Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2346728027714960.0
KLLA0C17644g15762829271e-115
YER166W (DNF1)15713079221e-114
AGR120C15472838461e-103
Scas_576.815913068171e-99
YDR093W (DNF2)16123108101e-98
Scas_636.1615543097993e-97
CAGL0L11814g15763157941e-96
CAGL0G08085g15783117412e-89
KLLA0A04015g13432151392e-09
Kwal_26.707013151501232e-07
YAL026C (DRS2)13552381215e-07
CAGL0G06270g13281571152e-06
Scas_505.410252401153e-06
ADR350W13111821037e-05
KLLA0E01650g1550163750.19
Scas_650.7111973662.7
Kwal_26.883191673643.9
Scas_707.1385943644.1
Scas_643.21*31441634.6
Kwal_27.12129233365627.6
Sklu_2298.2109681627.7
Scas_699.5240185618.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23467
         (277 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23467                                                         580   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   361   e-115
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   359   e-114
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   330   e-103
Scas_576.8                                                            319   1e-99
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   316   1e-98
Scas_636.16                                                           312   3e-97
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   310   1e-96
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   290   2e-89
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    58   2e-09
Kwal_26.7070                                                           52   2e-07
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    51   5e-07
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    49   2e-06
Scas_505.4                                                             49   3e-06
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    44   7e-05
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    33   0.19 
Scas_650.7                                                             30   2.7  
Kwal_26.8831                                                           29   3.9  
Scas_707.13                                                            29   4.1  
Scas_643.21*                                                           29   4.6  
Kwal_27.12129                                                          28   7.6  
Sklu_2298.2 YPL160W, Contig c2298 4548-7838                            28   7.7  
Scas_699.52                                                            28   8.6  

>Kwal_56.23467
          Length = 280

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/277 (100%), Positives = 277/277 (100%)

Query: 1   MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
           MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS
Sbjct: 1   MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60

Query: 61  VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
           VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA
Sbjct: 61  VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120

Query: 121 IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
           IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA
Sbjct: 121 IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180

Query: 181 DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFHPRSNIRTSL 240
           DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFHPRSNIRTSL
Sbjct: 181 DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFHPRSNIRTSL 240

Query: 241 DRTRMQMRASNELDGRYSIERARTSHELPGVTRAESL 277
           DRTRMQMRASNELDGRYSIERARTSHELPGVTRAESL
Sbjct: 241 DRTRMQMRASNELDGRYSIERARTSHELPGVTRAESL 277

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  361 bits (927), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 169/282 (59%), Positives = 206/282 (73%), Gaps = 18/282 (6%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +RSEWN TKFWLYM D +YQSVI FF P+L YYKTG+V+ NG GLDHRYWVG+ V +IA 
Sbjct: 1303 LRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAV 1362

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
            VSCN Y+L+HQ+RWDWFS+LFIALSCL ++ WTGIWS+FT+SGEFYKSAAH+YG P++WA
Sbjct: 1363 VSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWA 1422

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            I F G+LFCLLPRF  D F + + PKDIDIIRE W +G FD YPE YDPTDP+RP++  A
Sbjct: 1423 IMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNA 1482

Query: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPM-TFMEADDNNPEPF----HPRSN 235
                   +V     Y   I  A   S D++ TEEIPM     +   +P  +    H RS+
Sbjct: 1483 -------FV-----YNKDIEMA-QSSTDSIQTEEIPMDELFNSSATSPRSYPHNRHQRSS 1529

Query: 236  IRTSLDRTRMQMRASNELDGRYSIERARTSHELPGVTRAESL 277
             R SL+ TR +MR SN+LD RYS+ERAR S ELPGVTRA +L
Sbjct: 1530 GRPSLEITRAEMRNSNQLDNRYSVERARVSLELPGVTRAATL 1571

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  359 bits (922), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 214/307 (69%), Gaps = 33/307 (10%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +R EWN  KF  YM+DGLYQS+I FFFP+L Y+K  +V+ NGLGLDHRY+VG+ V +IA 
Sbjct: 1261 LRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAV 1320

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
            +SCN Y+L+HQ+RWDWFS LFIALSCLVV+ WTGIWS+   S EF+K+AA +YG+P +WA
Sbjct: 1321 ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWA 1380

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            +FFV VLFCLLPRFT+D FQK F+P D++I+RE W  GHFD YP  YDPTDPNRP++ KA
Sbjct: 1381 VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKA 1440

