   ++++  G     V      T N G          +G+ FV+F  
Sbjct: 56  LYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPS 115

Query: 271 HNAAAKAVEE--LNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFV 328
              AA A+ +  +   +F  +KL +  A   Y          +S            ++FV
Sbjct: 116 STHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGN--------NCSIFV 167

Query: 329 KNLDDSIDDEKLQEEFAP-FGTITSVKVMRDDA-GSSKGFGFVCFSTPEEATKAITEKNQ 386
            +L  ++ + +L E F   + + +  K++ D   G SKG+GFV F+  +E   A++E   
Sbjct: 168 GDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQG 227

Query: 387 QIVAGKPLYVA 397
             + G+ + V 
Sbjct: 228 VFLNGRAIKVG 238

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 96/253 (37%), Gaps = 61/253 (24%)

Query: 216 VKS-NFTNVYVKNIDPETKQDE-FEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHN 272
           VKS N  +++V ++ P   + + FE   ++Y + + A +  D   G  +G+GFV F + +
Sbjct: 157 VKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSD 216

Query: 273 AAAKAVEELNDTDFNGQKLYVG---------RAQKKYERLQE------------------ 305
               A+ E+     NG+ + VG              Y R                     
Sbjct: 217 EQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSF 276

Query: 306 ---------LKKQYESSRMEKLAKYQGVN---------LFVKNLDDSIDDEKLQEEFAPF 347
                     K+ + S  +  + +   +N         +F+  L   + +++L+  F PF
Sbjct: 277 LSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPF 336

Query: 348 GTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLY---VAIAQRKEV 404
           GTI  VK+        K  GFV +     A  AI       + G P+    V ++  +  
Sbjct: 337 GTIVYVKI-----PVGKCCGFVQYVDRLSAEAAIAG-----MQGFPIANSRVRLSWGRSA 386

Query: 405 RRSQLAQQIQARN 417
           +++ L QQ    N
Sbjct: 387 KQTALLQQAMLSN 399

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 79/173 (45%), Gaps = 12/173 (6%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVS-SIRVCRDAITKTS-----LGYAYVNFHDHN 92
           S  LY+G+L+P  TE  +  ++S +G  +  +++ + +    S      GY +V F +  
Sbjct: 55  STQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQM 114

Query: 93  AGTTAIEK--LNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTF-S 149
           A + A+ K  L          ++ W+    +   + +  +F+ +L P +    L + F S
Sbjct: 115 AASNALMKSGLRVPMDSNYALKLNWASFATAPGSEFT--LFVGDLAPNVTEAQLFELFIS 172

Query: 150 VFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVA 201
            + + L+ KI  D+ TG S+ +GFV F         +  + G  LNG  + V 
Sbjct: 173 RYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVG 225

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 37  ASSASLYVGELDPSVTEALLYDLF-SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95
            S  +L+VG+L P+VTEA L++LF S   S  + ++  D  T  S GY +V F +     
Sbjct: 147 GSEFTLFVGDLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQ 206

Query: 96  TAIEKLNYTPIKGRPCRI 113
            A+ ++  T + GR  R+
Sbjct: 207 RALVEMQGTFLNGRAIRV 224

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 90/194 (46%), Gaps = 25/194 (12%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGA--ITSAVLETDNEGKLR-----GFGFVNFEDH 271
           N T +Y+ +++P+  +++ + ++S  G   +   ++++ N  K       G+ FV F + 
Sbjct: 54  NSTQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQ 113

Query: 272 NAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNL 331
            AA+ A+ +      +G ++         +    LK  + S      +++    LFV +L
Sbjct: 114 MAASNALMK------SGLRV-------PMDSNYALKLNWASFATAPGSEF---TLFVGDL 157

Query: 332 DDSIDDEKLQEEF-APFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEKNQQIV 389
             ++ + +L E F + + +  + K++ D   G SKG+GFV F    E  +A+ E     +
Sbjct: 158 APNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFL 217

Query: 390 AGKPLYVAIAQRKE 403
            G+ + V    + +
Sbjct: 218 NGRAIRVGTTSKNK 231

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 79/184 (42%), Gaps = 15/184 (8%)

Query: 125 KGSGNVFIKNLHPAIDNKALHDTFSVFG--NILSCKIATDETGKSRK-----FGFVHFXX 177
           + S  +++ +L+P      +   +S+ G  N+    I +    KS       + FV F  
Sbjct: 53  QNSTQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPN 112

Query: 178 XXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPE-TKQDE 236
                  + A N ++ +GL V +  + + K   +       +   ++V ++ P  T+   
Sbjct: 113 Q------MAASNALMKSGLRVPMDSNYALKLNWASFATAPGSEFTLFVGDLAPNVTEAQL 166

Query: 237 FEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
           FE   S+Y +  +A +  D   G  +G+GFV F +     +A+ E+  T  NG+ + VG 
Sbjct: 167 FELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGT 226

Query: 296 AQKK 299
             K 
Sbjct: 227 TSKN 230

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 13/96 (13%)

Query: 20  EQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKT 79
           +QP+    TD  +T       ++++G L   +TE  L   F P G +  +++        
Sbjct: 303 QQPSLSQFTDPNNT-------TVFIGGLSTLITEDELRSYFQPFGQIVYVKI------PV 349

Query: 80  SLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMW 115
             G  +V + D  +  TAI K+   PI     R+ W
Sbjct: 350 GKGCGFVQYVDRISAETAISKMQGFPIGNSRIRLSW 385

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITE 383
           +F+  L   I +++L+  F PFG I  VK+        KG GFV +     A  AI++
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKI-----PVGKGCGFVQYVDRISAETAISK 370

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 71/167 (42%), Gaps = 15/167 (8%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           +GE S+  L+V      V E+ L ++FSP G +  +++          G+A+V F +  +
Sbjct: 69  EGELSTTRLFVRPFPFDVQESELNEIFSPFGPMKEVKILN--------GFAFVEFEESES 120

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGN 153
              AI+++N      +P  +++S+  P   +     + ++NL   +  + L D      N
Sbjct: 121 AAKAIDEVNGKTFANQPLEVVYSKLPPQRFR-----MILRNLPEGVAWQELKDL--AREN 173

Query: 154 ILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
            L    ++  T +    G + F         ++ +N +   G  + V
Sbjct: 174 NLETTFSSVNTREFDGTGALEFPTEEILEEALEKLNNIEFRGAVISV 220

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 7/73 (9%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T ++V+    + ++ E  ++FS +G +    +       L GF FV FE+  +AAKA++E
Sbjct: 75  TRLFVRPFPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDE 127

Query: 281 LNDTDFNGQKLYV 293
           +N   F  Q L V
Sbjct: 128 VNGKTFANQPLEV 140

>Kwal_27.10364
          Length = 443

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 97/215 (45%), Gaps = 28/215 (13%)

Query: 217 KSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAV----LETDNEGKLRGFGFVNFEDHN 272
           +S  + ++V N  P   + E +KLFSQ+G    ++    L  D+    R F +V+     
Sbjct: 113 QSQNSTLWVTNYPPLFGELELQKLFSQFGGTVLSIRFPSLRYDSH---RRFAYVDMASSE 169

Query: 273 AAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLD 332
            A   V+ L+    +  +L +     K     + +K+ +S  +E+        +++KNLD
Sbjct: 170 EAKLIVDRLHGFVVDNHELII-----KLSNPLKAEKRTDSDVLERR------QVYLKNLD 218

Query: 333 D-SIDDEKLQEEFAPFGTITSVKVMRDD----AGSSK----GFGFVCFSTPEEATKAITE 383
              + +E + + F+ +G I  + +   +    +G+ K    GFGFV FS    A  ++  
Sbjct: 219 YFRVSEEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSLQL 278

Query: 384 KNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQ 418
              ++  G+ + V +A RK     Q  +++  R +
Sbjct: 279 DGSEL-EGRKISVTLADRKAYIERQAVKRLLHRKR 312

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           LFV+     + + +L E F PFG +  VK++        GF FV F   E A KAI E +
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKIL-------NGFAFVEFEEAESAAKAIEEVH 179

Query: 386 QQIVAGKPLYVAIAQ 400
            +  A +PL V  ++
Sbjct: 180 GKSFANQPLEVVYSK 194

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T ++V+    + ++ E  ++F  +G +    +       L GF FV FE+  +AAKA+EE
Sbjct: 125 TRLFVRPFPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEFEEAESAAKAIEE 177

Query: 281 LNDTDFNGQKLYV 293
           ++   F  Q L V
Sbjct: 178 VHGKSFANQPLEV 190

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 70/167 (41%), Gaps = 15/167 (8%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           +GE S+  L+V      V E+ L ++F P G +  +++          G+A+V F +  +
Sbjct: 119 EGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAES 170

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGN 153
              AIE+++      +P  +++S+  P+ R +    + +KNL      + L D      N
Sbjct: 171 AAKAIEEVHGKSFANQPLEVVYSKL-PAKRYR----ITMKNLPEGCSWQDLKDL--AREN 223

Query: 154 ILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
            L    ++  T      G + F         ++ +N +   G  + V
Sbjct: 224 SLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITV 270

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 61/168 (36%), Gaps = 24/168 (14%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAIN 189
           +F++     +    L++ F  FG +   KI          F FV F         I+ ++
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 190 GMLL--NGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAI 247
           G       LEV  +   +K+ R             + +KN+       + + L  +    
Sbjct: 180 GKSFANQPLEVVYSKLPAKRYR-------------ITMKNLPEGCSWQDLKDLARENSLE 226

Query: 248 TSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
           T+    + N     G G + F       +A+E LN+ +F G  + V R
Sbjct: 227 TT--FSSVNTRDFDGTGALEFPSEEILVEALERLNNIEFRGSVITVER 272

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S  +Y+G +    TE  + DL S +G V S+++  D+ T  S GYA+V + D  +  +A+
Sbjct: 15  SRVVYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAV 74

Query: 99  EKLNYTPIKGRPCRIMWSQRDPSLRKKGSGN 129
             LN   +  R  +  +S  +  +  +G GN
Sbjct: 75  RNLNGYQLGSRLLKCGYS-SNSDITDQGVGN 104

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           VY+ +I  +  +++   L S  G + S  +  D++ GK +G+ FV ++D  ++A AV  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 282 NDTDFNGQKLYVG 294
           N      + L  G
Sbjct: 78  NGYQLGSRLLKCG 90

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%)

Query: 31  ESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           E  +   +SA++YVG L    +E  LY+LFS  GS+  I +  D    T  G+ ++ +  
Sbjct: 37  EELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQT 96

Query: 91  HNAGTTAIEKLNYTPIKGRPCRI 113
                 A++ L+ T +  R   I
Sbjct: 97  PQEALAALKYLSKTKLDDREITI 119

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 67/129 (51%), Gaps = 17/129 (13%)

Query: 203 HVSKKDRQS--KLDEVKSNFTN--VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-E 257
           ++ +K R++   L+E++ + T+  +YV N+   T +++  +LFS+ G+I   ++  D  +
Sbjct: 24  YLKRKARKTPGGLEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFK 83

Query: 258 GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV------------GRAQKKYERLQE 305
               GF F+ ++    A  A++ L+ T  + +++ +            GR +   +   E
Sbjct: 84  FTPCGFCFIIYQTPQEALAALKYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGGQVSDE 143

Query: 306 LKKQYESSR 314
           L+ ++++SR
Sbjct: 144 LRFEFDASR 152

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 12/88 (13%)

