Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.234821491487881e-109
KLLA0C17622g1591396988e-96
Sklu_1838.21631416928e-95
YDR092W (UBC13)1531396882e-94
Scas_636.15*1531396683e-91
CAGL0G08063g1491396526e-89
AGR121C1541396258e-85
YDR059C (UBC5)1481453383e-41
CAGL0E04752g1471463351e-40
YBR082C (UBC4)1481453342e-40
Scas_635.14*1481453314e-40
KLLA0E12595g1481393314e-40
AER173C1471393314e-40
Kwal_27.124012361313315e-39
YDR177W (UBC1)2151412983e-34
Sklu_1817.22151412871e-32
CAGL0E00671g2131412861e-32
ADR169C2111412834e-32
Scas_682.102141412834e-32
Kwal_23.64852151222792e-31
KLLA0C18656g2281222671e-29
CAGL0I00352g1671332588e-29
YOR339C (UBC11)1561222561e-28
Scas_563.81711332562e-28
Kwal_14.18281521252515e-28
AAR156C1701332527e-28
KLLA0C05632g1641332517e-28
YGL058W (RAD6)1721332518e-28
KLLA0A11198g2021222503e-27
Sklu_2299.51541252455e-27
Kwal_34.161742131212488e-27
AEL045W2111222461e-26
CAGL0M03399g2141222461e-26
Sklu_2410.41611252386e-26
YEL012W (UBC8)2181212427e-26
Scas_694.332311202374e-25
Kwal_26.70091611222282e-24
Scas_621.41931112284e-24
AER056C1571562151e-22
Kwal_23.42271221212095e-22
CAGL0M07568g1651212125e-22
YMR022W (QRI8)1651212117e-22
ABR059W1651212101e-21
KLLA0E04983g1571312091e-21
CAGL0D00814g1571482082e-21
KLLA0C17248g184912102e-21
Scas_709.491651472048e-21
Kwal_26.82241651212049e-21
CAGL0D06468g187862014e-20
YLR306W (UBC12)188902014e-20
Sklu_2411.72331372011e-19
ADL035C2001031972e-19
KLLA0E07711g1651211943e-19
YDL064W (UBC9)1571321908e-19
Kwal_27.104442781041961e-18
KLLA0D09196g2921111952e-18
YDR054C (CDC34)2951021934e-18
Sklu_1826.31611021855e-18
CAGL0E04598g2951021908e-18
Scas_635.182731021872e-17
AGL203C2701021853e-17
Sklu_2136.52721021854e-17
Kwal_55.212461601011777e-17
Scas_712.591711101752e-16
Scas_718.342581021713e-15
CAGL0I10450g1621111664e-15
AFR314W1551401612e-14
KLLA0E20493g2511161616e-14
YGR133W (PEX4)1831171552e-13
AGR372W2421141502e-12
YER100W (UBC6)2501101477e-12
Kwal_27.108372461121468e-12
Scas_599.162241101432e-11
CAGL0I05478g2461101432e-11
Sklu_2425.62511101399e-11
KLLA0E03916g1581051341e-10
Scas_609.72401161336e-10
Kwal_27.11182101871153e-08
Scas_551.9153911158e-08
KLLA0E19217g139821033e-06
CAGL0H03157g139811016e-06
YGL087C (MMS2)137801008e-06
Scas_720.10*13481991e-05
AFL064W13887946e-05
Scas_701.1212859630.92
Sklu_2369.8101575622.7
Scas_462.1814106603.9
Scas_558.4d76247604.8
Scas_534.1131147604.9
Scas_535.1119747605.0
Scas_553.199347595.4
Scas_698.11557109595.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23482
         (148 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23482                                                         308   e-109
KLLA0C17622g join(1555873..1555902,1556004..1556453) highly simi...   273   8e-96
Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement        271   8e-95
YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599) Ubiqu...   269   2e-94
Scas_636.15*                                                          261   3e-91
CAGL0G08063g 761662..762111 highly similar to sp|P52490 Saccharo...   255   6e-89
AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH] (977487..9...   245   8e-85
YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..5697...   134   3e-41
CAGL0E04752g complement(455965..456408) highly similar to sp|P15...   133   1e-40
YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..4071...   133   2e-40
Scas_635.14*                                                          132   4e-40
KLLA0E12595g join(1117022..1117068,1117342..1117741) highly simi...   132   4e-40
AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C (...   132   4e-40
Kwal_27.12401                                                         132   5e-39
YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugatin...   119   3e-34
Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement         115   1e-32
CAGL0E00671g complement(61460..62101) highly similar to sp|P2173...   114   1e-32
ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH] (1000736.....   113   4e-32
Scas_682.10                                                           113   4e-32
Kwal_23.6485                                                          112   2e-31
KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces...   107   1e-29
CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomy...   103   8e-29
YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein ...   103   1e-28
Scas_563.8                                                            103   2e-28
Kwal_14.1828                                                          101   5e-28
AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH] (626372..626...   101   7e-28
KLLA0C05632g complement(503484..503978) highly similar to sp|P06...   101   7e-28
YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugatin...   101   8e-28
KLLA0A11198g join(complement(974525..974529),complement(973755.....   100   3e-27
Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement       99   5e-27
Kwal_34.16174                                                         100   8e-27
AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH] complement(...    99   1e-26
CAGL0M03399g complement(389650..390294) highly similar to sp|P28...    99   1e-26
Sklu_2410.4 YOR339C, Contig c2410 15549-16034                          96   6e-26
YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551) Ubiqu...    98   7e-26
Scas_694.33                                                            96   4e-25
Kwal_26.7009                                                           92   2e-24
Scas_621.4                                                             92   4e-24
AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH] (741224..74...    87   1e-22
Kwal_23.4227                                                           85   5e-22
CAGL0M07568g complement(758110..758607) highly similar to sp|Q02...    86   5e-22
YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugati...    86   7e-22
ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH] complement(5...    86   1e-21
KLLA0E04983g 443446..443919 highly similar to sp|P50623 Saccharo...    85   1e-21
CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomy...    85   2e-21
KLLA0C17248g complement(1509885..1510439) similar to sp|P52491 S...    86   2e-21
Scas_709.49                                                            83   8e-21
Kwal_26.8224                                                           83   9e-21
CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces c...    82   4e-20
YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853) Rub...    82   4e-20
Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement       82   1e-19
ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH] (634059..6...    80   2e-19
KLLA0E07711g complement(693694..694191) highly similar to sp|Q02...    79   3e-19
YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070) Smt3p-...    78   8e-19
Kwal_27.10444                                                          80   1e-18
KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces c...    80   2e-18
YDR054C (CDC34) [905] chr4 complement(561436..562323) Ubiquitin-...    79   4e-18
Sklu_1826.3 YGR133W, Contig c1826 3548-4033                            76   5e-18
CAGL0E04598g complement(444288..445175) highly similar to sp|P14...    78   8e-18
Scas_635.18                                                            77   2e-17
AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH] (317749..3...    76   3e-17
Sklu_2136.5 YDR054C, Contig c2136 7737-8555                            76   4e-17
Kwal_55.21246                                                          73   7e-17
Scas_712.59                                                            72   2e-16
Scas_718.34                                                            70   3e-15
CAGL0I10450g complement(1024541..1025029) similar to sp|P29340 S...    69   4e-15
AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH] complement(...    67   2e-14
KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces...    67   6e-14
YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugatin...    64   2e-13
AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH] complement(...    62   2e-12
YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugatin...    61   7e-12
Kwal_27.10837                                                          61   8e-12
Scas_599.16                                                            60   2e-11
CAGL0I05478g complement(518933..519673) highly similar to sp|P33...    60   2e-11
Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement         58   9e-11
KLLA0E03916g complement(365119..365595) similar to sp|P29340 Sac...    56   1e-10
Scas_609.7                                                             56   6e-10
Kwal_27.11182                                                          49   3e-08
Scas_551.9                                                             49   8e-08
KLLA0E19217g join(complement(1703226..1703236), highly similar t...    44   3e-06
CAGL0H03157g join(complement(297881..297891),complement(297272.....    44   6e-06
YGL087C (MMS2) [1895] chr7 complement(346407..346809,346895..346...    43   8e-06
Scas_720.10*                                                           43   1e-05
AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH] complement(...    41   6e-05
Scas_701.12                                                            29   0.92 
Sklu_2369.8 YER075C, Contig c2369 9770-12817 reverse complement        28   2.7  
Scas_462.1                                                             28   3.9  
Scas_558.4d                                                            28   4.8  
Scas_534.1                                                             28   4.9  
Scas_535.1                                                             28   5.0  
Scas_553.1                                                             27   5.4  
Scas_698.1                                                             27   5.6  