Query: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFH--------- 231
                H   + EG   +  +  +N+ SRD+V TEEIPMTFM  +D +P  +          
Sbjct: 1441 GQ--HGEKIIEGIALSDNLGGSNY-SRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSP 1497

Query: 232  ---------------------PRSNIRTSLDRTRMQMRASNELDGRYSIERARTSHELPG 270
                                 P +N+R+SLDRTR QM A+N+LD RYS+ERARTS +LPG
Sbjct: 1498 KETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNRYSVERARTSLDLPG 1557

Query: 271  VTRAESL 277
            VT A SL
Sbjct: 1558 VTNAASL 1564

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  330 bits (846), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 207/283 (73%), Gaps = 11/283 (3%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +R+EW   KFW Y  DG+YQS+I FFFP+L YY+TG+++ N  GLDHRY  G+ V SIA 
Sbjct: 1266 LRTEWTQNKFWWYCFDGVYQSIICFFFPYLCYYRTGLITKNAYGLDHRYTFGVFVTSIAV 1325

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
            VSCNLY+LIHQ+RWDWF+TLFI LSC +++ WTG+WS+ T SGEFYK+A  +Y  P++WA
Sbjct: 1326 VSCNLYVLIHQYRWDWFTTLFIFLSCGILFFWTGVWSSATYSGEFYKTAVRLYAQPVFWA 1385

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            + FVGV+FCLLPRFT+D  QK+FFP+DIDI+RE W +G FD YPEDYDPTDPNRP+I  +
Sbjct: 1386 VLFVGVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDMYPEDYDPTDPNRPRINVS 1445

Query: 181  DTKLHPRYVEEGSDYAHAITTANHG-SRDTVYTEEIPMTFME--ADDNNPEPFHP---RS 234
             T      V+  SD   + T ++ G +R TV +E+IPM  ++  A  +  +P  P     
Sbjct: 1446 HTG-----VDRASDDERSRTGSDLGVTRTTVISEDIPMGLIDKTAPHSRADPTTPLGSED 1500

Query: 235  NIRTSLDRTRMQMRASNELDGRYSIERARTSHELPGVTRAESL 277
            + R SL+ TR +M  +++LD RYS+ERARTS +LPGVTRA +L
Sbjct: 1501 SARYSLEVTRREMLQTHQLDSRYSVERARTSLDLPGVTRARTL 1543

>Scas_576.8
          Length = 1591

 Score =  319 bits (817), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 152/306 (49%), Positives = 208/306 (67%), Gaps = 32/306 (10%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +R +WN TKF  YM+DGLYQS I FFFP+  Y+K  +VS NGLGLDHR++VG++V S+A 
Sbjct: 1277 LRLDWNQTKFLWYMLDGLYQSCICFFFPYCLYHKNQIVSNNGLGLDHRFYVGVMVTSLAV 1336

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
            VSCN+Y+L+HQ+RWDWFS LFI LSC++++ WTG+WS+  TS EF+K+A+ +YG+P +W 
Sbjct: 1337 VSCNIYMLLHQYRWDWFSCLFIGLSCIILFFWTGVWSSSLTSKEFFKAASRIYGAPSFWG 1396

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            +FFVG+++CLLPRFT D F+K F+P D++I+RE W +G F  YP  YDPTDPNRP++AK+
Sbjct: 1397 VFFVGIVYCLLPRFTLDCFRKFFYPTDVEIVREMWQRGDFSHYPPGYDPTDPNRPKVAKS 1456

Query: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADD---------------- 224
              K   R V EG   + +    N+ S ++V TEEIPM  +  D                 
Sbjct: 1457 -GKFGERIV-EGIHLSQSF-GENNFSHESVATEEIPMNILHTDAGQTIRRDTQDQWASSP 1513

Query: 225  ------------NNPEPFHPRSNI-RTSLDRTRMQMRASNELDGRYSIERARTSHELPGV 271
                        N  +    +SN+ R+SL+RTR  M A+N+LD RYS+E+ARTS +LPGV
Sbjct: 1514 KETQDLLFSPRLNQEQEQRQKSNLGRSSLERTREDMLATNQLDNRYSVEKARTSLDLPGV 1573