Query: 295 RAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVK 354
           +A+K    L+EL+K   S+            ++V NL     +E+L E F+  G+I  + 
Sbjct: 28  KARKTPGGLEELRKSMTSA-----------TIYVGNLSFYTSEEQLYELFSKCGSIEKII 76

Query: 355 VMRDDAG-SSKGFGFVCFSTPEEATKAI 381
           +  D    +  GF F+ + TP+EA  A+
Sbjct: 77  MGLDRFKFTPCGFCFIIYQTPQEALAAL 104

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           L+VG L    TE LL   F   G +  IR+     T    G+A+++F D    T A++  
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 102 NYTPIKGRPCRIMWSQ 117
           +   I  RP R+ + +
Sbjct: 289 SCRKIASRPIRMEYGE 304

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 80/168 (47%), Gaps = 10/168 (5%)

Query: 252 LETDNEGKLR--GFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQ 309
           L  ++  KLR  GF +++F+      +AV  L+++  NG+ L +  A   YE   +    
Sbjct: 160 LTKNDNKKLRNKGFAYIDFKTEKQM-EAVVGLSESALNGRNLLIKNAGS-YEGRPDKNDL 217

Query: 310 YESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMR-DDAGSSKGFGF 368
             +S+           LFV NL     ++ L++ F   G I  +++   +D G  KGF F
Sbjct: 218 VAASK-----NPPSRILFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAF 272

Query: 369 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQAR 416
           + F     AT A+ +K+ + +A +P+ +   + +  R+ +   ++ AR
Sbjct: 273 IDFKDETGATNALKDKSCRKIASRPIRMEYGEDRSKRQVRRRPELDAR 320

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 13/113 (11%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           +GE S+  L+V      V E+ L ++F P G++  +++          G+A+V F +  +
Sbjct: 99  EGELSNTRLFVRPFPLDVQESELNEIFGPFGAMKEVKILN--------GFAFVEFEEAES 150

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHD 146
            + AIE++N      +P  +M+S+  P  R +    + +KNL      + L D
Sbjct: 151 ASKAIEEVNGKTFANQPLEVMFSKM-PVKRFR----ITLKNLPEGCSWQELKD 198

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T ++V+    + ++ E  ++F  +GA+    +       L GF FV FE+  +A+KA+EE
Sbjct: 105 TRLFVRPFPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEFEEAESASKAIEE 157

Query: 281 LNDTDFNGQKLYVGRAQKKYERLQ-ELKKQYESSRMEKL 318
           +N   F  Q L V  ++   +R +  LK   E    ++L
Sbjct: 158 VNGKTFANQPLEVMFSKMPVKRFRITLKNLPEGCSWQEL 196

>Kwal_23.5864
          Length = 278

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFST---PEEATKA 380
            +FV  L  ++ + +LQ+EF  FG I  V+V+RD  +  S+G+GF+ F        A + 
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 381 ITEKNQQIVAGKPLYVAIAQRKEVR 405
           I       + G+P+ V I + + V+
Sbjct: 162 IGVHRGVEIGGRPVIVDIERGRTVK 186

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +++VG L  +VTE  L   F   G +  +RV RD  +  S GY ++ F +     TA  +
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 101 LNY---TPIKGRPC 111
           +       I GRP 
Sbjct: 162 IGVHRGVEIGGRPV 175

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 220 FTNVYVKNIDPETKQDEFEKLFSQYGAITSA-VLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +  V+V  +     + E +K F ++G I    V+      K RG+GF+ F++   A  A 
Sbjct: 100 YRTVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTAC 159

Query: 279 EEL 281
            E+
Sbjct: 160 REI 162

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 90  DHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFS 149
           D  +GT  I++LN  P K    +     +D    ++ SG +++  L      K L   F+
Sbjct: 58  DEQSGTHKIKRLN--PKKQANEK---KSKDKKTLEEYSGIIYVSRLPHGFHEKELSKYFA 112

Query: 150 VFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXIDAINGMLLNG--LEVYVAP 202
            FG++   ++A ++ TG SR +GF+ F          +++N  LL G  L+V V P
Sbjct: 113 QFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQVRVLP 168

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 318 LAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEE 376
           L +Y G+ ++V  L     +++L + FA FG +  V++ R+   G+S+ +GF+ F   E+
Sbjct: 86  LEEYSGI-IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKED 144

Query: 377 ATKAITEKNQQIVAGKPLYVAI 398
           A  A    N  ++ G  L V +
Sbjct: 145 AMIAQESMNNYLLMGHLLQVRV 166

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEA 377
            +FV  L    D+ +LQ+ FA +G I  V+V+RD    S+G+ FV F   + A
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 220 FTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
           +  V+V  +  +T + + +K+F++YG I    +  D + K RG+ FV F++ ++A     
Sbjct: 114 YKTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTR 173

Query: 280 EL---NDTDFNGQKLYV 293
           ++        NG++  V
Sbjct: 174 DIGVHRGIQINGRRCIV 190

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           +++VG L     E  L  +F+  G +  +RV RD   K S GYA+V F + ++       
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNK-SRGYAFVLFKETDSARVCTRD 174

Query: 101 LNY---TPIKGRPC 111
           +       I GR C
Sbjct: 175 IGVHRGIQINGRRC 188

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 30/75 (40%), Gaps = 3/75 (4%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDAI 188
            VF+  L    D   L   F+ +G I+  ++  D+  KSR + FV F            I
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRDI 175

Query: 189 ---NGMLLNGLEVYV 200
               G+ +NG    V
Sbjct: 176 GVHRGIQINGRRCIV 190

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEK 384
           LFV  L+       L   FA FG + SV+++RD D+G S G+GFV F+T      A T+ 
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 385 NQQIVAGKPLYVAIAQ 400
           +  ++  + ++V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           L+V +L+P    A L  +F+  G V+S+ + RD  +  SLGY +V F    A   A  K+
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 102 NYTPIKGRPCRIMWSQ 117
           +   I  R   + +SQ
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAI 188
           +F+  L+P      L   F+ FG++ S +I  D ++G+S  +GFV F            +
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 189 NGMLLNGLEVYV 200
           +G L++   V+V
Sbjct: 292 DGALIDDRRVHV 303

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%)

Query: 31  ESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           E  +   SSA++YVG L    +E  +Y+LFS  G++  I +  D    T  G+ +V ++ 
Sbjct: 37  EDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNT 96

Query: 91  HNAGTTAIEKLNYTPIKGRPCRI 113
                +A++ L+ T +  R   I
Sbjct: 97  PKEALSAVKYLSDTKLDDRHISI 119

 Score = 35.8 bits (81), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 13/105 (12%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEEL 281
           +YV N+   T +++  +LFS+ G I   ++  D  +    GF FV +     A  AV+ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSAVKYL 107

Query: 282 NDTDFNGQKLYV------------GRAQKKYERLQELKKQYESSR 314
           +DT  + + + +            GR +   +   EL+ ++++SR
Sbjct: 108 SDTKLDDRHISIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%)

Query: 40  ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           A +  G +   +TEA +  +FS  G    I++ RD  T  S G+ ++ + D  +   A++
Sbjct: 34  AYINFGGMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVD 93

Query: 100 KLNYTPIKGRPCRI 113
            LN   + GR  R+
Sbjct: 94  NLNGAKVCGRLIRV 107

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 214 DEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHN 272
           D+   NF  +++     E  + +   +FSQYG      L  D   GK +GFGF+ +ED  
Sbjct: 32  DQAYINFGGMHL-----ELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQR 86

Query: 273 AAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAK 320
           +   AV+ LN     G+ + V  A   + R +  + +YE +  ++L K
Sbjct: 87  STILAVDNLNGAKVCGRLIRVDHA---FYRPRSDEAEYEEAVRQELEK 131

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 4/105 (3%)

Query: 97  AIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILS 156
           +I+KL+   ++   C I+  +       K    +    +H  +    +   FS +G  + 
Sbjct: 6   SIQKLSERELE---CGILKPESSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPVD 62

Query: 157 CKIATDET-GKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYV 200
            K+  D+T GKS+ FGF+ +         +D +NG  + G  + V
Sbjct: 63  IKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 344 FAPFGTITSVKVMRDDA-GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           F+ +G    +K++RD   G SKGFGF+ +        A+   N   V G+ + V
Sbjct: 54  FSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXI 185
           SG +++  L      + L   FS FG++   ++A ++ TG SR +GFV F          
Sbjct: 124 SGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAY 183

Query: 186 DAINGMLLNG--LEVYVAPHVSK 206
           D +N  LL G  L+V + P  SK
Sbjct: 184 DTMNNYLLMGHLLQVRLLPKGSK 206

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD- 359
           ++L   KKQ  + + +K +   G+ ++V  L     + +L + F+ FG +  V++ R+  
Sbjct: 103 KKLDTSKKQKATKKDDKDSDISGI-IYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKK 161

Query: 360 AGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 398
            G+S+ +GFV F   +++  A    N  ++ G  L V +
Sbjct: 162 TGNSRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRL 200

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           S++VG LD    E  L+  F   GS+  +R+ RD  T    G+AYV F++  + + A+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKALL- 287

Query: 101 LNYTPI 106
           LN  P+
Sbjct: 288 LNEKPM 293

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 10/86 (11%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITE 383
           ++FV NLD   D+E L + F   G+I  V+++RD      KGF +V F+  +  +KA+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-- 286

Query: 384 KNQQIVAGKPLYVAIAQRKEVRRSQL 409
               ++  KP+   I+Q + +++ +L
Sbjct: 287 ----LLNEKPM---ISQNEHLKKRKL 305

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 89/198 (44%), Gaps = 24/198 (12%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAV-LETDNEGKLRGFGFVNFEDHNAAAKAVE 279
           + V++ N  P  +Q +   +F  +  +   V L +      R F +V+  +  +  KA++
Sbjct: 100 STVWMTNYPPTFQQRDIRNIFKDHKIVALNVRLPSLRFNSNRRFAYVDLPNMESLDKAIQ 159

Query: 280 ELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDS-IDDE 338
            LN  D NG KL V ++       +   K+ ++  +E+        + ++NL  + +  +
Sbjct: 160 LLNGKDINGYKLVVKKSNP-----ENRDKRSDAPVLERRE------IIIRNLPKTMLVKD 208

Query: 339 KLQEEFAPFGTITSVKVMRDD----AGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394
            L + F  +G I  +++ +      +  + G  FV ++ PE+A  A+ E N  ++    +
Sbjct: 209 TLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPEDAKSAL-EMNNHVIDDIKI 267

Query: 395 YV------AIAQRKEVRR 406
            V      A  +RKEV R
Sbjct: 268 SVNLSDSHAYLERKEVNR 285

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S ++Y+G +    TE  + DL S +G V+ +++  D  T  S GYA++ F D    ++A+
Sbjct: 10  SRTVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAV 69

Query: 99  EKLNYTPIKGRPCRIMWS 116
             LN   +  R  +  ++
Sbjct: 70  RNLNGYALGNRTLKCGYT 87

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           VY+ +I  +  + +   L S  G +T   +  D + GK +G+ F+ F+D   ++ AV  L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 282 NDTDFNGQKLYVG 294
           N      + L  G
Sbjct: 73  NGYALGNRTLKCG 85

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 192 LLNGLEVYVAPHVSKK--DRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS 249
           L+  L +   P VS+K    +    +++++  +++V NI P+   ++ E  F   G I  
Sbjct: 33  LVGKLSIEGTPQVSQKLSKEEKHAHQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKR 92

Query: 250 AVLETD-NEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
             L  D N G  +G+G++ FE      KA+ +LN  +  G+K+ V R
Sbjct: 93  ITLLYDRNTGTPKGYGYIEFESPAYREKAL-QLNGGELKGKKIAVSR 138