>Kwal_56.23482
          Length = 149

 Score =  308 bits (788), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%)

Query: 1   MYINSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPD 60
           MYINSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPD
Sbjct: 1   MYINSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEDWIKNEDGAIAKAREWTQLYA 148
           LANDVAEDWIKNEDGAIAKAREWTQLYA
Sbjct: 121 LANDVAEDWIKNEDGAIAKAREWTQLYA 148

>KLLA0C17622g join(1555873..1555902,1556004..1556453) highly similar
           to sp|P52490 Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 159

 Score =  273 bits (698), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 130/139 (93%), Positives = 137/139 (98%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +ETERLVSDPVPGITAEPHE+NLRYFQVTIEGPQQSPYENGVF+LELFLPDDYPMEAPKV
Sbjct: 10  KETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           RFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLSVQALLASPNPNDPLANDVAE+W
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEW 129

Query: 130 IKNEDGAIAKAREWTQLYA 148
           IK+ED AIAKA+EWT+LYA
Sbjct: 130 IKHEDTAIAKAKEWTKLYA 148

>Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement
          Length = 163

 Score =  271 bits (692), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 128/141 (90%), Positives = 137/141 (97%)

Query: 8   SKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAP 67
           S QETERLVSDPVPGI+AEPH++NLRYFQVTIEGPQQSPYENGVF+LELFLP+DYPMEAP
Sbjct: 18  SLQETERLVSDPVPGISAEPHDDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAP 77

Query: 68  KVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           KVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLS+QALLASPNPNDPLANDVAE
Sbjct: 78  KVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 137

Query: 128 DWIKNEDGAIAKAREWTQLYA 148
           DWIKNE+GAIA A+EWT+ YA
Sbjct: 138 DWIKNEEGAIATAKEWTEKYA 158

>YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599)
           Ubiquitin-conjugating (E2) enzyme involved in
           Rad6-dependent post-replicative repair pathway, required
           for non-proteolytic multi-ubiquitination of Pol30p
           (PCNA) [462 bp, 153 aa]
          Length = 153

 Score =  269 bits (688), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 126/139 (90%), Positives = 137/139 (98%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +ETE+LVSDPVPGITAEPH++NLRYFQVTIEGP+QSPYE+G+F+LEL+LPDDYPMEAPKV
Sbjct: 10  KETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDPLANDVAEDW
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW 129

Query: 130 IKNEDGAIAKAREWTQLYA 148
           IKNE GA AKAREWT+LYA
Sbjct: 130 IKNEQGAKAKAREWTKLYA 148

>Scas_636.15*
          Length = 153

 Score =  261 bits (668), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (94%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +ETERL+SDPVPGITAEPHE+NLRYF VT+EGP  SPYENG+F+LEL+LPDDYPMEAPKV
Sbjct: 10  KETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE+W
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEW 129

Query: 130 IKNEDGAIAKAREWTQLYA 148
           I+NE GA A AREWTQ YA
Sbjct: 130 IQNEAGAKATAREWTQKYA 148

>CAGL0G08063g 761662..762111 highly similar to sp|P52490
           Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 149

 Score =  255 bits (652), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (92%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +ETERLVSDPVPGITAEPHE+NLRYF VTIEGP QSPYE G+FKLEL+LP+DYPMEAPKV
Sbjct: 10  KETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDPLANDVAEDW
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW 129

Query: 130 IKNEDGAIAKAREWTQLYA 148
           IK+E  A   A+EWT  YA
Sbjct: 130 IKDEAKAKQTAKEWTAQYA 148

>AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH]
           (977487..977921,977971..978000) [465 bp, 154 aa]
          Length = 154

 Score =  245 bits (625), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (94%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +ETERLVSDPVPGI+AEPHE+NLRYF V+IEGPQQSPYE+GVF+LELFLPD+YPME PKV
Sbjct: 10  KETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLA+PNPNDPLANDVA+DW
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLATPNPNDPLANDVAKDW 129

Query: 130 IKNEDGAIAKAREWTQLYA 148
           I +E  A AKAREWT LYA
Sbjct: 130 IADEAAATAKAREWTALYA 148

>YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..569766)
           Ubiquitin-conjugating enzyme that with Ubc4p is
           responsible for most of ubiquitin-dependent protein
           degradation of short-lived and abnormal proteins [447
           bp, 148 aa]
          Length = 148

 Score =  134 bits (338), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 91/145 (62%)

Query: 4   NSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           +S+   +E   L  DP    +A P  ++L ++Q +I GP  SPY  GVF L +  P DYP
Sbjct: 3   SSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYP 62

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
            + PKV F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL  
Sbjct: 63  FKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVP 122

Query: 124 DVAEDWIKNEDGAIAKAREWTQLYA 148
           ++A+ +  ++    A A+EWT+ YA
Sbjct: 123 EIAQIYKTDKAKYEATAKEWTKKYA 147

>CAGL0E04752g complement(455965..456408) highly similar to sp|P15731
           Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 147

 Score =  133 bits (335), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (61%)

Query: 3   INSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDY 62
           ++S+   +E   L  DP    +A P  ++L ++Q +I GP  SPY  GVF L +  P DY
Sbjct: 1   MSSKRIAKELSDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDY 60

Query: 63  PMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLA 122
           P + PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL 
Sbjct: 61  PFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLV 120

Query: 123 NDVAEDWIKNEDGAIAKAREWTQLYA 148
            ++A  +  +     A AREWT+ YA
Sbjct: 121 PEIAHIYKTDRAKYEATAREWTKKYA 146

>YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..407126)
           Ubiquitin-conjugating (E2) enzyme, together with Ubc5p
           is responsible for the majority of ubiquitin-dependent
           protein degradation of short-lived and abnormal proteins
           [447 bp, 148 aa]
          Length = 148

 Score =  133 bits (334), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 89/145 (61%)

Query: 4   NSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           +S+   +E   L  DP    +A P  ++L ++Q +I GP  SPY  GVF L +  P DYP
Sbjct: 3   SSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYP 62

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
            + PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL  
Sbjct: 63  FKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVP 122