Query: 272  TRAESL 277
            T A SL
Sbjct: 1574 THAASL 1579

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  316 bits (810), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 205/310 (66%), Gaps = 42/310 (13%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +R EWN TKF  YM+DG+YQSVI FFFP+LAY+K  +V+ NGLGLDHRY+VG+ V +IA 
Sbjct: 1304 LRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAV 1363

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
             SCN Y+ + Q+RWDWF  LFI LS  V YGWTGIW++ ++S EFYK AA V+  P YWA
Sbjct: 1364 TSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTSSSSSNEFYKGAARVFAQPAYWA 1423

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            + FVGVLFCLLPRFT D  +K+F+PKDI+I+RE W++G FD YP+ YDPTDP+RP+I   
Sbjct: 1424 VLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRI--- 1480

Query: 181  DTKLHPRYVEEGSDYAHAITTANH-----GSRDTVYTEEIPMTFMEADDNNPEPFH---- 231
              ++ P      +D+   I+   H      S++T+ TEEIPM+ +  +  + + +     
Sbjct: 1481 -NEIRPL-----TDFKEPISLDTHFDGVSHSQETIVTEEIPMSILNGEQGSRKGYRVSTT 1534

Query: 232  ----------------PR--------SNIRTSLDRTRMQMRASNELDGRYSIERARTSHE 267
                            PR        + +RTSLDRTR +M A+++LD RYS+ERAR S +
Sbjct: 1535 LERRDQLSPVTTTNNLPRRSMASARGNKLRTSLDRTREEMLANHQLDTRYSVERARASLD 1594

Query: 268  LPGVTRAESL 277
            LPG+  AE+L
Sbjct: 1595 LPGINHAETL 1604

>Scas_636.16
          Length = 1554

 Score =  312 bits (799), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 204/309 (66%), Gaps = 35/309 (11%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +R EWN TKF  YM DG+YQSVI +FFP+L Y KT +++ NGLGLDHRY+VGI V  IA 
Sbjct: 1240 LRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAV 1299

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
             SCN Y+L+ Q+RWDWF+T F  LS +V +GWTGIWS+   S EF+K A+ +YG+P +WA
Sbjct: 1300 TSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWA 1359

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            ++FVG LFC+LPRFT+DVF K  +P D++IIRE W  G F +YP+DYDPTDPN+P++ KA
Sbjct: 1360 VYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKA 1419

Query: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEA------------------ 222
                  + V+E      A+  A+  S+ T+ TEEIPM+F++                   
Sbjct: 1420 HEWGQYKIVDES--IGDAVVCASD-SQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDS 1476

Query: 223  ---DD---------NNPEPFHPRSN--IRTSLDRTRMQMRASNELDGRYSIERARTSHEL 268
               DD          N   F P S+  +RTSLDRTR +M ASN+LD RYS++RAR S +L
Sbjct: 1477 LDEDDARRDSMNNARNSMQFRPSSSSRVRTSLDRTRDEMLASNQLDTRYSVDRARVSLDL 1536

Query: 269  PGVTRAESL 277
            PGVT AE L
Sbjct: 1537 PGVTHAEML 1545

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  310 bits (794), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 199/315 (63%), Gaps = 43/315 (13%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +R EWN TKF  YM DGLYQSVI FFFP+L Y + G+V+ NG+GL+HRY+VGI+V +IA 
Sbjct: 1257 LRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAV 1316

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
             +CNLYILIHQ+RWDWFS  FI LSC+VV GWTGIW++  TS + +K+   +Y SP +WA
Sbjct: 1317 FACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWA 1376

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            +FF+GV FCLLPRFT+D + + F P D+ IIRE W +G +D YP  YDPTDPNRP+I+K 
Sbjct: 1377 VFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKG 1436

Query: 181  ---DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFH------ 231
                 +L    V E   YA       + SRD+V+TEEIPM  +   D  P  F       
Sbjct: 1437 AKFGERLGQGIVLEDETYA-----GGNVSRDSVFTEEIPMNIISGTDGTPRGFEMSGRTP 1491

Query: 232  --------------------PRSNI---------RTSLDRTRMQMRASNELDGRYSIERA 262
                                P++N+         R S+DRTR  M A+ ELD RYS++RA
Sbjct: 1492 DIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELDNRYSVDRA 1551

Query: 263  RTSHELPGVTRAESL 277
            R S +LPGVT A +L
Sbjct: 1552 RASLDLPGVTHAAAL 1566

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  290 bits (741), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 198/311 (63%), Gaps = 37/311 (11%)