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95
           EA S S++VG + P VT   + D F   G +  I +  D  T T  GY Y+ F       
Sbjct: 60  EADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYRE 119

Query: 96  TAIEKLNYTPIKGRPCRI 113
            A++ LN   +KG+   +
Sbjct: 120 KALQ-LNGGELKGKKIAV 136

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
           +FV N+   +  E++++ F   G I  + ++ D + G+ KG+G++ F +P    KA+
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

>Scas_666.11
          Length = 224

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 5/127 (3%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXI 185
           S  +++  L      + L   FS FG++   ++A ++ TG SR +GF+ F          
Sbjct: 93  SSILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQ 152

Query: 186 DAINGMLLNG--LEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQ 243
           DA+N  L+ G  L+V + P  +K ++  K    K  FT + +K    E K+    K   +
Sbjct: 153 DAMNNYLVMGHLLQVRLLPKGAKIEKLYKYK--KRAFTQMKIKKTAKELKERAHTKHEER 210

Query: 244 YGAITSA 250
              +T A
Sbjct: 211 MNKLTEA 217

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 311 ESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFV 369
           +S++ + LA+Y  + L+V  L     + +L + F+ FG +  V++ R+   G+S+ +GF+
Sbjct: 82  DSNKKKPLAEYSSI-LYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFI 140

Query: 370 CFSTPEEATKAITEKNQQIVAGKPLYVAI 398
            F+  ++A  A    N  +V G  L V +
Sbjct: 141 EFANKDDANIAQDAMNNYLVMGHLLQVRL 169

>Scas_621.16
          Length = 314

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKL 101
           +Y+G +    TE  + DL + +G V ++++  D  T  S GYA++ F D     +AI  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFG 152
           N   +  R  +  +S  +  +    SGNV   N+   +DN   ++  S  G
Sbjct: 106 NGYQLGSRFLKCGYSSNN-DISASSSGNVHEGNI---LDNDGSYENNSKMG 152

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEEL 281
           VY+ +I  +  +++   L +  G + +  +  D   GK +G+ F+ F+D   +A A+  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 282 N 282
           N
Sbjct: 106 N 106

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S ++Y+G +    TE  + DL   IG V+++++  D  T  S GYA++ F D     +A+
Sbjct: 7   SRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAV 66

Query: 99  EKLNYTPIKGRPCRI 113
             LN   +  R  + 
Sbjct: 67  RNLNGYTLGSRSLKC 81

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-NEGKLRGFGFVNFEDHNAAAKAVEE 280
            VY+ +I  +  + +   L    G +T+  +  D   GK +G+ F+ F+D   +A AV  
Sbjct: 9   TVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRN 68

Query: 281 LNDTDFNGQKLYVG 294
           LN      + L  G
Sbjct: 69  LNGYTLGSRSLKCG 82

>Kwal_26.7522
          Length = 262

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S ++Y+G +    TE  + DL S +G V ++++  D  T  S GYA+V + D  A  +A+
Sbjct: 11  SRTVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAV 70

Query: 99  EKLN 102
             LN
Sbjct: 71  RNLN 74

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%)

Query: 32  STKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDH 91
           S +    S  +Y+G +    TE  + DL S +G V+++++  D  T  S GYA+V + D 
Sbjct: 5   SVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDL 64

Query: 92  NAGTTAIEKLN 102
            A  +A+  LN
Sbjct: 65  EASNSAVRNLN 75

>Sklu_2060.3 YIR009W, Contig c2060 4599-4931
          Length = 110

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 12/99 (12%)

Query: 31  ESTKGEASSA---SLYVGELD----PSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
           ES +G+  ++   +LYV  L+    P+     LY LFS  G V  +     ++T    G 
Sbjct: 16  ESHEGQPETSPKNTLYVNNLNDQIRPNTLRENLYLLFSTYGEVIQV-----SMTSKERGQ 70

Query: 84  AYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSL 122
           A+V     N    A+  L   P  G+P RI +S+ D  L
Sbjct: 71  AFVLLRTMNEANLAMISLQDEPFFGKPLRIRFSRTDSQL 109

 Score = 33.9 bits (76), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 223 VYVKNID----PETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +YV N++    P T ++    LFS YG     V++     K RG  FV     N A  A+
Sbjct: 30  LYVNNLNDQIRPNTLRENLYLLFSTYG----EVIQVSMTSKERGQAFVLLRTMNEANLAM 85

Query: 279 EELNDTDFNGQKLYV 293
             L D  F G+ L +
Sbjct: 86  ISLQDEPFFGKPLRI 100

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           S++VG LD   +E  L+  F   G +  +R+ RD  T    G+AYV F D  +   A+  
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKAL-L 318

Query: 101 LNYTPI---KGRPCRI 113
           LN   +   KGR  R+
Sbjct: 319 LNDKKMAVGKGRKLRV 334

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 1/100 (1%)

Query: 325 NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITE 383
           ++FV NLD    +E L + F   G I  V+++RD      KGF +V F+      KA+  
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLL 319

Query: 384 KNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMRYQQ 423
            ++++  GK   + + + + +++ Q      A  ++  QQ
Sbjct: 320 NDKKMAVGKGRKLRVTRCRNMQKVQRQSNTAALPKLTDQQ 359

>Scas_643.16
          Length = 448

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 13/104 (12%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA--I 98
           S++VG LD    E  L++ F   G +  +R+ RD  T    G+AYV F +  +   A  +
Sbjct: 276 SIFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLL 335

Query: 99  EKLNYTPI--------KGRPCRIMWSQRDPSLRKKGSGNVFIKN 134
            +   T I        KGR  R+    R  ++RK  +    IKN
Sbjct: 336 NEKQMTKIKTDKDNKKKGRKLRVT---RCKNMRKSNNTVSNIKN 376

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEK 384
           +FV NLD   D+E L   F   G I  V+++RD      KGF +V F   E   KA+   
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 385 NQQIV 389
            +Q+ 
Sbjct: 337 EKQMT 341

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S  +Y+G +    TE  + DL S +G V ++++  D  T  S GYA++ F D  +  +A+
Sbjct: 17  SRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAV 76

Query: 99  EKLN 102
             LN
Sbjct: 77  RNLN 80

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           VY+ +I  +  +++   L S  G + +  +  D + G+ +G+ F+ F D  ++A AV  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 282 NDTDFNGQKLYVG 294
           N      + L  G
Sbjct: 80  NGYQLGSRFLKCG 92

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 52/97 (53%), Gaps = 4/97 (4%)

Query: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS-AVLETDNEG 258
           V+  +SK  + +K  E+ S   +V+V +I PE   +  E+ F   G I+   +L     G
Sbjct: 64  VSQPLSKDRKHAKQVELDSR--SVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTG 121

Query: 259 KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
           + +G+ ++ FE  ++  KA+ +L+ + FNG  + V +
Sbjct: 122 EPKGYAYIQFESISSVEKAL-QLDGSSFNGNTISVAK 157

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 25  PTSTDSESTKG-EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGY 83
           P S D +  K  E  S S++V  + P  T  +L + F  +G +S I +  +  T    GY
Sbjct: 67  PLSKDRKHAKQVELDSRSVFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGY 126

Query: 84  AYVNF 88
           AY+ F
Sbjct: 127 AYIQF 131

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
           +FV ++      E L+E F   G I+ + ++ +   G  KG+ ++ F +     KA+
Sbjct: 85  VFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFESISSVEKAL 141

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 10/105 (9%)

Query: 11  QLEQLRIQDEQP-TGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSI 69
           QL   R+Q+  P   P   D++  +      ++++G L   + E  L   F   G +  I
Sbjct: 83  QLLDRRLQNWNPNVDPHIKDTDPYR------TIFIGRLPYDLDEIELQKYFVKFGEIEKI 136

Query: 70  RVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNY---TPIKGRPC 111
           R+ +D IT+ S GYA++ F D  +   A +++       IK R C
Sbjct: 137 RIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRIC 181

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITE 383
           +F+  L   +D+ +LQ+ F  FG I  +++++D     SKG+ F+ F  P  +  A  E
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKE 167

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S ++YVG L    +E  +Y+LFS  G++  I +  D    T  G+ ++ F        +I
Sbjct: 46  SCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSI 105

Query: 99  EKLNYTPIKGR 109
           + L  T +  R
Sbjct: 106 KYLGDTKLDDR 116

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 60/125 (48%), Gaps = 15/125 (12%)

Query: 205 SKKDRQSKLDEVKSNF--TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLR 261
           +++D  S L +++ +     VYV N+   T +++  +LFS+ G I   ++  D  +    
Sbjct: 29  ARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPC 88

Query: 262 GFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV------------GRAQKKYERLQELKKQ 309
           GF F+ F+    A  +++ L DT  + + + +            GR +   +   E++ +
Sbjct: 89  GFCFIIFDKMEDALNSIKYLGDTKLDDRHITIDLDPGFEEGRQFGRGKNGGQVSDEMRFE 148

Query: 310 YESSR 314
           +++SR
Sbjct: 149 FDASR 153

>Scas_316.1
          Length = 483

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 15/159 (9%)

Query: 259 KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK--YERLQELKKQYESSRME 316
           K RGFGFV+F   +   +A+++       G  L V  A+++    +  E  K  + +R +
Sbjct: 3   KFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTD 62

Query: 317 KLAKYQGV------------NLFVKNLDDSIDD-EKLQEEFAPFGTITSVKVMRDDAGSS 363
            +A+ +               L ++N+  S  D  +L++ F+ FGT+    + +   G  
Sbjct: 63  TIARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKL 122

Query: 364 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402
            GF FV        T A+       + G+ + V  A +K
Sbjct: 123 CGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQK 161

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 235 DEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVG 294
           ++ +K+FS++G +  A +    +GKL GF FV  +  +    A+E   D   +G+ + V 
Sbjct: 97  NQLKKIFSRFGTVVEASIPKKRDGKLCGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVD 156

Query: 295 RAQKKYERLQELKK 308
            A +K  R ++ KK
Sbjct: 157 FAVQK-NRWEDYKK 169

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 364 KGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKE 403
           +GFGFV F+  ++  +A+ +  +  + G  L V IA+R++
Sbjct: 5   RGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRD 44

>Scas_714.59
          Length = 233

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFA-PFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
             L +  L+++ D+  L+EE   PF  I    V+R+ + G SKG  FV FS+ + A KA+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 55/109 (50%), Gaps = 11/109 (10%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETD-------NEGKLRGFGFVNFEDHNAAA 275
           +Y+ N+   + +++  +    +   +S ++          NE +  G  +V+F     A 
Sbjct: 6   IYIANVSYSSSEEDLREFLKDFN-FSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAV 64

Query: 276 KAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESS--RMEKLAKYQ 322
           +AVEELN  +F G+ L V R    Y+  + +K+++ +   +++K AKY+
Sbjct: 65  RAVEELNGKEFGGRVLRV-RTHNPYQPPKPIKERFGTKLQQLKKFAKYE 112

>Kwal_33.15208
          Length = 186

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 8/110 (7%)

Query: 19  DEQPTGPTS-TDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGS-VSSIRVCRDAI 76
           DEQ  G ++  D++    E S+ S++VG +  S+T   L  LF  + S V+ + +  + +
Sbjct: 34  DEQSPGISAKCDNDR---EVSTRSVFVGNISQSITAEELQLLFKDVVSCVNRVEIQVNRV 90

Query: 77  TKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKG 126
              + G+AYV F      T A+E L+     GR  R++  +  P  R++G
Sbjct: 91  NGLTKGFAYVEFAQPKDVTAAVE-LDNVDFHGRRLRVVPKR--PDFRQEG 137