Query: 124 DVAEDWIKNEDGAIAKAREWTQLYA 148
           ++A  +  +     A AREWT+ YA
Sbjct: 123 EIAHIYKTDRPKYEATAREWTKKYA 147

>Scas_635.14*
          Length = 148

 Score =  132 bits (331), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 89/145 (61%)

Query: 4   NSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           +S+   +E   +  DP    +A P  ++L ++Q +I GP  SPY  GVF L +  P DYP
Sbjct: 3   SSKRITKELSDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYP 62

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
            + PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL  
Sbjct: 63  FKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVP 122

Query: 124 DVAEDWIKNEDGAIAKAREWTQLYA 148
           ++A  +  +     A AREWT+ YA
Sbjct: 123 EIAHIYKTDRPKYEATAREWTKKYA 147

>KLLA0E12595g join(1117022..1117068,1117342..1117741) highly similar
           to sp|P15731 Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 148

 Score =  132 bits (331), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 86/139 (61%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +E   L  DP    +A P  +++ ++Q +I GP  SPY  GVF L +  P DYP + PK+
Sbjct: 9   KELNDLGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKI 68

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
            F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLS+ +LL   NP+DPL  ++A  +
Sbjct: 69  SFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLY 128

Query: 130 IKNEDGAIAKAREWTQLYA 148
             +     A AREWT+ YA
Sbjct: 129 KTDRAKYEATAREWTKKYA 147

>AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C
           (UBC5) - SH] (960420..960863) [444 bp, 147 aa]
          Length = 147

 Score =  132 bits (331), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 86/139 (61%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +E   L  DP    +A P  ++L ++Q +I GP  SPY  GVF L +  P DYP + PK+
Sbjct: 8   KELNDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKI 67

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
            F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLS+ +LL   NP+DPL  ++A  +
Sbjct: 68  SFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIY 127

Query: 130 IKNEDGAIAKAREWTQLYA 148
             +     A A+EWT+ YA
Sbjct: 128 KTDRAKYEATAKEWTKKYA 146

>Kwal_27.12401
          Length = 236

 Score =  132 bits (331), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 83/131 (63%)

Query: 18  DPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYH 77
           DP    +A P  ++L ++Q +I GP  SPY  GVF L +  P DYP + PK+ F TKIYH
Sbjct: 105 DPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYH 164

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
           PNI+  G ICLD+LK  WSPAL I  VLLS+ +LL   NP+DPL  ++A  +  +     
Sbjct: 165 PNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYE 224

Query: 138 AKAREWTQLYA 148
           A A+EWT+ YA
Sbjct: 225 ATAKEWTKKYA 235

>YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugating
           enzyme (E2) that plays a role early in spore
           germination, in degradation of mis-folded proteins in
           the ER, and degradation of Gal2p at the plasma membrane
           [648 bp, 215 aa]
          Length = 215

 Score =  119 bits (298), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 91/141 (64%), Gaps = 2/141 (1%)

Query: 10  QETERLVSDPVPGITAE-PHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E + +  DP   IT E   E ++ + + T  GP  +PYE G F +++ +P +YP + PK
Sbjct: 9   KEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPK 68

Query: 69  VRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           ++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP   +VA+
Sbjct: 69  MQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

Query: 128 DWIKNEDGAIAKAREWTQLYA 148
            ++++ +     A  WT+LYA
Sbjct: 129 HYLRDRESFNKTAALWTRLYA 149

>Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement
          Length = 215

 Score =  115 bits (287), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 89/141 (63%), Gaps = 2/141 (1%)

Query: 10  QETERLVSDPVPGITAE-PHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E +    DP   IT     E ++ + + +  GP  +PYE G F +++ +P +YP + PK
Sbjct: 9   KEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLEYPFKPPK 68

Query: 69  VRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           ++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP   +VA+
Sbjct: 69  MQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

Query: 128 DWIKNEDGAIAKAREWTQLYA 148
            +I+++      A  WT+LYA
Sbjct: 129 HFIRDKSSFDKTAALWTKLYA 149

>CAGL0E00671g complement(61460..62101) highly similar to sp|P21734
           Saccharomyces cerevisiae YDR177w E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 213

 Score =  114 bits (286), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 90/141 (63%), Gaps = 2/141 (1%)

Query: 10  QETERLVSDPVPGITAE-PHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E + +  DP   I+ E   E ++ + + +  GP  +PYE G F +++ +P +YP + PK
Sbjct: 9   KELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPMEYPFKPPK 68

Query: 69  VRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           ++F +K+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP   +VA+
Sbjct: 69  MKFDSKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

Query: 128 DWIKNEDGAIAKAREWTQLYA 148
            ++++       A  WT+LYA
Sbjct: 129 HYLRDRQSFDKTAALWTKLYA 149

>ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH]
           (1000736..1001371) [636 bp, 211 aa]
          Length = 211

 Score =  113 bits (283), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 88/141 (62%), Gaps = 2/141 (1%)

Query: 10  QETERLVSDPVPGIT-AEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E + +  DP   I+ A   E ++ + + T  GP  +PY  G F +++ +P +YP + PK
Sbjct: 9   KEIQSVKDDPDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPFKPPK 68

Query: 69  VRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           ++F TK+YHPNI  + G ICLD+LK +WSP L ++T L+S+QALL SP PNDP   +VA+
Sbjct: 69  MQFDTKVYHPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVAK 128

Query: 128 DWIKNEDGAIAKAREWTQLYA 148
            ++ +       A  WT+ YA
Sbjct: 129 HYLSDRASFDRTAALWTKTYA 149

>Scas_682.10
          Length = 214

 Score =  113 bits (283), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 90/141 (63%), Gaps = 2/141 (1%)

Query: 10  QETERLVSDPVPGITAE-PHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E + +  DP   I  E  +E ++ + + +  GP  +PYE G F +++ +P +YP + P 
Sbjct: 9   KELQAVKDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPFKPPM 68

Query: 69  VRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           ++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP   +VA+
Sbjct: 69  MKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

Query: 128 DWIKNEDGAIAKAREWTQLYA 148
            ++K+ +     A  WT+LYA
Sbjct: 129 HYLKDRESFNKTAALWTKLYA 149

>Kwal_23.6485
          Length = 215

 Score =  112 bits (279), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 82/122 (67%), Gaps = 1/122 (0%)

Query: 28  HEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRL-GRI 86
           +E ++   + +  GP  +PYENG + +++ +P +YP + PK++F TK+YHPN+  + G I
Sbjct: 28  NENDIHLLKGSFLGPPGTPYENGKYIVDIEVPMEYPFKPPKMKFQTKVYHPNVSSVTGAI 87

Query: 87  CLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQL 146
           CLD+LK  WSP + +++ L+S+QALL SP PNDP   +VA+ +I+++      A  WT+ 
Sbjct: 88  CLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYIRDKASFDKTAAFWTKT 147

Query: 147 YA 148
           YA
Sbjct: 148 YA 149

>KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces
           cerevisiae YDR177w UBC1 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 228

 Score =  107 bits (267), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 80/122 (65%), Gaps = 1/122 (0%)

Query: 28  HEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRL-GRI 86
           +E ++ + + +  GP  +PYE G F +++ +P +YP + P+++F TK+YHPN+  + G I
Sbjct: 28  NESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPYKPPQMKFDTKVYHPNVSSVTGAI 87

Query: 87  CLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQL 146
           CLD+LK  W+P + +++ L+S+QALL SP PNDP    VA+ ++ ++      A  WT+ 
Sbjct: 88  CLDILKNAWTPVITLKSALISLQALLQSPEPNDPQDAQVAKHYLTDKKSFDETAALWTRT 147