Query: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60
            +R EW+ TKF  YM+DGLYQSVI+FFFP+L Y +  +V+ NGLGLDHRY+VG+ V +IA 
Sbjct: 1267 LRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIAC 1326

Query: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120
            +SCNLYILI Q  WD F + F+ +S ++ + WTGIWS+ + S EFY  AA V+G+P +WA
Sbjct: 1327 ISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVFGTPTFWA 1386

Query: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180
            + FVG++FCLLPRFT DVF++ F+PKDIDIIRE W +G FD +P+ YDPTDP   +IA +
Sbjct: 1387 VLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPEVHKIAMS 1446

Query: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEA------------------ 222
            D ++      E  ++     T++  S D + +EEIP+   +                   
Sbjct: 1447 DIRVFSG--AESKEFNSNSNTSSSSSED-ILSEEIPLELGKGMNDSGKKSEYESGVGDEI 1503

Query: 223  ----------------DDNNPEPFHPRSNIRTSLDRTRMQMRASNELDGRYSIERARTSH 266
                            D+      + R++ RTSLDRTR  M A+N+LD R+S+ERAR S 
Sbjct: 1504 LKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDTRFSVERARASL 1563

Query: 267  ELPGVTRAESL 277
            ELPG+T AE+L
Sbjct: 1564 ELPGITHAENL 1574

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 96/215 (44%), Gaps = 24/215 (11%)

Query: 5    WNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSC 63
            +++T FW ++++G Y S + F    L Y     ++  G   DH  W VGI   SI  V  
Sbjct: 1092 FSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLG 1151

Query: 64   NLYILIHQFRWDWFSTLFIALSCLVVYG-----WTGIWSTFTTSGEFYKSAAHVYGSPIY 118
               ++  Q  W  F+ + I  S LV++      ++ ++     S E+Y    HVYGS  +
Sbjct: 1152 KAALITSQ--WTKFTLVAIPGS-LVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATF 1208

Query: 119  WAIFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTD--PNRPQ 176
            W +  V  +F LL  F +  +++ + P+   +++E           + Y+ +D  P   Q
Sbjct: 1209 WLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEM----------QKYNISDYRPRMEQ 1258

Query: 177  IAKADTKLHPRYVEE-GSDYAHAITTANHGSRDTV 210
              KA  K+  R V+        A + +  G +D +
Sbjct: 1259 FQKAIRKV--RQVQRMKKQRGFAFSQSEEGGQDRI 1291

>Kwal_26.7070
          Length = 1315

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 7/150 (4%)

Query: 10   FWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSCNLYIL 68
            FW ++++G Y S ++F    L Y    +++ +G   DH  W V I   S+  V     ++
Sbjct: 1093 FWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALV 1152

Query: 69   IHQFRWDWFSTLFIALSC---LVVYG-WTGIWSTFTTSGEFYKSAAHVYGSPIYWAIFFV 124
             +Q  W  F+   I  S    LV +  +  I      S E+Y   +HVYGS  +W +  V
Sbjct: 1153 TNQ--WTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIV 1210

Query: 125  GVLFCLLPRFTFDVFQKMFFPKDIDIIREF 154
               F L+    +  +++ + P+   +++E 
Sbjct: 1211 LPTFALMRDLVWKYYKRTYTPESYHVVQEM 1240

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 103/238 (43%), Gaps = 24/238 (10%)

Query: 10   FWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSCNLYIL 68
            FW ++++G + S I F    L Y     ++ +G   DH  W V +   S+  V     ++
Sbjct: 1094 FWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALV 1153

Query: 69   IHQFRWDWFSTLFIALSCL--VVY--GWTGIWSTFTTSGEFYKSAAHVYGSPIYWAIFFV 124
             +Q  W  F+ + I  S L  +++   +  I+     S E+Y    H YGS ++W    V
Sbjct: 1154 TNQ--WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIV 1211

Query: 125  GVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKADTKL 184
              +F L+  F +  +++M+ P+   +I+E           + Y+ +D +RP + +    +
Sbjct: 1212 LPIFALVRDFLWKYYKRMYEPETYHVIQEM----------QKYNISD-SRPHVQQFQNAI 1260