>Scas_720.2
          Length = 245

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%)

Query: 31  ESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           E  +    SA++YVG L    +E  +Y+LFS  G +  I +  D    T  G+ +V + +
Sbjct: 38  EELRQSLQSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSN 97

Query: 91  HNAGTTAIEKLNYTPIKGRPCRI 113
                 A++ L+ T +  +   I
Sbjct: 98  AQEALNALKYLSDTKLDDKHITI 120

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEEL 281
           +YV N+   T +++  +LFS+ G I   ++  D  +    GF FV + +   A  A++ L
Sbjct: 49  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNALKYL 108

Query: 282 NDTDFNGQKLYV 293
           +DT  + + + +
Sbjct: 109 SDTKLDDKHITI 120

>Scas_570.14
          Length = 113

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 326 LFVKNLDDSIDDEKLQEE----FAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
           L+V NLD+ I+ ++L+      F+ +G +  V +    A   +G  F+   T +EA  A+
Sbjct: 32  LYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAI---SAKKQRGQAFITMRTVDEANLAL 88

Query: 382 TEKNQQIVAGKPLYVAIAQ 400
              N +    KPL++  ++
Sbjct: 89  ISLNNEPFFDKPLHIQFSK 107

>Kwal_27.11096
          Length = 201

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%)

Query: 31  ESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHD 90
           E  +    SA++YVG L    +E  +Y+LFS  G +  I +  D    T  G+ +V ++ 
Sbjct: 37  EDLRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNT 96

Query: 91  HNAGTTAIEKLNYTPIKGR 109
                 A++ L+ T +  R
Sbjct: 97  PEEALNAVKYLSDTKLDDR 115

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 13/105 (12%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVEEL 281
           +YV N+   T +++  +LFS+ G I   ++  D  +    GF FV +     A  AV+ L
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVKYL 107

Query: 282 NDTDFNGQKLYV------------GRAQKKYERLQELKKQYESSR 314
           +DT  + + + +            GR +   +   EL+ ++++SR
Sbjct: 108 SDTKLDDRNISLDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 12/88 (13%)

Query: 295 RAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVK 354
           +A++  + L++L++   S+            ++V NL     +E++ E F+  G I  + 
Sbjct: 28  KARRNPDGLEDLRRSMRSA-----------TIYVGNLSFYTSEEQIYELFSKSGVIKRII 76

Query: 355 VMRDDAG-SSKGFGFVCFSTPEEATKAI 381
           +  D    +  GF FV ++TPEEA  A+
Sbjct: 77  MGLDRFKFTPCGFCFVIYNTPEEALNAV 104

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 324 VNLFVKNLDDSIDDEKLQEEFA-PFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
             L +  ++++ D+  L+EE   PF  I  V V+R+ + G S+G  FV FS+ E A +A+
Sbjct: 191 CTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQAL 250

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           +FV  LD S+  EKL + F+  G +  V ++  D  ++K F F+ + T E    A+  +N
Sbjct: 382 IFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKD-NNTKVFAFIKYETEEATATALEREN 440

Query: 386 QQIVAGKPLYVAIAQRKEV 404
                 + ++V   Q +EV
Sbjct: 441 HASFLNRTMHV---QYREV 456

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIR-VCRDAITKTSLGYAYVNFHDHNAGTTAIE 99
           S++V +LDPSVT+  L   FS  G V  +  + +D  TK    +A++ +    A  TA+E
Sbjct: 381 SIFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKDNNTKV---FAFIKYETEEATATALE 437

Query: 100 KLNYTPIKGRPCRIMWSQ 117
           + N+     R   + + +
Sbjct: 438 RENHASFLNRTMHVQYRE 455

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSA-VLETDNEGKLRGFGFVNFEDHNAAAKAVEEL 281
           ++V  +DP   +++  + FS++G +    ++  DN  K+  F F+ +E   A A A+E  
Sbjct: 382 IFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKDNNTKV--FAFIKYETEEATATALERE 439

Query: 282 NDTDFNGQKLYV 293
           N   F  + ++V
Sbjct: 440 NHASFLNRTMHV 451

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 51/97 (52%), Gaps = 12/97 (12%)

Query: 326 LFVKNLDDSIDDEKL----QEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
           +FV +L  S+ D+ L     E F  +G ++ VKV+RD   S++ + FV ++   +A +A+
Sbjct: 163 VFVASLAASLTDDDLCVSVTEAFKKYGELSMVKVLRDP--SNRPYAFVQYTNDNDAKRAL 220

Query: 382 TEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQ 418
            +    ++ G+ +     ++ +V R+     I  RN+
Sbjct: 221 KQAQGTLLNGRTIRC---EKAKVNRTLF---ISTRNR 251

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 16/94 (17%)

Query: 28  TDSESTKGEASS--------ASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKT 79
           +D ++ +G  SS        ASL   +L  SVTEA     F   G +S ++V RD   + 
Sbjct: 150 SDPKTWRGRPSSCVFVASLAASLTDDDLCVSVTEA-----FKKYGELSMVKVLRDPSNRP 204

Query: 80  SLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRI 113
              YA+V + + N    A+++   T + GR  R 
Sbjct: 205 ---YAFVQYTNDNDAKRALKQAQGTLLNGRTIRC 235

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 3/89 (3%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEE 280
           T+++V N+ PET  ++ +K+F +   +    L++D     R F FV F+D         +
Sbjct: 17  TSIFVGNLSPETSPEDLQKVFGESVKVEIPTLQSDRTYP-RIFAFVTFDDKVDVEDLRSK 75

Query: 281 LNDTDFNGQKLYVGRAQKKYERLQELKKQ 309
            + T    + +YV +     E  Q+LKKQ
Sbjct: 76  FDKTVIKDKSIYVTKVLTPEE--QQLKKQ 102

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 77/210 (36%), Gaps = 43/210 (20%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKS--RKFGFVHFXXXXXXXXXID 186
           ++F+ NL P    + L     VFG  +  +I T ++ ++  R F FV F           
Sbjct: 18  SIFVGNLSPETSPEDLQ---KVFGESVKVEIPTLQSDRTYPRIFAFVTFDDKVDVEDLRS 74

Query: 187 AINGMLLNGLEVYV--------------------------APHVSKKDRQSKLDEVKSNF 220
             +  ++    +YV                          AP    K+ Q  L++++ + 
Sbjct: 75  KFDKTVIKDKSIYVTKVLTPEEQQLKKQKRRANQRGKAVPAPPKKNKEAQVPLEQMERSK 134

Query: 221 TNVYVKNIDPETKQDEFEKLF--SQYGAITSAVLETDNEGKL--------RGFGFVNF-E 269
             +YV NI   T + E    F  ++   I       D   K         RG  FV+F E
Sbjct: 135 DTLYVNNIPYHTTKAEIASFFGTTEESVILPMRRMKDTTTKRVFFSRKFNRGIAFVSFPE 194

Query: 270 DHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299
             +  AKA  E N  +F  ++L V  A  K
Sbjct: 195 GTDIEAKAA-EFNGKNFEDRELTVDVAANK 223

>Scas_582.10
          Length = 283

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLET-------DNEGKLRGFGFVNFEDHNAAA 275
           +YV NI   T Q +   LFS+YG I     E        D +G  +G   V +E   +  
Sbjct: 43  IYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALVVYEKPESVQ 102

Query: 276 KAVEELNDTDFNGQKLYVGRAQ 297
            A++ ++ T FN   + V RAQ
Sbjct: 103 LAIDMVDGTIFNKSTIKVERAQ 124

>Kwal_33.13496
          Length = 330

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFXXXXXXXXXIDAI 188
           +FI  L+P    K L   FS FG I   +I  D ETG S  +GF+ F            +
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 189 NGMLLNGLEVYV 200
            G+L++   ++V
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%)

Query: 38  SSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTA 97
           S   L++ +L+P      L  +FS  G++  + + RD  T  SL Y ++ F + ++   A
Sbjct: 245 SEKVLFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAA 304

Query: 98  IEKLNYTPIKGRPCRIMWSQ 117
             K+    I  R   + + Q
Sbjct: 305 YSKMEGVLIDDRRIHVDFCQ 324

 Score = 35.4 bits (80), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEK 384
           LF+  L+     + L   F+ FGTI  V+++RD + G+S  +GF+ F+       A ++ 
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 385 NQQIVAGKPLYVAIAQ 400
              ++  + ++V   Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/76 (19%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281
           +++  ++P T+  +   +FS++G I    +  D E G    +GF+ F + ++   A  ++
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 282 NDTDFNGQKLYVGRAQ 297
                + ++++V   Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

>Scas_530.4
          Length = 684

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 9/86 (10%)

Query: 326 LFVKNLDDSIDDEKL----QEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
           +FV +L  ++ D++L     + F  FG I  VKV+RD A  ++ + FV ++   +A  A+
Sbjct: 143 VFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQA--NRPYAFVQYTNDNDANVAL 200

Query: 382 TEKNQQIVAGKPLYVAIAQRKEVRRS 407
            E +  I+ G+ L     +R  V R+
Sbjct: 201 KEAHGSILNGRRLR---CERARVNRT 223

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 65/333 (19%), Positives = 122/333 (36%), Gaps = 63/333 (18%)

Query: 119 DPSLRKKGSGNVFI----KNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVH 174
           +P+ R + S  VF+     NLH      ++ D F  FG I+  K+  D+   +R + FV 
Sbjct: 132 EPTFRGRPSSCVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQA--NRPYAFVQ 189

Query: 175 FXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQ 234
           +         +   +G +LNG             R+ + +  + N T +++ +  P  + 
Sbjct: 190 YTNDNDANVALKEAHGSILNG-------------RRLRCERARVNRT-LFITHNSP-IEL 234

Query: 235 DEFEKLFSQYGAITSAVLETDNEGKLR---------GFGFVNFEDHNAAAKAVEEL-NDT 284
            E   +  ++G +   V + D+   +R            F  F   + A +A   L  D+
Sbjct: 235 FEVHAICRKFGELDQLVPKRDDNPFMRRCSYPISNSSSWFAQFTFRDDAIRAFANLKTDS 294

Query: 285 DFNGQKLYVGRAQKKY-----------ERLQELKKQYESSRMEKLAKYQGVN-------- 325
           ++  Q     R  K +           E +     Q + +  +        N        
Sbjct: 295 NWAVQWAQNIRVPKFFNLLNKDSPMDKENITNFNSQEDGADTDPTHDNNLNNDNMQPVTI 354

Query: 326 ----LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
               +FV  L +   +E L+  F+  G I  + ++         F F+ + T   A  A+
Sbjct: 355 DKKSIFVGQLPEETTEEVLKIHFSKHGKILDLNLIHKPKNV---FAFIQYETENAAAIAL 411

Query: 382 TEKNQQIVAGKPLYV------AIAQRKEVRRSQ 408
             +N  I   K ++V       I  R+  +RSQ
Sbjct: 412 ETENHSIFISKTIHVQYKEIGGIHGRRNSKRSQ 444

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           +++L+  EL  SVT     D F   G +  ++V RD   +    YA+V + + N    A+
Sbjct: 149 ASNLHDDELCLSVT-----DYFKKFGEIIRVKVLRDQANRP---YAFVQYTNDNDANVAL 200

Query: 99  EKLNYTPIKGRPCRI 113
           ++ + + + GR  R 
Sbjct: 201 KEAHGSILNGRRLRC 215

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100
           S++VG+LD S T+ +L   FS  G + +I    D ++K +  +A++ +    A   A++K
Sbjct: 377 SIFVGQLDLSTTKEILVKRFSTHGKIRNI----DVVSKPTTVFAFIEYETEQAAAAALDK 432