Query: 147 YA 148
           YA
Sbjct: 148 YA 149

>CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomyces
           cerevisiae YGL058w RAD6 E2 ubiquitin-conjugating, start
           by similarity
          Length = 167

 Score =  103 bits (258), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 80/133 (60%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           ++ +R+  D  PG++A P  +N+  +   I GP  +PYE+G F+L L   +DYP + P V
Sbjct: 11  RDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHV 70

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           +FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P   + A  +
Sbjct: 71  KFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

Query: 130 IKNEDGAIAKARE 142
             ++   I + +E
Sbjct: 131 KDHKSQYIKRVKE 143

>YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein
           with similarity to ubiquitin-conjugating enzymes [471
           bp, 156 aa]
          Length = 156

 Score =  103 bits (256), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 73/122 (59%), Gaps = 1/122 (0%)

Query: 9   KQETERLVSDPVPGITAEPHEEN-LRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAP 67
           + E  +L+S     I+A P ++N L Y+   I GP+ +PY    FK+ L  P +YP   P
Sbjct: 14  QNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPP 73

Query: 68  KVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
            ++FL+ ++HPN+D+ G ICLD+LK  WS    + T+LLS+Q+LL  PN   PL    AE
Sbjct: 74  MIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAE 133

Query: 128 DW 129
            W
Sbjct: 134 LW 135

>Scas_563.8
          Length = 171

 Score =  103 bits (256), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 81/133 (60%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           ++ +R+  D  PG++A P  +N+  +   I GP ++PYE+G F+L L   ++YP + P V
Sbjct: 11  RDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHV 70

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           +FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P   + A  +
Sbjct: 71  KFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

Query: 130 IKNEDGAIAKARE 142
             ++   I + +E
Sbjct: 131 KDHKSQYIKRVKE 143

>Kwal_14.1828
          Length = 152

 Score =  101 bits (251), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 76/125 (60%)

Query: 18  DPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  +N+  +   I GP ++PYE+G F+L L   ++YP + P V+FL++I+H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
           PN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P   + A  +  ++   I
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYI 123

Query: 138 AKARE 142
            + +E
Sbjct: 124 KRVKE 128

>AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH]
           (626372..626884) [513 bp, 170 aa]
          Length = 170

 Score =  101 bits (252), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 80/133 (60%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           ++ +R+  D  PG++A P  +N+  +   I GP  +PYE+G F+L L   ++YP + P V
Sbjct: 11  RDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHV 70

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           +FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P   + A  +
Sbjct: 71  KFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

Query: 130 IKNEDGAIAKARE 142
             ++   + + +E
Sbjct: 131 KDHKSQYVKRVKE 143

>KLLA0C05632g complement(503484..503978) highly similar to sp|P06104
           Saccharomyces cerevisiae YGL058w RAD6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 164

 Score =  101 bits (251), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 80/133 (60%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           ++ +R+  D  PG++A P  +N+  +   I GP  +PYE+G F+L L   ++YP + P V
Sbjct: 11  RDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHV 70

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           +FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P   + A  +
Sbjct: 71  KFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

Query: 130 IKNEDGAIAKARE 142
             ++   + + +E
Sbjct: 131 QDHKSQYVKRVKE 143

>YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugating
           (E2) enzyme involved in error-prone and error-free
           DNA-damage recovery pathways, in the N-end rule protein
           degradation pathway, mediates methylation of histone H3
           lysines 4 and 79 by ubiquitination of histone H2B [519
           bp, 172 aa]
          Length = 172

 Score =  101 bits (251), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 80/133 (60%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           ++ +R+  D  PG++A P  +N+  +   I GP  +PYE+G F+L L   ++YP + P V
Sbjct: 11  RDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHV 70

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129
           +FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P   + A  +
Sbjct: 71  KFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

Query: 130 IKNEDGAIAKARE 142
             ++   + + +E
Sbjct: 131 KDHKSQYVKRVKE 143

>KLLA0A11198g
           join(complement(974525..974529),
           complement(973755..974358)) similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 202

 Score =  100 bits (250), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 75/122 (61%), Gaps = 2/122 (1%)

Query: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRL-GRIC 87
           E+ ++ F +   GP+ +PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQL 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   +K++D    K  E+   
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINK 146

Query: 147 YA 148
           YA
Sbjct: 147 YA 148

>Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement
          Length = 154

 Score = 99.0 bits (245), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 75/125 (60%)

Query: 18  DPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  +N+  +   I GP  +PYE+G F+L L   ++YP + P V+FL++++H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
           PN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P   + A  +  ++   +
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYV 123

Query: 138 AKARE 142
            + +E
Sbjct: 124 KRVKE 128

>Kwal_34.16174
          Length = 213

 Score =  100 bits (248), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 77/121 (63%), Gaps = 2/121 (1%)

Query: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRL-GRICL 88
           +N++ F V   GP+++PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G ICL
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICL 74

Query: 89  DVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQLY 147
           DV+ + WSP   +  +L   +  LL  PN +DPL N+ A   +K+++    K RE+   +
Sbjct: 75  DVINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELYERKIREFIDQF 134

Query: 148 A 148
           A
Sbjct: 135 A 135

>AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH]
           complement(549376..549380,549444..550074) [636 bp, 211
           aa]
          Length = 211

 Score = 99.4 bits (246), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 2/122 (1%)

Query: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRL-GRIC 87
           ++N++ F V   GP+ +PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 85

Query: 88  LDVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQL 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   +KN      K +E+   
Sbjct: 86  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYIDK 145

Query: 147 YA 148
           YA
Sbjct: 146 YA 147

>CAGL0M03399g complement(389650..390294) highly similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, hypothetical start
          Length = 214

 Score = 99.4 bits (246), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 76/122 (62%), Gaps = 2/122 (1%)

Query: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRIC 87
           E++++ F V   GP+ +PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQL 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   +K++     K RE+   
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDK 146

Query: 147 YA 148
           YA
Sbjct: 147 YA 148

>Sklu_2410.4 YOR339C, Contig c2410 15549-16034
          Length = 161

 Score = 96.3 bits (238), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 78/125 (62%), Gaps = 1/125 (0%)

Query: 9   KQETERLVSDPVPGITAEP-HEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAP 67
           + E  +L+  P PG++A P +E++L  +   I GP  +PYE   FK+ L  P  YP  AP
Sbjct: 20  QSELVQLMMSPSPGLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAP 79

Query: 68  KVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           +V F++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL    AE
Sbjct: 80  RVTFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAE 139

Query: 128 DWIKN 132
            W KN
Sbjct: 140 LWDKN 144

>YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551)
           Ubiquitin-conjugating enzyme involved in the catabolite
           degradation of fructose-1,6-bisphosphate [657 bp, 218
           aa]
          Length = 218

 Score = 97.8 bits (242), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 75/121 (61%), Gaps = 2/121 (1%)

Query: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICL 88
           ++++ F V   GP+ +PYENGV++L + LPD+YP ++P + F+ KI+HPNID   G ICL
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICL 86

Query: 89  DVLKTNWSPALQ-IRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQLY 147
           DV+ + WSP    I  V   +  LL  PN +DPL N+ A   ++++     K +E+   Y
Sbjct: 87  DVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKY 146