Query: 185  HP-RYVEE-GSDYAHAITTANHGSRDTVY----TEEIPMTFMEADDNNPEPFHPRSNI 236
               R V+        A + A  G ++ +     T +    + E  D +  PF+  + +
Sbjct: 1261 RKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGL 1318

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 70/157 (44%), Gaps = 11/157 (7%)

Query: 5    WNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSC 63
            ++++ FW ++V+G Y S + F    L Y     +  +G   DH  W + I   S+  V  
Sbjct: 1070 FSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLG 1129

Query: 64   NLYILIHQFRWDWFS------TLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPI 117
               ++ +Q  W  F+      +LF  L    +YG   I+     S E++    H YGS  
Sbjct: 1130 KAALVTNQ--WTKFTLFAIPGSLFFWLIFFPIYG--SIFPYAKISREYFGVVEHTYGSAT 1185

Query: 118  YWAIFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREF 154
            +W    V   F L   F +  +++M+ P+   +I+E 
Sbjct: 1186 FWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEM 1222

>Scas_505.4
          Length = 1025

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 102/240 (42%), Gaps = 28/240 (11%)

Query: 10  FWLYMVDGLYQSVISFFFPFLAYYKTGM-VSPNGLGLDHRYW-VGILVGSIASVSCNLYI 67
           FW ++V+G Y S + +    L +Y+ GM ++ +G   DH  W + +   SI  V     +
Sbjct: 759 FWGWIVNGFYHSAVVYIGTML-FYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAAL 817

Query: 68  LIHQFRWDWFSTLFIALSCLVVYG-----WTGIWSTFTTSGEFYKSAAHVYGSPIYWAIF 122
           + +Q  W  F TLF      + +      +  ++     S E++    H YGS  +W   
Sbjct: 818 VTNQ--WTKF-TLFAIPGSFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTL 874

Query: 123 FVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKADT 182
            V  +F L+  F +  +++M+ P+   +++E           + ++ +D NRP +     
Sbjct: 875 IVLPVFALMRDFVWKYYRRMYEPESYHLVQEM----------QKFNISD-NRPHVQHFQN 923

Query: 183 KLHP-RYVEE-GSDYAHAITTANHGSRDTVY----TEEIPMTFMEADDNNPEPFHPRSNI 236
           ++   R V+        A + +  G +D +     T +    + E  D NP   +   NI
Sbjct: 924 EIRKVRQVQRMKKQRGFAFSQSEEGGQDKIIRMYDTTQKRGVYGELHDANPFSNNNAENI 983

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 79/182 (43%), Gaps = 22/182 (12%)

Query: 5    WNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSC 63
            W  T F    ++G Y + I+     + Y      + +G   DH  W V I   SI  V  
Sbjct: 1085 WPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLG 1144

Query: 64   NLYILIHQFRWDWFSTLFIALSCLV------VYGWTGIWSTFTTSGEFYKSAAHVYGSPI 117
               ++ +Q  W  F+ L I  S +       +Y +  +      S E+Y   +HVYGS  
Sbjct: 1145 KAALITNQ--WTKFTVLAIPGSLVFWLLFFPIYAY--LLPGLNVSKEYYGIVSHVYGSFT 1200

Query: 118  YWAIFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQI 177
            +WA+ +V  +  LL    +  +++ + P+   +++E           + YD +D NRP+I
Sbjct: 1201 FWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQEM----------QKYDISD-NRPRI 1249

Query: 178  AK 179
             +
Sbjct: 1250 EQ 1251

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 27/163 (16%)

Query: 5    WNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGIL----VGSIAS 60
            +NL  F ++M+     SV+  F  F  +  T   S N +     Y +G++    +  + +
Sbjct: 1283 FNLKIFLVWMLTAAGISVLITFLNFEIWGFTAQ-SDNSI-----YPIGVINFTSICFLIN 1336

Query: 61   VSCNLYILIHQFRWDWFSTLFIAL------SCLV--VYGWTGIWSTFTTSGEFYKSAAHV 112
            V C  +I      W  F++L I+        CL+  +YG   I+              H 
Sbjct: 1337 VKCQ-FIETRNRNWLAFASLLISCIGWILWCCLLPGIYGENAIYDVLI-------GLYHQ 1388

Query: 113  YGSPI-YWAIFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREF 154
            +G  I +WA   + ++F ++       F+ M +P D DI  E 
Sbjct: 1389 FGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAEL 1431