Query: 101 LNYTPIKGRPCRIMWSQ 117
            N++ +  +   + + +
Sbjct: 433 ENHSILLSKTMHVQYKE 449

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           +FV  LD S   E L + F+  G I ++ V+   +  +  F F+ + T + A  A+ ++N
Sbjct: 378 IFVGQLDLSTTKEILVKRFSTHGKIRNIDVV---SKPTTVFAFIEYETEQAAAAALDKEN 434

Query: 386 QQIVAGKPLYVAIAQRKEV 404
             I+  K ++V   Q KE+
Sbjct: 435 HSILLSKTMHV---QYKEI 450

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 12/101 (11%)

Query: 316 EKLAKYQG---VNLFVKNLDDSIDDEKL----QEEFAPFGTITSVKVMRDDAGSSKGFGF 368
           + +  Y+G     +FV +L  S+ D++L     + F  +G +  VKV+RDD   ++ + F
Sbjct: 84  DTIGDYKGRPSACIFVASLASSLPDDQLCMNVTKHFQNYGQLVGVKVLRDD--HNRPYAF 141

Query: 369 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQL 409
           V +   ++A  A+   +  ++ G+ L    A+   V R+ L
Sbjct: 142 VQYINDKDAKHALKNASGTVLNGRKLRCEAAK---VNRTLL 179

>Kwal_26.8458
          Length = 219

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDE-TGKSRKFGFVHFXXXXXXXXXI 185
           SG +++  L      + L   FS FG++   ++A ++ TG SR +GFV F          
Sbjct: 89  SGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQ 148

Query: 186 DAINGMLLNG--LEVYVAP 202
           + ++  LL G  L+V   P
Sbjct: 149 ETMHNYLLMGHLLQVVALP 167

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 35/82 (42%)

Query: 33  TKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHN 92
           +K +  S  +YV  L     E  L   FS  G +  +R+ R+  T  S  Y +V F +  
Sbjct: 83  SKADGLSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKE 142

Query: 93  AGTTAIEKLNYTPIKGRPCRIM 114
               A E ++   + G   +++
Sbjct: 143 DSFVAQETMHNYLLMGHLLQVV 164

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEK 384
           ++V  L     + +L + F+ FG +  V++ R+   G+S+ +GFV F   E++  A    
Sbjct: 92  IYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETM 151

Query: 385 NQQIVAGKPLYV 396
           +  ++ G  L V
Sbjct: 152 HNYLLMGHLLQV 163

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 309 QYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFG 367
           Q  + R+EK  +    ++FV N+      E L+E F   G +  V ++ +   G+ KG+ 
Sbjct: 88  QSRAERLEKQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYA 147

Query: 368 FVCFSTPEEATKAITEKNQQIVAGKPLYVA 397
           ++ F + +   KA+  K+ ++  G+ + VA
Sbjct: 148 YIEFESSDSIPKALELKDSEL-HGETINVA 176

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 203 HVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS-AVLETDNEGKLR 261
           H S+ +R  K  E+ S   +++V NI  E   +  E+ F   G +    +L     G  +
Sbjct: 87  HQSRAERLEKQIELDS--RSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPK 144

Query: 262 GFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGR 295
           G+ ++ FE  ++  KA+ EL D++ +G+ + V +
Sbjct: 145 GYAYIEFESSDSIPKAL-ELKDSELHGETINVAK 177

 Score = 35.8 bits (81), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%)

Query: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95
           E  S S++VG +    T   L + F   G V  + +  + +T    GYAY+ F   ++  
Sbjct: 99  ELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIP 158

Query: 96  TAIE 99
            A+E
Sbjct: 159 KALE 162

>KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 652

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 79/196 (40%), Gaps = 49/196 (25%)

Query: 8   TAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVS 67
           TAE    L +Q  Q   P    +      A S ++Y+G +  ++T   L D +   G V 
Sbjct: 207 TAEANLPLSLQSGQLNNPRDFTT------APSRTVYLGNIPATITYKALLD-YVRTGVVE 259

Query: 68  SIRVCRDAITKTSLGYAYVNFHDHNAGT-----TAIEKLNYTPIKGRPCRIMWSQ---RD 119
            +++  + +       A+V+F D N          +++LN   I GR  +I W +    D
Sbjct: 260 EVKILSEKMC------AFVSFVDENDALLFHSDAILKRLN---IDGRDIKIGWGKPQPID 310

Query: 120 PSLRKK-----GSGNVFIKNLHPAIDN---------------KALHDTFSVFGNILSCKI 159
           P +R        + NV+I  L+   D+               + L+D  S FG I S K+
Sbjct: 311 PIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADPKEILVTKEKLYDDLSQFGEIESIKL 370

Query: 160 ATDETGKSRKFGFVHF 175
             D     R   FVHF
Sbjct: 371 VED-----RGIAFVHF 381

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 15/119 (12%)

Query: 229 DPETKQDEFEKLF---SQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTD 285
           DP+      EKL+   SQ+G I S  L  D     RG  FV+F    AA KAV  +   D
Sbjct: 344 DPKEILVTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAVANIGSID 398

Query: 286 --FNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342
             ++ +K++ G+     +R   + K  + +  + L    G+   ++N  + I    LQ+
Sbjct: 399 PYYSNKKVFYGK-----DRCAFITKTQQHNVAQFLGIQPGMEALMENNRELISQTLLQQ 452

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
           +  EKL ++ + FG I S+K++ D     +G  FV F++   A KA+
Sbjct: 350 VTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAV 391

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEK 384
           +++  L     + +L   FA FG +  V++ R+   G+S+ + F+ F+ P++A  A    
Sbjct: 80  IYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETM 139

Query: 385 NQQIVAGKPLYVAI 398
           +  ++ G  L V++
Sbjct: 140 HNYLLMGHLLQVSV 153

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 64/137 (46%), Gaps = 17/137 (12%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLET-----------DNEGKLRGFGFVNFEDH 271
           VY+ N+     + +     + YGA +S ++ T            N  K  G  F  F ++
Sbjct: 20  VYISNLPFTASERDLHAFLNNYGA-SSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANN 78

Query: 272 NAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQ----ELKKQYESSRMEKLAKYQGVNLF 327
             A KA+++LN T F  QKL++ +    YE       ++KK  E ++++K  +     ++
Sbjct: 79  TLALKAIQDLNGTVFQNQKLFL-KLHVPYEADSTPDTDVKKPKEKNKVKKTPETAADTVY 137

Query: 328 VKNLDDSIDDEKLQEEF 344
             +L D I D +++E F
Sbjct: 138 CHDLPDDITDSEIRELF 154

>ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH]
           (1420640..1422850) [2211 bp, 736 aa]
          Length = 736

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 10/70 (14%)

Query: 228 IDPETK----QDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELND 283
           + PE K    Q    KLFSQ G++    +  + EG+ +G  F+ FED  AA +A++    
Sbjct: 46  VAPEAKVGALQKVLTKLFSQAGSVVDMDVPVE-EGRTKGHLFIEFEDAGAARRAIKM--- 101

Query: 284 TDFNGQKLYV 293
             FNG+KL V
Sbjct: 102 --FNGKKLDV 109

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S+++YVG L    +E  +Y+LFS  G++  I +  D    T  G+ ++ +   +    A+
Sbjct: 45  SSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNAL 104

Query: 99  EKLNYTPI 106
           + L+ T +
Sbjct: 105 KYLSDTKL 112

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 51/107 (47%), Gaps = 13/107 (12%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVE 279
           + +YV N+   T +++  +LFS+ G I   ++  D  +    GF F+ +   + A  A++
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALK 105

Query: 280 ELNDTDFNGQKLYV------------GRAQKKYERLQELKKQYESSR 314
            L+DT  + + + +            GR +   +   EL+  +++SR
Sbjct: 106 YLSDTKLDEKTITIDLDPGFEDGRQFGRGKSGGQVSDELRFDFDASR 152

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
          Saccharomyces cerevisiae YIR001c SGN1, hypothetical
          start
          Length = 144

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 9/89 (10%)

Query: 7  KTAEQLEQLRIQDEQPTGPTSTDSESTKG-------EASSASLYVGELDPSVTEALLYDL 59
          K +E  E L +     T  T ++S  T+        EA + S+Y+G +    T   + + 
Sbjct: 7  KISEIFENLNVSSNNVT--TQSNSRLTREQKHALQLEADACSIYIGNISLDTTPEEIDEH 64

Query: 60 FSPIGSVSSIRVCRDAITKTSLGYAYVNF 88
          F   G +  I +  D  T  S+GYAYV F
Sbjct: 65 FKSCGVIKRITMLYDKNTGPSIGYAYVEF 93

>Kwal_55.20903
          Length = 147

 Score = 36.2 bits (82), Expect = 0.020,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 13/128 (10%)

Query: 293 VGRAQKKYERLQE---LKKQYESSRMEKLAKYQGVN--------LFVKNLDDSIDDEKLQ 341
           +G+  KK  +++    LK    SS  E  AK + ++        +F++++   I    L+
Sbjct: 17  LGKWSKKPVKIRHSPALKSSNRSSHQESAAKGENIDQSETDSRSIFLRDIPSDISLPSLE 76

Query: 342 EEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401
           + F   G+I  + ++     S  G+ +V F+T   A +A+ E +  I+ G  L VA  +R
Sbjct: 77  DHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-ELDGSILRGHKLRVA-RKR 134

Query: 402 KEVRRSQL 409
             V R ++
Sbjct: 135 TNVPRMRV 142

 Score = 31.6 bits (70), Expect = 0.90,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 34  KGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNA 93
           + E  S S+++ ++   ++   L D F  +GS+  I +      K+  GYAYV F    +
Sbjct: 53  QSETDSRSIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQ-RKSGTGYAYVEFATKAS 111

Query: 94  GTTAIEKLNYTPIKGRPCRIMWSQRD-PSLRKK 125
              A+E L+ + ++G   R+   + + P +R K
Sbjct: 112 AERALE-LDGSILRGHKLRVARKRTNVPRMRVK 143

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%)

Query: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98
           S+++YVG L    +E  +Y+LFS  G +  I +  D    T  G+ ++ ++       A+
Sbjct: 45  SSTIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAV 104

Query: 99  EKLNYTPIKGRPCRI 113
           + L  T +  +   I
Sbjct: 105 KYLGDTKLDDKSITI 119

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 50/107 (46%), Gaps = 13/107 (12%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN-EGKLRGFGFVNFEDHNAAAKAVE 279
           + +YV N+   T +++  +LFS+ G I   ++  D  +    GF F+ +     A  AV+
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVK 105

Query: 280 ELNDTDFNGQKLYV------------GRAQKKYERLQELKKQYESSR 314
            L DT  + + + +            GR +   +   EL+ ++++SR
Sbjct: 106 YLGDTKLDDKSITIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 12/93 (12%)

Query: 290 KLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGT 349
           K  + +A++    L +L++  +SS            ++V NL     +E++ E F+  G 
Sbjct: 23  KYLLRKARRNPNGLNDLRQSLKSS-----------TIYVGNLSFYTSEEQIYELFSKCGF 71

Query: 350 ITSVKVMRDDAG-SSKGFGFVCFSTPEEATKAI 381
           I  + +  D    +  GF F+ ++TP+EA  A+
Sbjct: 72  IKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAV 104