Query: 148 A 148
           A
Sbjct: 147 A 147

>Scas_694.33
          Length = 231

 Score = 95.9 bits (237), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLD 89
           +++ F +   GP+ +PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G ICLD
Sbjct: 51  SMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLD 110

Query: 90  VLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQLYA 148
           V+ + WSP   +  ++   +  LL  PN +DPL N+ A   ++++     K RE+   YA
Sbjct: 111 VINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYEEKIREYIDKYA 170

>Kwal_26.7009
          Length = 161

 Score = 92.4 bits (228), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 75/122 (61%), Gaps = 1/122 (0%)

Query: 9   KQETERLVSDPVPGITAEPH-EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAP 67
           + E  +L+  P PG++A P  E++L  +   I GP  +PYE   FK+ L     YP  AP
Sbjct: 20  QSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAP 79

Query: 68  KVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           KVRF++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL    AE
Sbjct: 80  KVRFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAE 139

Query: 128 DW 129
            W
Sbjct: 140 LW 141

>Scas_621.4
          Length = 193

 Score = 92.4 bits (228), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 66/111 (59%)

Query: 38  TIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSP 97
            I  P +  Y+NG F+  L   D+YPME PKV    +IYHPNID  G++CL++L+ +WSP
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIYHPNIDVQGKVCLNILREDWSP 132

Query: 98  ALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQLYA 148
           AL ++++++ +  L   PN  DPL  D A  + K+ +      R+  + Y+
Sbjct: 133 ALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFVRKTMEGYS 183

>AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH]
           (741224..741659,741718..741755) [474 bp, 157 aa]
          Length = 157

 Score = 87.4 bits (215), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 83/156 (53%), Gaps = 10/156 (6%)

Query: 3   INSRCSK---QETERLVSDPVPGITAEPHEE-----NLRYFQVTIEGPQQSPYENGVFKL 54
           +NS C +   +E ++   D   G  A+P ++     NL+ ++  I G + + +++GV+ +
Sbjct: 1   MNSLCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPI 60

Query: 55  ELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALL 112
            +  PDDYP + P+V+F    YHPNI   G +CL +L    +W PA+ ++ +LL VQ LL
Sbjct: 61  TIEYPDDYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWKPAITMKQILLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEDWIKNEDGAIAKAREWTQLYA 148
            SPNPN P        + KN      K  E  + YA
Sbjct: 121 TSPNPNSPAQEPAWRAYAKNLQEYEKKVLEQARRYA 156

>Kwal_23.4227
          Length = 122

 Score = 85.1 bits (209), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 69/121 (57%), Gaps = 6/121 (4%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDV 90
           NL+ ++  I G + + ++ GVF + +  PDDYP + PKV+F    YHPNI   G +CL +
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFYHPNIYPSGTVCLSI 61

Query: 91  LK--TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN----EDGAIAKAREWT 144
           L    +W PA+ ++ + L VQ LL SPNPN P        + KN    E   I +A+++T
Sbjct: 62  LNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKVIEQAKKYT 121

Query: 145 Q 145
           +
Sbjct: 122 K 122

>CAGL0M07568g complement(758110..758607) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 86.3 bits (212), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (53%), Gaps = 14/121 (11%)

Query: 10  QETERLVSDPVPGITAEPH-EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E ++L+ D  PGI A P  ++NL  +   I+GP  +PY  GVF  +L  P DYP+  PK
Sbjct: 11  KELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPK 70

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115
           + F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++L+ P
Sbjct: 71  LTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEP 130

Query: 116 N 116
           N
Sbjct: 131 N 131

>YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugating
           enzyme, associates with Ubc6p on the cytoplasmic side of
           endoplasmic reticulum [498 bp, 165 aa]
          Length = 165

 Score = 85.9 bits (211), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (53%), Gaps = 14/121 (11%)

Query: 10  QETERLVSDPVPGITAEPHEEN-LRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E ++L+ D  PGI A P  EN +  +   I+GP  +PY +GVF  +L  P DYP+  PK
Sbjct: 11  KELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPK 70

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115
           + F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++L+ P
Sbjct: 71  LTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEP 130

Query: 116 N 116
           N
Sbjct: 131 N 131

>ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH]
           complement(503223..503720) [498 bp, 165 aa]
          Length = 165

 Score = 85.5 bits (210), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 10  QETERLVSDPVPGITAEP-HEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E ++L+ D   GI A P  E+NL  +   IEGP  SPYE GVF   L  P DYP+  PK
Sbjct: 11  KELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPPK 70

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115
           + F   I HPN+   G +C+ +L                WSP   +  +LLSV ++L+ P
Sbjct: 71  LTFTPSILHPNVYPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEP 130

Query: 116 N 116
           N
Sbjct: 131 N 131

>KLLA0E04983g 443446..443919 highly similar to sp|P50623
           Saccharomyces cerevisiae YDL064w UBC9 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 157

 Score = 85.1 bits (209), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 73/131 (55%), Gaps = 7/131 (5%)

Query: 9   KQETERLVSDPVPGITAEPHEE-----NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           ++E ++   D   G  A+P ++     NL+ ++  I G   + ++NG++ L +  PDDYP
Sbjct: 10  QEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYP 69

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALLASPNPNDPL 121
            + PKV+F    YHPN+   G ICL +L    +W PA+ ++ +LL VQ LL SPNPN P 
Sbjct: 70  SKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSPA 129

Query: 122 ANDVAEDWIKN 132
                  + KN
Sbjct: 130 QEPAWRAFSKN 140

>CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomyces
           cerevisiae YDL064w UBC9 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 157

 Score = 84.7 bits (208), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 82/148 (55%), Gaps = 11/148 (7%)

Query: 9   KQETERLVSDPVPGITAEPHEE-----NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           ++E ++   D   G  A+P +      NL+ ++  I G + + +++GVF + +  PD+YP
Sbjct: 10  QEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYP 69

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALLASPNPNDPL 121
            + PKV+F    YHPNI   G +CL +L    +W PA+ ++ ++L VQ LL SPNPN P 
Sbjct: 70  SKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPA 129

Query: 122 ANDVAEDWIKN----EDGAIAKAREWTQ 145
                  + KN    E   + +A+++T+
Sbjct: 130 QEPAWRAFSKNKAEYEKKVLIQAKQYTK 157

>KLLA0C17248g complement(1509885..1510439) similar to sp|P52491
           Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 184

 Score = 85.5 bits (210), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 57/91 (62%)

Query: 42  PQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101
           P    Y  G +   +F+ D YPME P V+ + +IYHPNID  G +CL++L+ +W+PAL I
Sbjct: 67  PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDI 126

Query: 102 RTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
           +++++ +  L   PN  DPL  D A+  I++
Sbjct: 127 QSIIIGILFLFHEPNGRDPLNKDAAKTLIED 157

>Scas_709.49
          Length = 165

 Score = 83.2 bits (204), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 70/147 (47%), Gaps = 14/147 (9%)

Query: 10  QETERLVSDPVPGITAEP-HEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E ++L  D  PGI A P +E NL  +   ++GP  + YE G+F   L  P DYP+  PK
Sbjct: 11  KELQQLTKDSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPK 70

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115
           + F   I HPNI   G +C+ +L +              WSP   I  +LLSV ++L+ P
Sbjct: 71  LTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEP 130

Query: 116 NPNDPLANDVAEDWIKNEDGAIAKARE 142
           N       D    W  N +    + R+
Sbjct: 131 NIESGANIDACILWRDNREEFERQVRQ 157