>Scas_650.7
          Length = 1119

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 34/73 (46%)

Query: 205 GSRDTVYTEEIPMTFMEADDNNPEPFHPRSNIRTSLDRTRMQMRASNELDGRYSIERART 264
           G R TVY+E+     M+ D  + E   P+  +   ++ T     A   +D   +I++++ 
Sbjct: 277 GERYTVYSEKDGQACMDHDRQSGEGVTPQEYVGIKIEATEFAEEAQKIIDETAAIDKSKK 336

Query: 265 SHELPGVTRAESL 277
            + +    R E++
Sbjct: 337 IYFVAATLRPETM 349

>Kwal_26.8831
          Length = 916

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/73 (20%), Positives = 33/73 (45%)

Query: 205 GSRDTVYTEEIPMTFMEADDNNPEPFHPRSNIRTSLDRTRMQMRASNELDGRYSIERART 264
           G R T+Y+E+     M+ D  + E   P+  +   ++       A   +D   S+++++ 
Sbjct: 74  GERYTIYSEKDGQACMDHDRQSGEGVTPQEYVGIKIEAIEFAEAAQKIIDSTESLDKSKK 133

Query: 265 SHELPGVTRAESL 277
            H +    R E++
Sbjct: 134 FHFVAATLRPETM 146

>Scas_707.13
          Length = 859

 Score = 29.3 bits (64), Expect = 4.1,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 24/43 (55%)

Query: 224 DNNPEPFHPRSNIRTSLDRTRMQMRASNELDGRYSIERARTSH 266
           DN PEP H + N  T  +  R ++ +++ ++ R + E  RT +
Sbjct: 200 DNKPEPQHQKVNDTTFAENLRGKLLSNSPIEERINSETVRTGN 242

>Scas_643.21*
          Length = 314

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 28  PFLAYYKTGMVSPNGLGLDHRYWVGILVGSIASVSCNLYIL 68
           PFL  +   ++ P G+G+ H  W+ ++  SI S SC   +L
Sbjct: 97  PFLLAWSALILGPIGIGIAHVQWL-VISASITSWSCKKLLL 136

>Kwal_27.12129
          Length = 2333

 Score = 28.5 bits (62), Expect = 7.6,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 4/65 (6%)

Query: 165  EDYDPTDPNRPQIAKADTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEADD 224
            E+  P       +A  + + HP +      YA     A   + DT+  E + MT M +  
Sbjct: 1854 EENSPNTVGATSLADGEEEEHPSH----KGYASDDLLARPSTGDTLSDENVTMTLMNSQH 1909

Query: 225  NNPEP 229
            + PEP
Sbjct: 1910 SLPEP 1914

>Sklu_2298.2 YPL160W, Contig c2298 4548-7838
          Length = 1096

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/81 (19%), Positives = 36/81 (44%)

Query: 197 HAITTANHGSRDTVYTEEIPMTFMEADDNNPEPFHPRSNIRTSLDRTRMQMRASNELDGR 256
            A+     G R T+Y+E+     M+ D  + E   P+  I   ++ T     A   +D  
Sbjct: 245 KALGKIKFGERYTIYSEKDGQACMDHDRQSGEGVTPQEYIGIKIEVTEFAPEAKKIVDSS 304

Query: 257 YSIERARTSHELPGVTRAESL 277
            ++++++  + +    R E++
Sbjct: 305 DALDKSKKIYFVAATLRPETM 325

>Scas_699.52
          Length = 401

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 32/85 (37%), Gaps = 31/85 (36%)

Query: 72  FRWDWFSTLFIALSCLVVYGWTG----------------------IWSTFTTSGEFYKSA 109
           +R  WFS  FI    L V G+ G                      I   FT  G +Y+ A
Sbjct: 71  YRQIWFSVAFICTGILEVLGYIGRAWGHYNVYNMDGFLLNMICLTIAPVFTMGGIYYQLA 130

Query: 110 A--HVYG-------SPIYWAIFFVG 125
               VYG       SP+Y++  F+G
Sbjct: 131 KLIEVYGHRFSLLPSPMYYSYIFIG 155

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,750,271
Number of extensions: 438360
Number of successful extensions: 1498
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1500
Number of HSP's successfully gapped: 33
Length of query: 277
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 177
Effective length of database: 13,134,309
Effective search space: 2324772693
Effective search space used: 2324772693
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)