>Kwal_55.21039
          Length = 119

 Score = 35.8 bits (81), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 223 VYVKNIDPETK----QDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAV 278
           +YV N++   K    ++    LFS YG     VL+ D   ++RG  F+  +  + A  A+
Sbjct: 37  LYVHNLNDRVKIQTLRENLFLLFSTYGE----VLQIDMSKRIRGQAFIVLKTVDEANIAL 92

Query: 279 EELNDTDFNGQKLYVGRAQKKYERLQE 305
             LN+  F G+ L++  ++K    L E
Sbjct: 93  ISLNNEPFFGKDLHIQFSKKDSRLLTE 119

>CAGL0G05511g complement(522026..524050) similar to sp|P34761
           Saccharomyces cerevisiae YNL197c WHI3 involved in
           regulation of cell size, start by similarity
          Length = 674

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 223 VYVKNIDPETKQDEFEKLFS-QYGAITSAVLETDNEGKLRGFG---FVNFEDHNAAAKAV 278
           +YV N+ P+T + E  +LFS Q G    +    +N G   G G   FV FED + A +A+
Sbjct: 560 LYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNNNGHTHGHGPMCFVEFEDVSFATRAL 619

Query: 279 EEL 281
            EL
Sbjct: 620 AEL 622

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 81/193 (41%), Gaps = 9/193 (4%)

Query: 129 NVFIKNLHPAIDNKALHDTFSVFG-NILSCKIATDETGKSRKFGFVHFXXXXXXXXXIDA 187
            +++ N  P  D + L   F   G   LS ++ +      R+F +V            + 
Sbjct: 109 TLWVTNFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANT 168

Query: 188 INGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNID-PETKQDEFEKLFSQYGA 246
           +NGM L+G  + V      + R  + D        V ++ +D  +   ++ + L   +G 
Sbjct: 169 LNGMDLDGYNLVVKLS-DPESRAQRSDAGTIEKREVLIRGLDFIKVTIEKLQGLVEPFGE 227

Query: 247 ITSAVLETDNEG----KLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK-YE 301
           +   ++   ++       RGF FV ++D  AA  A+   N T F  ++L V  A +K Y 
Sbjct: 228 VEKLIMPPSSDSADGRHNRGFAFVTYKDAAAAEAALALHN-TVFEDRRLTVAMADRKPYL 286

Query: 302 RLQELKKQYESSR 314
             Q++K+   S +
Sbjct: 287 ERQKVKQILVSRK 299

>Kwal_55.20414
          Length = 284

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 38/89 (42%), Gaps = 6/89 (6%)

Query: 211 SKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEG------KLRGFG 264
           +++ E  S    +YV N+D  T ++E  +   +Y  ++  +      G      +  G G
Sbjct: 7   TQVSEASSQIKRIYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNSTVRPLGIG 66

Query: 265 FVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
           + +F+    A  A + LN      +KL +
Sbjct: 67  YADFQSAQDAQNAAQNLNGKQLKDRKLKI 95

>Kwal_55.22147
          Length = 468

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (45%), Gaps = 21/120 (17%)

Query: 223 VYVKNI--DPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVN--FEDHNAAAKAV 278
           V+V NI  D +T   E  + F ++G  TS   E+        FG+VN  FE+  A AK  
Sbjct: 7   VFVGNIYNDHDTSLTELYRRFQRFGKCTSDKFESHAH-----FGYVNMEFENEAAFAKLK 61

Query: 279 EELNDTDFNGQKLYVGRA----QKKYERLQ--------ELKKQYESSRMEKLAKYQGVNL 326
           +  N   F G  L V  A    Q+++++ Q        E +KQ E S+ E   K + + +
Sbjct: 62  QSFNGVKFKGNILKVDVAKMGWQERWKKDQEEGQHIEEEKQKQMEKSQWEHYKKLENIKM 121

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%)

Query: 29  DSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNF 88
           D ++ + E  S S++VG + PS T   L   F   G +  + +  +  T    GYAY+ F
Sbjct: 72  DRQARQIELDSRSIFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEF 131

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 326 LFVKNLDDSIDDEKL----QEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
           +FV +L  ++ D++L     E F  +G +  VKV+RD+A  ++ + FV ++   +A  A+
Sbjct: 95  IFVASLAAALSDDELCLSVTENFKKYGDLARVKVLRDNA--NRPYAFVQYNNDHDAKHAL 152

Query: 382 TEKNQQIVAGKPLYVAIAQ 400
                 ++ G+ L    A+
Sbjct: 153 IRAQGTLLNGRRLRCEPAK 171

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 359 DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           D G  +G  F  F+TPEE T+ IT  N + ++G+ L V
Sbjct: 121 DNGIFRGLAFANFTTPEETTQVITSLNGKEISGRKLKV 158

>ACL149W [900] [Homologous to ScYDL167C (NRP1) - SH]
           complement(88715..90601) [1887 bp, 628 aa]
          Length = 628

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 28/120 (23%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLETDNEGKLRGF------------ 263
           +Y+ N+ P+T Q E E  F+Q+GA       + + V +T N                   
Sbjct: 200 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSI 259

Query: 264 -GFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQE--LKKQYESSRMEKLAK 320
            GFV F+ H AA++A+      + NG+ +    A  K  R+ E  ++ +  SSR+   A+
Sbjct: 260 SGFVVFQSHEAASEAL------NLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQ 313

>Scas_565.8
          Length = 322

 Score = 35.4 bits (80), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 8/90 (8%)

Query: 211 SKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRG-------F 263
           S +D ++     +   N+   T   E E+L   +G + S +  T++    RG       +
Sbjct: 7   SNVDPIEITTHKLVFTNVRFNTSDAELEELLKPFGKV-SVLTPTESLFGFRGTKVVSIGY 65

Query: 264 GFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
            +V FE    AA A  EL+ T+F G+ LY+
Sbjct: 66  AYVIFETPQLAATAFNELHKTEFKGRTLYI 95

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 5/93 (5%)

Query: 26  TSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAI----TKT-S 80
           T+ DS     E ++  L    +  + ++A L +L  P G VS +           TK  S
Sbjct: 3   TNGDSNVDPIEITTHKLVFTNVRFNTSDAELEELLKPFGKVSVLTPTESLFGFRGTKVVS 62

Query: 81  LGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRI 113
           +GYAYV F       TA  +L+ T  KGR   I
Sbjct: 63  IGYAYVIFETPQLAATAFNELHKTEFKGRTLYI 95

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 35.4 bits (80), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 326 LFVKNLDDSIDDEKLQEEFA-PFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
           L +  L++  D+  +++E   PFG I  V V+R+ + G S+G  ++ F T E A  A+
Sbjct: 200 LKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETAL 257

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 326 LFVKNLD-DSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEK 384
           LF+ NL   ++  + L   F+PFG I  + +          FGF+ +  P+    AI  +
Sbjct: 332 LFIGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECE 384

Query: 385 NQQIVAGKPLYVAIA 399
           +Q+I  GK L + ++
Sbjct: 385 SQEINFGKKLILEVS 399

>Kwal_56.24638
          Length = 527

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 26/122 (21%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLETDN-------------EGKLRG 262
           +Y+ N+ P+T Q E E  F+Q+GA       + + V ET N             E +   
Sbjct: 212 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSI 271

Query: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ 322
            GFV F+ H  A +A+        NG+ +    A  K  R+ E   + + S    L + Q
Sbjct: 272 SGFVVFQSHEEATEAL------SLNGRSILSNIANTKQPRVIEHIVEVQPSSARVLDRAQ 325

Query: 323 GV 324
            +
Sbjct: 326 EI 327

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 27/66 (40%)

Query: 222 NVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEEL 281
            V+V     ET+  +    F   G I    +      + R F FV FE H    +AVEEL
Sbjct: 6   TVHVSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEEL 65

Query: 282 NDTDFN 287
           +   F 
Sbjct: 66  DGRPFT 71

>Sklu_2434.14 YOR361C, Contig c2434 32150-34360
          Length = 736

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 13/83 (15%)

Query: 219 NFTNVYVKN---IDPETK----QDEFEKLFSQYGAITSAVLETDNEGKL-RGFGFVNFED 270
           NF N  V +   + PE+K         KLFSQ G +    L  D E K  +G+ FV F+ 
Sbjct: 35  NFDNFVVVDGAPVAPESKVPVLTKVLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDS 94

Query: 271 HNAAAKAVEELNDTDFNGQKLYV 293
             AA KA+  L     NG+KL V
Sbjct: 95  AVAAKKAIALL-----NGKKLDV 112

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%)

Query: 51  VTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLN 102
           V   +L  LFS  G+V  + +  D   KT+ GY +V F    A   AI  LN
Sbjct: 55  VLTKVLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLN 106

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 326 LFVKNLDDSIDDEKLQEE----FAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
           ++VKNL+D I  + ++E     FA +G +  V +        +G  F+ F + +EA  A+
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGEVIKVSM----TPKQRGQAFITFKSVDEANLAL 89

Query: 382 TEKNQQIVAGKPLYVAIAQRKEVR 405
                ++   KPL +  +++   +
Sbjct: 90  LSLKDELFFNKPLVLQFSKQTTTK 113

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 215 EVKSNFTNVYVKNIDPETK----QDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFED 270
           E++ N T VYVKN++ + K    ++    LF+ YG     V++     K RG  F+ F+ 
Sbjct: 27  EIEPNNT-VYVKNLNDQIKIQTVRESLYMLFATYG----EVIKVSMTPKQRGQAFITFKS 81

Query: 271 HNAAAKAVEELNDTDFNGQKLYVGRAQKKYERL 303
            + A  A+  L D  F  + L +  +++   +L
Sbjct: 82  VDEANLALLSLKDELFFNKPLVLQFSKQTTTKL 114

>YDL167C (NRP1) [704] chr4 complement(160996..163155)
           Asparagine-rich protein with one RNA recognition (RRM)
           domain [2160 bp, 719 aa]
          Length = 719

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 55/147 (37%), Gaps = 29/147 (19%)

Query: 198 VYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN- 256
           V   P+ S  D ++ L E KS    +Y+ N+ P+T Q E E  F+QYG          N 
Sbjct: 206 VLTKPYDSHTDIRAFLQE-KSKI--LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNI 262

Query: 257 -------------------EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQ 297
                              E +    GFV F+ H  A + +        NG+ +    A 
Sbjct: 263 VEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEATEVLA------LNGRSILSNLAN 316

Query: 298 KKYERLQELKKQYESSRMEKLAKYQGV 324
            K  R+ E   + + S    L K Q +
Sbjct: 317 TKQPRVVEHVLELQPSSTGVLDKAQEI 343

>Kwal_30.12890
          Length = 280

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 328 VKNLDDSIDDEKLQEEFA-PFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
           +  L+++ D+  L+ E   PFG I  V V+R+ + G S+G  +V F T E A  A+
Sbjct: 201 IMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETAL 256

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%)

Query: 55  LLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLN 102
           L Y+L  P G +  + V R+  T  S G AYV F       TA+  LN
Sbjct: 213 LRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLN 260

>Sklu_2063.4 YDL167C, Contig c2063 1979-3781
          Length = 600

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 51/115 (44%), Gaps = 28/115 (24%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLETDN-------------EGKLRG 262
           +Y+ N+ P+T Q E E  F+Q+GA       + + V ET N             E +   
Sbjct: 221 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSI 280

Query: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQE--LKKQYESSRM 315
            GFV F+ H  A +A+        NG+ +    A  K  R+ E  ++ Q  S+R+
Sbjct: 281 SGFVVFQTHEEATEAL------SLNGRSILSNMANTKQPRVVEHVVELQPSSTRV 329

>Kwal_55.20718
          Length = 594

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNF 88
           S++VG+LDP  TE  L   FS  GS++ I +    ITK +  +A++ F
Sbjct: 201 SIFVGQLDPMATEEKLLKRFSRHGSITDINL----ITKPNNVFAFIKF 244

