Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2346269568527540.0
YER167W (BCK2)851771954e-15
AGR119C801971936e-15
KLLA0C17666g7901291793e-13
Scas_681.21846821525e-10
CAGL0L11836g847781194e-06
CAGL0G09845g50075667.2
Scas_692.449691667.5
Scas_636.16d62081659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23462
         (685 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23462                                                        1065   0.0  
YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in ...    80   4e-15
AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH] (969101..97...    79   6e-15
KLLA0C17666g 1562996..1565368 some similarities with sp|P33306 S...    74   3e-13
Scas_681.21                                                            63   5e-10
CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306 Saccha...    50   4e-06
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    30   7.2  
Scas_692.4                                                             30   7.5  
Scas_636.16d                                                           30   9.9  

>Kwal_56.23462
          Length = 695

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/685 (80%), Positives = 551/685 (80%)

Query: 1   MRYAGSPSKTAENSSQCLTPAESVSKWKIPHYYRKSTGAPVRQELGSNTSLKSESNRANG 60
           MRYAGSPSKTAENSSQCLTPAESVSKWKIPHYYRKSTGAPVRQELGSNTSLKSESNRANG
Sbjct: 1   MRYAGSPSKTAENSSQCLTPAESVSKWKIPHYYRKSTGAPVRQELGSNTSLKSESNRANG 60

Query: 61  NINIMTTPKHVQLDEXXXXXXXXXXXXXXXXEMVFVNYTVXXXXXXXXXXXXXXXXXXXX 120
           NINIMTTPKHVQLDE                EMVFVNYTV                    
Sbjct: 61  NINIMTTPKHVQLDESGGGSKRGSKSKAKKGEMVFVNYTVKDAKSADAPLPKKKSSKSRM 120

Query: 121 XXXXXXGHNSGMDESFDNFSQLDVSTPQDSSDAVQKSRSSGSTPSSQATKRSYSSFLKYG 180
                 GHNSGMDESFDNFSQLDVSTPQDSSDAVQKSRSSGSTPSSQATKRSYSSFLKYG
Sbjct: 121 LKLFSSGHNSGMDESFDNFSQLDVSTPQDSSDAVQKSRSSGSTPSSQATKRSYSSFLKYG 180

Query: 181 HXXXXXXXXXXXXXXXXDGVSSTSLPLRSTVQRXXXXXXXXXXXXXXXXXXKASLALGTN 240
           H                DGVSSTSLPLRSTVQR                  KASLALGTN
Sbjct: 181 HAGSSSTITSPAITPPGDGVSSTSLPLRSTVQRPSLGPSLSSNVSLVNNNGKASLALGTN 240

Query: 241 DPASNFYHSPSKEKSNLNEAPRSDLHYNDQYNDRQGHLATFRPQLNHMHTSAYPKSGDEN 300
           DPASNFYHSPSKEKSNLNEAPRSDLHYNDQYNDRQGHLATFRPQLNHMHTSAYPKSGDEN
Sbjct: 241 DPASNFYHSPSKEKSNLNEAPRSDLHYNDQYNDRQGHLATFRPQLNHMHTSAYPKSGDEN 300

Query: 301 DASIAFSKMFTRKRANTGGSMSSLVSSTASNNLPTLHRNMSTHSISSMSNRYSPIRAGSP 360
           DASIAFSKMFTRKRANTGGSMSSLVSSTASNNLPTLHRNMSTHSISSMSNRYSPIRAGSP
Sbjct: 301 DASIAFSKMFTRKRANTGGSMSSLVSSTASNNLPTLHRNMSTHSISSMSNRYSPIRAGSP 360

Query: 361 AXXXXXXXXXXXXXXXDCTLLQGSSNYADLTGGMEIYLDSXXXXXXXXXXXXXDSISDSY 420
           A               DCTLLQGSSNYADLTGGMEIYLDS             DSISDSY
Sbjct: 361 ARNNSILRSNSNRYSRDCTLLQGSSNYADLTGGMEIYLDSQTKQRHTTHKKKQDSISDSY 420

Query: 421 RALPNNTALGPYXXXXXXXXXXXXXXXXEGGTITNTSGVDRQNSIILSLDRXXXXXXXXX 480
           RALPNNTALGPY                EGGTITNTSGVDRQNSIILSLDR         
Sbjct: 421 RALPNNTALGPYPSTVSSLSSASTPCLVEGGTITNTSGVDRQNSIILSLDRESSLENEIL 480

Query: 481 XXXXXTANSPNGRPAIQGIPKTTLEVGERELDNISLPNTSRSSVTMFSSLVNSHSTLDSS 540
                TANSPNGRPAIQGIPKTTLEVGERELDNISLPNTSRSSVTMFSSLVNSHSTLDSS
Sbjct: 481 EEQEETANSPNGRPAIQGIPKTTLEVGERELDNISLPNTSRSSVTMFSSLVNSHSTLDSS 540