>Kwal_26.8224
          Length = 165

 Score = 83.2 bits (204), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 10  QETERLVSDPVPGITAEPH-EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E ++L+ D   GI A P  E+NL  +   I GP  SPY+ GVF   L  P DYP+  PK
Sbjct: 11  KELQQLLKDSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPLSPPK 70

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115
           + F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++L+ P
Sbjct: 71  LLFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEP 130

Query: 116 N 116
           N
Sbjct: 131 N 131

>CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces
           cerevisiae YLR306w UBC12 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 187

 Score = 82.0 bits (201), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 55/86 (63%)

Query: 42  PQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101
           P +  Y+ G F+      + YP++ PKV    KI+HPNID  G+ICL++L+ +WSPAL +
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPHGKICLNILREDWSPALDL 130

Query: 102 RTVLLSVQALLASPNPNDPLANDVAE 127
           + ++L + +L   PN NDPL  + AE
Sbjct: 131 QCIVLGLLSLFQEPNGNDPLNKEAAE 156

>YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853)
           Rub1p-conjugating enzyme, with similarity to ubiquitin-
           and ubiquitin-like protein-conjugating enzymes [567 bp,
           188 aa]
          Length = 188

 Score = 82.0 bits (201), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%)

Query: 38  TIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSP 97
            I  P +  Y  G     L   + YP+E PKV  L KI+HPNID  G +CL++L+ +WSP
Sbjct: 66  VIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSP 125

Query: 98  ALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           AL +++++  +  L   PNPNDPL  D A+
Sbjct: 126 ALDLQSIITGLLFLFLEPNPNDPLNKDAAK 155

>Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement
          Length = 233

 Score = 82.0 bits (201), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 65/137 (47%), Gaps = 14/137 (10%)

Query: 10  QETERLVSDPVPGITAEPH-EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E ++L  D   GI A P  E+NL  +   I GP  SPYE GVF   L  P DYP+  P+
Sbjct: 79  KELQQLARDSPEGIVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPLSPPR 138

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115
           + F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++L+ P
Sbjct: 139 LTFTPSILHPNIYPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSMLSEP 198

Query: 116 NPNDPLANDVAEDWIKN 132
           N       D    W  N
Sbjct: 199 NVESGANIDACILWRDN 215

>ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH]
           (634059..634610,634663..634713) [603 bp, 200 aa]
          Length = 200

 Score = 80.5 bits (197), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 62/103 (60%), Gaps = 3/103 (2%)

Query: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLD 89
           EN  Y +++   P++  Y  G F+  +   D YP+E P V+ L  IYHPNID  G ICL+
Sbjct: 74  ENKVYLRIS---PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNIDYSGNICLN 130

Query: 90  VLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
           VL+ +WSP + ++TV+L +  L   PN +DPL    A+  +++
Sbjct: 131 VLREDWSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTMLRD 173

>KLLA0E07711g complement(693694..694191) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w QRI8 E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 79.3 bits (194), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 60/121 (49%), Gaps = 14/121 (11%)

Query: 10  QETERLVSDPVPGITAEP-HEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPK 68
           +E E+L  D   GI A P  + NL  +   I GP  S YE GVF   L  P DYP+  PK
Sbjct: 11  KELEKLTKDSPEGILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPLNPPK 70

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQALLASP 115
           + F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++L+ P
Sbjct: 71  LTFQPSILHPNIYPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSILSEP 130

Query: 116 N 116
           N
Sbjct: 131 N 131

>YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070)
           Smt3p-conjugating enzyme required for G2/M transition,
           conjugates Smt3p to Pol30p (PCNA) in S phase, which may
           be antagonistic to non-proteolytic ubiquitination of
           Pol30p in the Rad6-dependent DNA repair pathway [474 bp,
           157 aa]
          Length = 157

 Score = 77.8 bits (190), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 7/132 (5%)

Query: 9   KQETERLVSDPVPGITAEPHEE-----NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           ++E ++   D   G  A+P ++     +L+ ++  I G + + +  GV+ + +  P++YP
Sbjct: 10  QEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYP 69

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALLASPNPNDPL 121
            + PKV+F    YHPN+   G ICL +L    +W PA+ ++ ++L VQ LL SPNPN P 
Sbjct: 70  SKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPA 129

Query: 122 ANDVAEDWIKNE 133
                  + +N+
Sbjct: 130 QEPAWRSFSRNK 141

>Kwal_27.10444
          Length = 278

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 56/104 (53%), Gaps = 12/104 (11%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           + S Y  G FK ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L T+        
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHTSGDPTSEEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNED 134
               WSP   + +VL+S+ +LL  PN + P   D A D+ KN D
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNAD 154

>KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 292

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 58/111 (52%), Gaps = 12/111 (10%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVL----------- 91
           ++S Y  G FK ++  PDD+P   P  RF   IYHPN+ R GR+C+ +L           
Sbjct: 50  EESIYHGGYFKAQMKFPDDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQSGNPTSDEP 109

Query: 92  -KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAIAKAR 141
            +  WSP   + +VL+S+ +LL  PN + P   D A D+ KN D    K +
Sbjct: 110 DEETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKVK 160

>YDR054C (CDC34) [905] chr4 complement(561436..562323)
           Ubiquitin-conjugating enzyme (E2); component of the SCF
           (Skp1p-Cdc53p-F-box) complexes which act with various
           F-box proteins to direct target proteins into the
           ubiquitin-dependent degradation pathway [888 bp, 295 aa]
          Length = 295

 Score = 79.0 bits (193), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           + S Y  G FK ++  P+D+P   P+ RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
               WSP   + +VL+S+ +LL  PN N P   D A D+ KN
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Sklu_1826.3 YGR133W, Contig c1826 3548-4033
          Length = 161

 Score = 75.9 bits (185), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85
           N+ ++   I GP ++PY + VF L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95

Query: 86  ICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137

>CAGL0E04598g complement(444288..445175) highly similar to sp|P14682
           Saccharomyces cerevisiae YDR054c CDC34 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 295

 Score = 77.8 bits (190), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           + S Y  G FK ++  PDD+P   P+ RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
               WSP   + +VL+S+ +LL  PN + P   D A D+ KN
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKN 152

>Scas_635.18
          Length = 273

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           + S Y  G FK ++  P+D+P   P+ RF   IYHPN+ R GR+C+ +L           
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQGGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
               WSP   + +VL+S+ +LL  PN + P   D A D+ KN
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH]
           (317749..318561) [813 bp, 270 aa]
          Length = 270

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           + S Y  G FK ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPSFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
               WSP   + +VL+S+ +LL  PN + P   D A D+ KN
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Sklu_2136.5 YDR054C, Contig c2136 7737-8555
          Length = 272

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           + S Y  G FK ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMKFPEDFPFSPPNFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
               WSP   + +VL+S+ +LL  PN + P   D A D+ KN
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Kwal_55.21246
          Length = 160

 Score = 72.8 bits (177), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 64/101 (63%), Gaps = 3/101 (2%)

Query: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86
           ++NL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92

Query: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
           C+++L + +WSPA  +  ++ ++  LLA+P P+ PL  D+A
Sbjct: 93  CINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLA 133

>Scas_712.59
          Length = 171

 Score = 72.0 bits (175), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87
            +L ++Q  I+GPQ +PY N  F+L++  P  YP+E P + F    + H N++ + G IC
Sbjct: 43  SDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAIC 102