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKN 385
           +FV  LD    +EKL + F+  G+IT + ++      +  F F+ F+T E A  A+  +N
Sbjct: 202 IFVGQLDPMATEEKLLKRFSRHGSITDINLI---TKPNNVFAFIKFTTEEAAAAALEMEN 258

Query: 386 QQIVAGKPLYVAIAQRKEVRRSQLAQQ 412
             I   K ++V   +   ++R +   Q
Sbjct: 259 HAIFLSKTMHVQYREIGGIKRFRRGNQ 285

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 219 NFTNVYVKNIDPETKQDEFEKLFSQYGAIT----SAVLETDNEGKLR--GFGFVNFEDHN 272
           N   VY+ N+  +T +DE      +Y  ++    S  +      ++R  G  + +FE  +
Sbjct: 20  NNRRVYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRGFRNSRVRPLGIAYADFESAD 79

Query: 273 AAAKAVEELNDTDFNGQKL 291
            A +A+E LN   FN + L
Sbjct: 80  KAKEAIEALNGKVFNNRTL 98

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 13/102 (12%)

Query: 18  QDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTE------ALLYDLFSPIGSVSSIRV 71
           QD  P   T   SE+ +       +Y+  L    TE       L Y++ S +    +IR 
Sbjct: 6   QDSAPRQQTVQPSENNR------RVYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRG 59

Query: 72  CRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRI 113
            R++  +  LG AY +F   +    AIE LN      R  R+
Sbjct: 60  FRNSRVR-PLGIAYADFESADKAKEAIEALNGKVFNNRTLRL 100

>Scas_241.1
          Length = 186

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 13/98 (13%)

Query: 20  EQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKT 79
           +QPT    TD  +T       ++++G L   V+E  L   F P G +  +++       T
Sbjct: 13  QQPTLNHLTDPNNT-------TVFIGGLSSLVSEDDLRQYFQPFGDIIYVKI------PT 59

Query: 80  SLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQ 117
             G  +V + D  +   AI K+   P+     R+ W +
Sbjct: 60  GKGCGFVQYVDRLSAELAISKMQGFPLANSRIRLSWGR 97

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 315 MEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTP 374
           +  L       +F+  L   + ++ L++ F PFG I  VK+      + KG GFV +   
Sbjct: 17  LNHLTDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIP-----TGKGCGFVQYVDR 71

Query: 375 EEATKAITE 383
             A  AI++
Sbjct: 72  LSAELAISK 80

>ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391)
           [1401 bp, 466 aa]
          Length = 466

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 38/94 (40%), Gaps = 5/94 (5%)

Query: 24  GPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSI----RVCRDAITKT 79
           GP   D+ +   E S  ++YVG L    T+  L   F        I    R  R    + 
Sbjct: 173 GP-QVDAAAVPREMSKVTIYVGRLPGRTTDKDLRTYFHEYLPQEIIVFKHRQFRGWRIRR 231

Query: 80  SLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRI 113
            +  A + F DH    +A+E L+  P  GR  R+
Sbjct: 232 HVTAAVITFPDHERQESALESLSNLPFNGRTVRM 265

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 34/77 (44%), Gaps = 6/77 (7%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEG------KLRGFGFVNFEDHNAAAK 276
           VY+ N+  +  ++   +    +  ++  +      G      +  G  +V F+D + AAK
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSVRPLGIAYVEFKDADTAAK 110

Query: 277 AVEELNDTDFNGQKLYV 293
            + ELN   F  ++L +
Sbjct: 111 VILELNGVTFMDRELRL 127

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 42  LYVGELDPSVTEALLYDL---FSPIGSVSSIRVCRDAITKTS---LGYAYVNFHDHNAGT 95
           +Y+  L    TE  L +    F P+  +   +  R    KTS   LG AYV F D +   
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVR-GFQKTSVRPLGIAYVEFKDADTAA 109

Query: 96  TAIEKLNYTPIKGRPCRIMW 115
             I +LN      R  R+ +
Sbjct: 110 KVILELNGVTFMDRELRLRY 129

>KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036
           Saccharomyces cerevisiae YKL214c singleton, start by
           similarity
          Length = 173

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 213 LDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHN 272
            ++ +   T + ++NI  ET   E E   ++ G + S  +    E ++     V F+D  
Sbjct: 43  FNDRRKRITLLRIRNIPLETSDYEIEDWINEIGEVESIRINDRKENRV---ATVGFKDVQ 99

Query: 273 AAAKAVEELNDTDFNGQKLYV 293
               AVE+LN  + +G +L V
Sbjct: 100 LLGTAVEKLNGKEVHGSQLEV 120

>AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH]
           complement(381754..382098) [345 bp, 114 aa]
          Length = 114

 Score = 31.6 bits (70), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 8/80 (10%)

Query: 325 NLFVKNLDDSIDDEKLQEE----FAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKA 380
            L++ NL+D +    L+      F+ FG +  + +    +   +G  FV  ST +EA  A
Sbjct: 33  TLYISNLNDQVKISTLRTNLYLLFSTFGEVLRIAM----SPKLRGQAFVVLSTVDEANLA 88

Query: 381 ITEKNQQIVAGKPLYVAIAQ 400
           +     +   GKPL +  ++
Sbjct: 89  MISLKDESFFGKPLRIQFSK 108

>Scas_710.31*
          Length = 162

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 282 NDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLF-VKNLDDS 334
           N  + NG +  +G+  KK E   +L +    +R+E L K +G+++F  K LD S
Sbjct: 42  NLAEVNGPESLIGQGAKKGEVPTDLDQATGLARLELLGKLEGIDIFDTKPLDSS 95

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGA-ITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEEL 281
           + +KNI    K+++   +  + G  +  A     + G  RG  F NF      ++ + +L
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 282 NDTDFNGQKLYV 293
           N  + NG+KL V
Sbjct: 118 NGKEINGRKLKV 129

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 359 DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 396
           D G  +G  F  FSTPE+ ++ I++ N + + G+ L V
Sbjct: 92  DNGIFRGLAFANFSTPEDTSRVISDLNGKEINGRKLKV 129

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 323 GVNLFVKNLDDSIDDEKLQEEFA-PFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKA 380
              L +  L+++ D+  L+ E   PF  I  V V+R+ + G S+G  FV F   + A KA
Sbjct: 188 SCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKA 247

Query: 381 I 381
           +
Sbjct: 248 L 248

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 325 NLFVKNLDDSIDDEKLQEEFA-PFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAI 381
            + +  +++  D+E L+ E   PFG I  V V+++ + G S+G  +V F T E A +A+
Sbjct: 185 TIRLTQVNELADEEVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQAL 243

>Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement
          Length = 280

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 65/147 (44%), Gaps = 20/147 (13%)

Query: 121 SLRKKGSGNVFIKNLHPAIDN---KALHDTFSVFG--------NILSCKIATDETGKSRK 169
           ++++K +  +F+ NL  +++N     L   F+ FG        N   CK+  D TG  + 
Sbjct: 36  TMKRKQNSAIFVSNL--SVENTKRDELISEFNKFGMIRRDLSTNDYKCKLYFDSTGNFKG 93

Query: 170 FGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNID 229
              + +         I+ ++G  LNG ++ V   V  K + SK DE+         + ++
Sbjct: 94  EALIVYVRPESVGMAINMMDGFELNGEKITVQEAVFSK-KNSKEDEL--GMPTTKRRKLE 150

Query: 230 PETKQ----DEFEKLFSQYGAITSAVL 252
            E +Q    D++E   SQ G   + +L
Sbjct: 151 NEKEQAKRLDDWEDTDSQQGETYTVIL 177

>KLLA0A09097g 794827..797244 some similarities with sp|P25339
           Saccharomyces cerevisiae YGL014w, hypothetical start
          Length = 805

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 445 GVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFGRPNGPMYGVPPQG---PQGAFPRNG 501
           G+  P  +P +GPNP   AA +G P   VP      P+ P +  PP G   PQ   P++ 
Sbjct: 386 GLSQPGSLPMSGPNPWMFAAPHGSPNFLVP-----HPHHPGHAGPPAGHQRPQSNNPQHR 440

Query: 502 NQFF 505
            + F
Sbjct: 441 KRHF 444

>YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRNA
           mutations and homolog of human Tat-SF1 protein, contains
           two RNA recognition motif (RRM) domains [858 bp, 285 aa]
          Length = 285

 Score = 32.3 bits (72), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%), Gaps = 10/86 (11%)

Query: 221 TNVYVKNI--DPETKQDEFEKLFSQYGAITS-------AVLETDNEGKLRGFGFVNFEDH 271
           T++Y+  +  D  TK+   E+ F +YG I +         L  +++G  +G   + +   
Sbjct: 45  TSIYISGLPTDKTTKEGLTEQ-FCKYGMIRTNRDGEPLCKLYVNDKGAFKGDALITYSKE 103

Query: 272 NAAAKAVEELNDTDFNGQKLYVGRAQ 297
            +   A+E +N++ F G+++ V RAQ
Sbjct: 104 ESVTLAIEMMNESIFLGKQIRVERAQ 129

>Kwal_26.6824
          Length = 739

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 44/89 (49%), Gaps = 15/89 (16%)

Query: 215 EVKS--NFTNVYVKN---IDPETK----QDEFEKLFSQYGAITSAVLETDNEGKL-RGFG 264
           EV+S  NF N  V +   + PE+K         KLFSQ G +    L  D   K  +G+ 
Sbjct: 29  EVESPVNFDNFVVVDGAPVAPESKVPVLSKVLTKLFSQAGKVVDINLPLDEAKKCTKGYL 88

Query: 265 FVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
           FV F+   +A KA++ L     NG+KL V
Sbjct: 89  FVEFDSAVSARKAIKLL-----NGKKLDV 112

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 51  VTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLN 102
           V   +L  LFS  G V  I +  D   K + GY +V F    +   AI+ LN
Sbjct: 55  VLSKVLTKLFSQAGKVVDINLPLDEAKKCTKGYLFVEFDSAVSARKAIKLLN 106

>Kwal_27.11158
          Length = 567

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 332 DDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAG 391
           D+ + ++KL+++ + +G I SVK++     + KG  FV F +   A K ++     + A 
Sbjct: 260 DEVVTEQKLRDDLSFYGEIESVKII-----TEKGIAFVHFCSIFSAIKVVSS----LAAV 310

Query: 392 KPLY 395
            P Y
Sbjct: 311 NPYY 314

>Kwal_23.4597
          Length = 664

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 223 VYVKNIDPETKQDEFEKLFS-QYGAITSAVLETDNEGKLRG-FGFVNFEDHNAAAKAVEE 280
           +YV N+ P+  + E  +LFS Q G    +    +  G   G   FV FED   A +A+ E
Sbjct: 547 LYVGNLPPDATEHELRQLFSTQKGFRRLSFRNKNTNGNGHGPMCFVEFEDVAHATRALAE 606

Query: 281 L 281
           L
Sbjct: 607 L 607

>CAGL0C01419g complement(153063..154982) similar to sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 639

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 14/96 (14%)

Query: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAIT---EKN-----Q 386
           + +EKL+E+   +G I S+K++ +     K   FV FS+   A K ++   +KN     +
Sbjct: 335 LTEEKLREDLKEYGEIDSIKIIPE-----KDIAFVHFSSIATAIKVVSTLAQKNPFYQEK 389