Query: 541 FPPTKDFESQRMHDSGNFQHFNSDIQNKDSLSSMNFNSAQNDDFLNLYMELDIGSRAEMM 600
           FPPTKDFESQRMHDSGNFQHFNSDIQNKDSLSSMNFNSAQNDDFLNLYMELDIGSRAEMM
Sbjct: 541 FPPTKDFESQRMHDSGNFQHFNSDIQNKDSLSSMNFNSAQNDDFLNLYMELDIGSRAEMM 600

Query: 601 TDQFERPNRTENDMSVNSAPMQGDMSTLNSMLNASPATITNTNVPSARQNQQQDTTYNEP 660
           TDQFERPNRTENDMSVNSAPMQGDMSTLNSMLNASPATITNTNVPSARQNQQQDTTYNEP
Sbjct: 601 TDQFERPNRTENDMSVNSAPMQGDMSTLNSMLNASPATITNTNVPSARQNQQQDTTYNEP 660

Query: 661 PPYTNFSHRIMHDIDQIAHSINATE 685
           PPYTNFSHRIMHDIDQIAHSINATE
Sbjct: 661 PPYTNFSHRIMHDIDQIAHSINATE 685

>YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in the
           SIT4 pathway for CLN activation and in suppression of
           lethality due to mutations in the protein kinase C
           pathway [2556 bp, 851 aa]
          Length = 851

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 50/77 (64%), Gaps = 11/77 (14%)

Query: 295 KSGDENDASIAFSKMFTRKRANTGGSMSSLVSSTAS----------NNLPTLHRNMSTHS 344
           K  +ENDASIAFSKMFTRKRANTGGS  SL S T +          N LPT  R  S  S
Sbjct: 351 KLPEENDASIAFSKMFTRKRANTGGSTCSLASPTIAQTIQQSNIKVNKLPT-QRTTSVGS 409

Query: 345 ISSMSNRYSPIRAGSPA 361
           +SSMSNRYSPIR  SP 
Sbjct: 410 LSSMSNRYSPIRVASPG 426

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 22  ESVSKWKIPHYYRKSTGAPVRQELGSNTSLKSESNRANGNINIMTTPKHVQL-DEXXXXX 80
           ES +KWKIPHYYR+S     +     N+S  S S      +N+M++PK V L D      
Sbjct: 22  ESTNKWKIPHYYRRSASGSTQASPDRNSSTGSCSTPVLPTMNVMSSPKKVLLEDPRDNHT 81

Query: 81  XXXXXXXXXXXEMVFVNYTV 100
                      EMVFVNYTV
Sbjct: 82  KAKKSSRKKSGEMVFVNYTV 101

>AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH]
           (969101..971506) [2406 bp, 801 aa]
          Length = 801

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 63/97 (64%), Gaps = 4/97 (4%)

Query: 267 YNDQYNDR-QGHLATFRPQLNHMHT-SAYPKSGDENDASIAFSKMFTRKRANTGGSMSSL 324
           Y  Q +D  Q   AT +P L+   T S      DENDASIAFSKMFTRKRANTGGS+SS 
Sbjct: 359 YKMQLSDNGQDGAATLKPNLHTSDTFSGSYYQVDENDASIAFSKMFTRKRANTGGSLSSF 418

Query: 325 VSSTASNNLPTLHRNMSTHSISSMSNRYSPIRAGSPA 361
           VS+T + +   +  N+STHSI   S RYSPIR+ SP 
Sbjct: 419 VSNTQTISPYNIPGNISTHSIP--SQRYSPIRSHSPG 453

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 76/181 (41%), Gaps = 33/181 (18%)

Query: 17  CLTPAESVSKWKIPHYYRKSTGA--PVRQELGSNTSLKSES--------NRANGNINIMT 66
           C    ES SKWKIPHYY+K++     V  +L   TS +  +        N  N  INIM 
Sbjct: 15  CGGAIESTSKWKIPHYYKKASSVTQTVISDLNPATSSQQCATYSPTMALNGGNNRINIMN 74

Query: 67  TPKHVQLD--EXXXXXXXXXXXXXXXXEMVFVNYTVXXXXXXXXXXXXXXXXXXXXXXXX 124
           TP  VQL+  +                EMVFVN+TV                        
Sbjct: 75  TPVAVQLEDPDQPKTRKGQKAKAKKNGEMVFVNFTVQDTTESPKKPKSSRREK------- 127

Query: 125 XXGHNSGMDESFDNFSQLDVSTPQDSSDAV----QKSRSS-GSTPSSQATKRSYSSFLKY 179
                  M   F +  QL +  P D  +      ++ RS+  STP+S A+KR+YSSFLK 
Sbjct: 128 -------MLRIFKSSEQLKLR-PHDLGELAPSLSKEPRSAPASTPAS-ASKRNYSSFLKC 178