Query: 88  LDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGA 136
           LD+L K +W+PA  + T + ++  LL  P P+ PL  D+A     N+  A
Sbjct: 103 LDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152

>Scas_718.34
          Length = 258

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN-------- 94
           + S Y  G F+ ++  P D+P   P+ +F+  IYHPN+ R G++C+ +L  +        
Sbjct: 58  KDSIYHGGYFQSQMKFPKDFPFSPPQFKFIPPIYHPNVYRDGKLCISILHQSGDAMTSEP 117

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKN 132
               WSP   + +VL+S+ +LL  PN + P   D A ++ KN
Sbjct: 118 DNETWSPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYRKN 159

>CAGL0I10450g complement(1024541..1025029) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w ubiquitin-conjugating
           enzyme - peroxin, hypothetical start
          Length = 162

 Score = 68.6 bits (166), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 63/111 (56%), Gaps = 11/111 (9%)

Query: 33  RYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIY-------HPNID-RLG 84
           R+F V I+GP ++PY    FKL + +P  YPM  P ++F++          H N+D R G
Sbjct: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94

Query: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNED 134
            ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A + +KN D
Sbjct: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA-NILKNND 144

>AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH]
           complement(1006421..1006888) [468 bp, 155 aa]
          Length = 155

 Score = 66.6 bits (161), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 69/140 (49%), Gaps = 8/140 (5%)

Query: 6   RCSKQETERLVSDPVPGITAEPHEEN--LRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           R  KQ  ++L   P     A   EEN  L  ++   +GP+ +PY    F L + +P+ YP
Sbjct: 6   REYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65

Query: 64  MEAPKVRF-LTKIYHPNID-RLGRICLDVLKTN-WSPALQIRTVLLSVQALLASPNPNDP 120
            E PK  F    I HPNI    G +CLD+LK   WSP   +  V+ ++  LLA P  + P
Sbjct: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSP 125

Query: 121 LANDVAEDWIKNE---DGAI 137
           L  D++  +  +    DG +
Sbjct: 126 LDVDLSRLYTTDRAAYDGVV 145

>KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 251

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 10/116 (8%)

Query: 4   NSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           N R +K E + +V++P P I A PHE+N+  +   I GP  +PYENG +   L  P DYP
Sbjct: 7   NKRLTK-EYKNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTFPSDYP 65

Query: 64  MEAPKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
              P +R +T    PN       R+CL   D     W+PA  + T+L  + + +  
Sbjct: 66  FNPPAIRMIT----PNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMTG 117

>YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugating
           enzyme and peroxisomal biogenesis protein (peroxin) [552
           bp, 183 aa]
          Length = 183

 Score = 64.3 bits (155), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 16  VSDPVPGITAEPH---EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFL 72
           +++P  GI    +   E +L  ++  I GP  +PYEN  F++ + +P  YPM  PK+ F+
Sbjct: 39  IANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFM 98

Query: 73  -TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
              I H N+    G ICL++LK   W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 99  QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155

>AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH]
           complement(1419828..1420556) [729 bp, 242 aa]
          Length = 242

 Score = 62.4 bits (150), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 10/114 (8%)

Query: 6   RCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPME 65
           R SK E + +  +P P I A P E+N+  +   I GP ++PYE+G +   L  P+DYP  
Sbjct: 9   RLSK-EYKMMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFN 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
            P +R LT    PN       R+CL   D     W+P+  + T+L  + + + +
Sbjct: 68  PPAIRMLT----PNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTT 117

>YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugating
           enzyme, anchored in the ER membrane with the
           catalytically active domain in cytoplasm [753 bp, 250
           aa]
          Length = 250

 Score = 61.2 bits (147), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 9/110 (8%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +E + +V +P P I A P+E+N+  +   I GP  +PY+ G +   L  P DYP + P +
Sbjct: 12  KEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAI 71

Query: 70  RFLT--KIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
           R +T    + PN     R+CL   D     W+P   + T+L  + + + S
Sbjct: 72  RMITPNGRFKPNT----RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117

>Kwal_27.10837
          Length = 246

 Score = 60.8 bits (146), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (50%), Gaps = 6/112 (5%)

Query: 6   RCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPME 65
           R SK E + +V +P P I A+P+E+N+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 9   RLSK-EYKSMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFK 67

Query: 66  APKVRFLTKIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
            P +R +T       D   R+CL   D     W+P+  + T+L  + + + S
Sbjct: 68  PPAIRMVTPSGRFKED--TRLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTS 117

>Scas_599.16
          Length = 224

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +E + +V +P+P I A P+E+N+  +   I GP  +PY++G +   L  P DYP + P +
Sbjct: 114 KEYKLMVENPLPYILARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYKPPAI 173

Query: 70  RFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSVQALLAS 114
           R +T    PN       R+CL +   +   W+P   + T+L  + +L+  
Sbjct: 174 RMIT----PNGRFKDNTRLCLSMSDYHPDLWNPGWSVNTILNGLLSLMTG 219

>CAGL0I05478g complement(518933..519673) highly similar to sp|P33296
           Saccharomyces cerevisiae YER100w UBC6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 246

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 9/110 (8%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +E + +V +P P I A P+EEN+  +   I GP  +PY+ G +   L  P DYP + P +
Sbjct: 12  KEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAI 71

Query: 70  RFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
           R +T    PN       R+CL   D     W+P   + T+L  + + +  
Sbjct: 72  RMIT----PNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTG 117

>Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement
          Length = 251

 Score = 58.2 bits (139), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 9/110 (8%)

Query: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69
           +E + ++ +P   I A+P+E+N+  +   I GP  +PY +G +   L  P DYP + P +
Sbjct: 12  KEYKAIIENPPQFINAQPNEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFKPPAI 71

Query: 70  RFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
           R +T    PN       R+C+   D     W+PA  + T+L+ + + +  
Sbjct: 72  RMIT----PNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMTG 117

>KLLA0E03916g complement(365119..365595) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w PAS2 E2
           ubiquitin-conjugating enzyme - peroxin, start by
           similarity
          Length = 158

 Score = 56.2 bits (134), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82
           +++L  +    +GP +SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88

Query: 83  LGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
            G ICLD+LK  W+P   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133

>Scas_609.7
          Length = 240

 Score = 55.8 bits (133), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 10/116 (8%)

Query: 4   NSRCSKQETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63
           + R SK E + ++ +P P I A P+E N+  +   I GP  +PY  G +   L  P DYP
Sbjct: 7   HKRLSK-EYKLIIENPTPYILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYP 65

Query: 64  MEAPKVRFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSVQALLAS 114
            + P +R +T    PN       R+CL +   +   W+P   + T+L  + + +  
Sbjct: 66  FKPPAIRMIT----PNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFMTG 117

>Kwal_27.11182
          Length = 101

 Score = 48.9 bits (115), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 3/87 (3%)

Query: 32  LRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDV 90
           + Y+  TI GP  S +EN ++ + L   + YP E PK++F++KI  P +++  G +  D 
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPCVNQTTGEVKRDQ 60

Query: 91  LKT--NWSPALQIRTVLLSVQALLASP 115
             T  +W  +  + T+LL ++  +A P
Sbjct: 61  FSTLRDWKRSYNMETLLLDLRKEMALP 87

>Scas_551.9
          Length = 153

 Score = 48.9 bits (115), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 6   RCSKQETERLVSDPVPGITAEPHEE-----NLRYFQVTIEGPQQSPYENGVFKLELFLPD 60
           R   +  ++   D   G  A+P        NL+ ++  I G + + +  GV+ + +  P+
Sbjct: 61  RFKTKNRKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPN 120