Query: 387 QIVAGKPLYVAIAQRKEVRRSQ-LAQQIQARNQMRY 421
           +I  GK     I + ++   +Q L  Q +  + MRY
Sbjct: 390 KIFYGKDRCAFITKTQQHNAAQFLGVQPEMEHLMRY 425

>Scas_677.9
          Length = 626

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 223 VYVKNIDPETKQDEFEKLF-SQYGAITSAVLETDNEGKLRG-FGFVNFEDHNAAAKAVEE 280
           +YV N+ P+  + E  +LF SQ G    +    +  G   G   FV FED + A +A+ E
Sbjct: 518 LYVGNLPPDATEQELRQLFSSQEGFRRLSFRNKNTNGHGHGPMCFVEFEDISFATRALAE 577

Query: 281 L 281
           L
Sbjct: 578 L 578

>Scas_537.5
          Length = 570

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 28/115 (24%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLET---DNEGKLRG---------- 262
           +Y+ N+  +T Q E E  F+Q+GA         + + ET   ++   L G          
Sbjct: 220 LYMNNLPSDTTQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCV 279

Query: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQE--LKKQYESSRM 315
            GFV F+ H  A +A+        NG+ +    A  K  R+ E  ++ Q  S+R+
Sbjct: 280 AGFVVFQSHEEATEALV------LNGRSILSNIANTKQPRVVEHIVEIQPSSTRV 328

>CAGL0I05082g complement(473462..475276) some similarities with
           sp|P34217 Saccharomyces cerevisiae YBL051c, hypothetical
           start
          Length = 604

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 258 GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
           G  RG  F N+      AK V ELN+ +  G+ L V
Sbjct: 104 GTFRGLAFANYNSEVDTAKVVNELNEKEVGGRNLRV 139

>Scas_500.6
          Length = 621

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 12/120 (10%)

Query: 185 IDAINGMLLNGLE---VYVAPHVSKKDRQ---SKLDEVKSNF----TNVYVKNIDPETKQ 234
           ID+ N  L N LE      +P +   D Q   S LD+V+ +     T + +KNI    K+
Sbjct: 8   IDSTNESLRN-LEPEMTINSPELGIADEQHDASNLDDVEIDEDIIPTAIVIKNIPFAIKR 66

Query: 235 DEFEKLFSQYGA-ITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
           ++   + ++    +  A     + G  RG  F NF   +   + +E LN  +  G+KL V
Sbjct: 67  EQLLDIMAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDETTRVIECLNGKEIGGRKLRV 126

>CAGL0J07546g complement(731562..733931) similar to sp|P13134
           Saccharomyces cerevisiae YNL238w KEX2 endoproteinase of
           late golgi compartment, hypothetical start
          Length = 789

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 4/108 (3%)

Query: 262 GFGFVNFEDHNAAAKAVEELN-DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAK 320
           G+G +N  +  A AK  E +N   +F      V     K ++  E   +  +S +EK AK
Sbjct: 448 GYGKLNAHNIVALAKDWENVNPQVEFATDIKEVNEETDKEDKPIESTIEITASDLEK-AK 506

Query: 321 YQGVNLFVKNLDDSIDDEKLQ--EEFAPFGTITSVKVMRDDAGSSKGF 366
           ++ V     N+D S ++      +  +PFG ++ + V+R    S++GF
Sbjct: 507 FRSVEHVTINVDISTENRGTTTIDLISPFGVVSHLGVVRRKDDSNEGF 554

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%)

Query: 59  LFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQ 117
           L SP  +V  + V R+  T  S G AYV F       TA+  L+         ++ WS+
Sbjct: 208 LLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQVDWSK 266

>Sklu_2412.4 YMR124W, Contig c2412 7729-10719
          Length = 996

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 433 GMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMN-GMPKN-GVPPQQFGRPNGPMYGVPP 490
           G P +F QP   G  PPR + F    P+ M+  N G P N  +PPQQ   PN     VPP
Sbjct: 273 GPPQRFRQPP-QGGYPPRPMGFGQEGPRAMSLTNSGRPLNMAMPPQQ-PYPNANYGPVPP 330

Query: 491 Q 491
           Q
Sbjct: 331 Q 331

>Kwal_33.14810
          Length = 574

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYG-AITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
           T + +KNI    K+++   + ++    +  A     + G  RG  F NF   +   + V 
Sbjct: 31  TAIVIKNIPFAIKKEQLLDVIAKMNLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVH 90

Query: 280 ELNDTDFNGQKLYV 293
            LN  +  G+KL V
Sbjct: 91  MLNGKEIGGRKLRV 104

>KLLA0D12364g complement(1051765..1053660) some similarities with
           sp|P32770 Saccharomyces cerevisiae YDL167c ARP1
           singleton, hypothetical start
          Length = 631

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYGA 246
           T +Y+ N+ P+T Q E E  F+Q+G+
Sbjct: 236 TVLYMNNLPPDTTQSELESWFAQFGS 261

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 11/50 (22%)

Query: 433 GMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNGVPPQQFGRPN 482
           G P  FMQP  Y   P        P+P  MA    MP   +PP   G P+
Sbjct: 142 GTPVSFMQPNIYSTTP-------VPSPASMA----MPNVVMPPNDMGSPD 180

>KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217
           Saccharomyces cerevisiae YBL051c singleton, hypothetical
           start
          Length = 592

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYG-AITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
           T + +KNI    K+++  ++ ++    +  A     + G  RG  F NF         V+
Sbjct: 37  TAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETTTVVQ 96

Query: 280 ELNDTDFNGQKLYV 293
            LN  +  G+KL V
Sbjct: 97  SLNGKEIGGRKLRV 110

>AFL061C [3132] [Homologous to ScYPL184C - SH] (317447..319018)
           [1572 bp, 523 aa]
          Length = 523

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 332 DDSIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381
           ++ I +EKL+ + + FG + +VK++ +     KG  FV FS+   A K +
Sbjct: 217 EEVITEEKLRNDLSDFGEVENVKIVPE-----KGIAFVHFSSIFAAIKVV 261

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 205 SKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGF 263
           +K+D+ S L  +      +Y+  +    K+ E  K FSQ+G +    L  + + G  R +
Sbjct: 173 AKEDKSSDLSGI------LYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHY 226

Query: 264 GFVNFEDHNAAAKAVEELNDTDFNGQKLYV 293
            F+ + + + A  A E +N+    G  L V
Sbjct: 227 AFLEYINKDDAVVAQESMNNYLLMGHLLKV 256

>ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH]
           complement(771971..773707) [1737 bp, 578 aa]
          Length = 578

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 221 TNVYVKNIDPETKQDEFEKLFSQYG-AITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVE 279
           T + +KNI    K+++  ++ ++    +  A     + G  RG  F NF       + V+
Sbjct: 49  TAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETMQVVQ 108

Query: 280 ELNDTDFNGQKLYV 293
            LN  +  G++L V
Sbjct: 109 HLNGKEIGGRRLRV 122

>Scas_589.4
          Length = 530

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 16/120 (13%)

Query: 193 LNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVL 252
           LN     +A  V+K+D   ++      F      N+D     ++  K F  +G     V 
Sbjct: 9   LNWTMSSIADTVNKEDSTVRV------FVGNLQNNLDASL--EDLYKRFGTFGQCVDPVF 60

Query: 253 ETDNEGKLRGFGFVN--FEDHNAAAKAVEE-LNDTDFNGQKLYVGRAQKKYERLQELKKQ 309
           E  N     GF ++N  FED  A  K ++  LN+  F G  L + +A+  ++   +L+++
Sbjct: 61  EKHN-----GFAYINMTFEDGLAGFKKLKNSLNNVKFKGNLLVIDQAKPDWQESWKLRQE 115

>KLLA0B08976g complement(786122..787039) weakly similar to sp|P32605
           Saccharomyces cerevisiae YBR119w MUD1 U1 snRNP-specific
           A protein singleton, start by similarity
          Length = 305

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEEL- 281
           + V+N+  +  Q E EKLF   G     ++       +R   FV ++    A K VE L 
Sbjct: 235 LLVQNLPKDVTQQELEKLFVSDGFKEVRLVS------VRNLCFVEYDSTANATKVVETLG 288

Query: 282 NDTDFNGQKLYVGRAQK 298
           +D  F    + +G A+K
Sbjct: 289 HDHPFKNVTIKIGYAKK 305

>KLLA0E01936g 183638..185092 similar to sp|Q08287 Saccharomyces
           cerevisiae YOL144w NOP8 nucleolar protein required for
           60S ribosome biogenesis singleton, start by similarity
          Length = 484

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 48/116 (41%), Gaps = 14/116 (12%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVN--FEDHNAAAKAVEE 280
           VYV ++    + D F +L++++      V E+ +  +   FG++N  FED +   K    
Sbjct: 6   VYVGSV-TSNQDDCFAELYARFLKFGKVVDESKSFEQHDAFGYLNMEFEDASQFEKMKSS 64

Query: 281 LNDTDFNGQKLYVGRAQ-----------KKYERLQELKKQYESSRMEKLAKYQGVN 325
            N   F G  L V  A+           K  ER  + +KQ      E   K + +N
Sbjct: 65  FNRVKFKGNTLRVAEAKPDWKTRWEIDHKDEEREHKKRKQMAKQEWEHYKKLENIN 120

>CAGL0I03344g complement(285637..287448) similar to sp|P32770
           Saccharomyces cerevisiae YDL167c ARP1, start by
           similarity
          Length = 603

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 47/117 (40%), Gaps = 25/117 (21%)

Query: 223 VYVKNIDPETKQDEFEKLFSQYGAIT------------SAVLETDNEGKLRG-----FGF 265
           +Y+ NI  E  Q + E  F Q G  +            + +    N GK+       FGF
Sbjct: 229 LYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHGKMLSIPDSMFGF 288

Query: 266 VNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ 322
             F+ HN A  A+  L+ T     K+   +  K  E+L ++    + S M  L K Q
Sbjct: 289 AIFQSHNDAEYAL-NLHGTVM---KIVAPKGNKHIEQLLDI----QPSSMRLLEKVQ 337

>YGR178C (PBP1) [2130] chr7 complement(851050..853218) Protein that
           interacts with Poly(A)-binding protein Pab1p [2169 bp,
           722 aa]
          Length = 722

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 34/84 (40%), Gaps = 15/84 (17%)

Query: 433 GMPGQFM----QPMFYGVMPPRGVPFNGPNPQQMAAMNGMPK---------NGVPPQQFG 479
           G  G +M    QPMFY    P+ +P  G N  +    N  P           G P   FG
Sbjct: 612 GSMGMYMPFQPQPMFYHPSMPQMMPVMGSNGAEEGGGNISPHVPAGFMAAGPGAPMGAFG 671

Query: 480 RPNG-PMYGVPPQGPQGAFPRNGN 502
            P G P  G+   GP G  P NG+
Sbjct: 672 YPGGIPFQGMMGSGPSG-MPANGS 694

>Kwal_23.5204
          Length = 294

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 22/52 (42%)

Query: 157 CKIATDETGKSRKFGFVHFXXXXXXXXXIDAINGMLLNGLEVYVAPHVSKKD 208
           CK+ TDE G  +    V +         ID +NG    G E+ V     KKD
Sbjct: 85  CKLYTDEQGSFKGSALVVYMRRESVDLAIDLMNGYRFLGNELKVEEATFKKD 136

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,018,104
Number of extensions: 857581
Number of successful extensions: 4630
Number of sequences better than 10.0: 300
Number of HSP's gapped: 4150
Number of HSP's successfully gapped: 728
Length of query: 579
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 472
Effective length of database: 12,891,983
Effective search space: 6085015976
Effective search space used: 6085015976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 64 (29.3 bits)