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVL 91
           +YP + PKV+     YHPN+   G ICL +L
Sbjct: 121 EYPSKPPKVKLPANFYHPNVYPSGTICLSIL 151

>KLLA0E19217g join(complement(1703226..1703236), highly similar to
           sp|P53152 Saccharomyces cerevisiae YGL087c MMS2 part of
           the error-free postreplication repair pathway singleton,
           start by similarity
          Length = 139

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 38  TIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKT--N 94
           TI GP  S +EN ++ + +     YP E PKV+F++KI  P ++   G +  +   T   
Sbjct: 44  TILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPCVNSTTGEVVKEKFHTLKE 103

Query: 95  WSPALQIRTVLLSVQALLASPN 116
           W  +  + TVLL ++  +A+P+
Sbjct: 104 WKRSYTMETVLLELRKEMATPS 125

>CAGL0H03157g
           join(complement(297881..297891),
           complement(297272..297680)) highly similar to sp|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 43.5 bits (101), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 38  TIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKT--N 94
           TI GP  S +EN ++ + +     YP E P + F++KI  P +D+  G +  +   T  +
Sbjct: 44  TILGPPHSNHENRIYSVSIECGPKYPDEPPTITFISKINLPCVDQSTGEVNKEKFNTLKD 103

Query: 95  WSPALQIRTVLLSVQALLASP 115
           W     + T+LL ++  +ASP
Sbjct: 104 WKRLYNMETILLDLRKEMASP 124

>YGL087C (MMS2) [1895] chr7
           complement(346407..346809,346895..346905)
           Ubiquitin-conjugating enzyme variant (UEV) protein
           required for resistance to DNA damaging agents and
           non-proteolytic multi-ubiquitination of Pol30p (PCNA)
           [414 bp, 137 aa]
          Length = 137

 Score = 43.1 bits (100), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 38  TIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLK-TNW 95
           TI GP  S +EN ++ L +    +YP   PKV F++KI  P ++   G +  D     +W
Sbjct: 44  TILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRDW 103

Query: 96  SPALQIRTVLLSVQALLASP 115
             A  + T+LL ++  +A+P
Sbjct: 104 KRAYTMETLLLDLRKEMATP 123

>Scas_720.10*
          Length = 134

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 38  TIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLKT--N 94
           TI GP  S +EN ++ + +     YP   P ++F++KI  P +D + G +      T  +
Sbjct: 40  TILGPPHSNHENRIYSVAIHCGPHYPDAPPTIKFVSKINLPCVDEKTGEVKQASFHTLRD 99

Query: 95  WSPALQIRTVLLSVQALLASP 115
           W  +  + T+LL ++  +ASP
Sbjct: 100 WKRSYTMETLLLDLRKEMASP 120

>AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH]
           complement(314210..314220,314273..314678) [417 bp, 138
           aa]
          Length = 138

 Score = 40.8 bits (94), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLD 89
           ++ ++  TI GP  S +EN ++ + +    +YP   PKVRF+++I  P +D   G +  +
Sbjct: 37  SMTHWNGTILGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPE 96

Query: 90  VLKT--NWSPALQIRTVLLSVQALLAS 114
                 +W  +  + T+L  ++  +AS
Sbjct: 97  AFHALRDWKRSSNMETLLQDLRKEMAS 123

>Scas_701.12
          Length = 128

 Score = 28.9 bits (63), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 77  HPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDG 135
           H   D LG+  L+VL  + +    + +V   V +L    N N  +++ V+  W  N+DG
Sbjct: 43  HQWADTLGKGILEVLAKHSTAYKYLVSVTTVVSSLAFEGNENASVSHTVSTYWNPNKDG 101

>Sklu_2369.8 YER075C, Contig c2369 9770-12817 reverse complement
          Length = 1015

 Score = 28.5 bits (62), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 64  MEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           M+A K++F+++     +D L +  L+   TN    L+    +     LL +P P+ P A 
Sbjct: 514 MKASKLQFISQFQR--LDLLEKKRLNQCLTNVDMVLEQPQSIPPTGNLLCNPIPSTPCAI 571

Query: 124 DVAEDWIKNEDGAIA 138
           D  ED   ++ GA A
Sbjct: 572 DDTEDPRNHQHGATA 586

>Scas_462.1
          Length = 814

 Score = 27.7 bits (60), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 16/106 (15%)

Query: 31  NLRYFQVTIEGPQQSPYENGV-FKLELFLPDDYPMEAPKV-RFLTKIYHPNIDRLGRICL 88
           N+ Y ++T+       Y+N   F + +  PD   +   K  R   + ++ N+        
Sbjct: 34  NVMYHKLTV------AYQNYTKFNVRVCKPDAVLISGKKFSRSYIREFYANVK------- 80

Query: 89  DVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNED 134
           +  ++N S   Q    +LSVQA+ A    N P A DVAE+ IK ++
Sbjct: 81  ERFESNLSDLRQYFDKVLSVQAV-ADATLNSPTAIDVAENRIKTKN 125

>Scas_558.4d
          Length = 762

 Score = 27.7 bits (60), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 91  LKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
            ++N S   Q    +LSVQA+ A    N P A DVAE+ IK ++  +
Sbjct: 491 FESNLSDLRQYFDKVLSVQAV-ADATLNSPTAIDVAENRIKTKNSLL 536

>Scas_534.1
          Length = 1311

 Score = 27.7 bits (60), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 91  LKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
            ++N S   Q    +LSVQA+ A    N P A DVAE+ IK ++  +
Sbjct: 520 FESNLSDLRQYFDKVLSVQAV-ADATLNSPTAIDVAENRIKTKNSLL 565

>Scas_535.1
          Length = 1197

 Score = 27.7 bits (60), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 91  LKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
            ++N S   Q    +LSVQA+ A    N P A DVAE+ IK ++  +
Sbjct: 520 FESNLSDLRQYFDKVLSVQAV-ADATLNSPTAIDVAENRIKTKNSLL 565

>Scas_553.1
          Length = 993

 Score = 27.3 bits (59), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 91  LKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
            ++N S   Q    +LSVQA+ A    N P A DVAE+ IK ++  +
Sbjct: 501 FESNLSDLRQYFDKVLSVQAV-ADATLNSPTAIDVAENRIKTKNSLL 546

>Scas_698.1
          Length = 1557

 Score = 27.3 bits (59), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 16/109 (14%)

Query: 31  NLRYFQVTIEGPQQSPYENGV-FKLELFLPDDYPMEAPKV-RFLTKIYHPNIDRLGRICL 88
           N+ Y ++T+       Y+N   F + +  PD   +   K  R   + ++ N+        
Sbjct: 374 NVMYHKLTV------AYQNYTKFNVRVCKPDAVLISGKKFSRSYIREFYANVK------- 420

Query: 89  DVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGAI 137
           +  ++N S   Q    +LSVQA+ A    N P A DVAE+ IK ++  +
Sbjct: 421 ERFESNLSDLRQYFDKVLSVQAV-ADATLNSPTAIDVAENRIKTKNSLL 468

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,136,513
Number of extensions: 204217
Number of successful extensions: 606
Number of sequences better than 10.0: 99
Number of HSP's gapped: 560
Number of HSP's successfully gapped: 99
Length of query: 148
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 56
Effective length of database: 13,411,253
Effective search space: 751030168
Effective search space used: 751030168
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)