Query: 180 G 180
           G
Sbjct: 179 G 179

>KLLA0C17666g 1562996..1565368 some similarities with sp|P33306
           Saccharomyces cerevisiae YER167w BCK2 suppressor of
           mutations in protein kinase C pathway components
           singleton, hypothetical start
          Length = 790

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 73/129 (56%), Gaps = 6/129 (4%)

Query: 298 DENDASIAFSKMFTRKRANTGGSMSSLVSSTASN-NLPTLHRNMSTHSISSMSNRYSPIR 356
           DENDAS+AFSK+FTRKR NTGGS+SSL+S +A+  ++P L R+ S+ S++S S RYSPIR
Sbjct: 415 DENDASVAFSKLFTRKRTNTGGSISSLLSLSATQPSIPALDRHQSSTSVTS-SMRYSPIR 473

Query: 357 AGSPAXXXXXXXXXXXXXXXDCTLLQGSSNYADLTG----GMEIYLDSXXXXXXXXXXXX 412
           +GS                 D T LQ S   ++       GME YLD+            
Sbjct: 474 SGSQNRTRSNTRTSNHRLSRDLTSLQTSMKISNTDSSELPGMESYLDTHNKGNKPTHRKK 533

Query: 413 XDSISDSYR 421
            +SISD  R
Sbjct: 534 QESISDMAR 542

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%)

Query: 624 DMSTLNSMLNASPATITNTNVPSARQNQQQDTTYNEPPPYTNFSHRIMHDIDQIAHSINA 683
           D ST+ S +N SP T+T  N           +++       +F  RIM+DID++AH  N 
Sbjct: 725 DTSTITSGMNVSPITVTGGNTSQDEVTTLMPSSHQMHSSNLSFQSRIMNDIDRLAHGFNL 784

Query: 684 TE 685
           ++
Sbjct: 785 SD 786

>Scas_681.21
          Length = 846

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (54%)

Query: 19  TPAESVSKWKIPHYYRKSTGAPVRQELGSNTSLKSESNRANGNINIMTTPKHVQLDEXXX 78
           +P E+++KWKIPHYYR+S       +  S+ S  + S   + NIN+MT+PK + L+E   
Sbjct: 33  SPTETLNKWKIPHYYRRSNIGLSTPQTESSMSFANPSANLSPNINVMTSPKKLLLEEPKK 92

Query: 79  XXXXXXXXXXXXXEMVFVNYTV 100
                         MVFVNYTV
Sbjct: 93  SKNGSKKSQKKKGGMVFVNYTV 114

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 50/109 (45%), Gaps = 45/109 (41%)

Query: 298 DENDASIAFSKMFTRKRANTGGSMSSL--------------------------------- 324
           +ENDASIAFSKMFTRKRANT GSM+SL                                 
Sbjct: 349 EENDASIAFSKMFTRKRANTAGSMNSLRYTSNSNSNSNANANANANANANQAQLQNIYQS 408

Query: 325 VSSTASNNLPTL------------HRNMSTHSISSMSNRYSPIRAGSPA 361
           V   ++ + P L             R MS  S+SS+SNRYSP R  SPA
Sbjct: 409 VQHPSNQSQPNLKINRSSSSTTLAQRTMSVASLSSLSNRYSPNRMISPA 457

>CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306
           Saccharomyces cerevisiae YER167w suppressor of mutations
           in protein kinase C pathway components, hypothetical
           start
          Length = 847

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 15/78 (19%)

Query: 297 GDENDASIAFSKMFTRKRANTG-------------GSMSSLVSSTASNNLPTLHRNMSTH 343
           G+ENDAS+AF+K+F RKRANTG              S  ++  S  S    + HR  S +
Sbjct: 399 GEENDASVAFTKLFHRKRANTGGSTSSSNSNTTFQNSTQNITKSGVSK--ISAHRTTSLN 456

Query: 344 SISSMSNRYSPIRAGSPA 361
           S++S++NR+SPIR  SP 
Sbjct: 457 SLASIANRFSPIRTASPV 474

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 11/83 (13%)

Query: 21  AESVSKWKIPHYYR--KSTGA-PVRQELGSNTSLKSESNRANGNINIMTTPKHVQLDEXX 77
           A+SV+KW+IPHYY+  KS G+ PV + +  N+ L++  N  +     +++PK + L+E  
Sbjct: 14  ADSVNKWRIPHYYKRGKSVGSTPVSEVV--NSPLRAVQNEPS-----VSSPKKILLEE-R 65

Query: 78  XXXXXXXXXXXXXXEMVFVNYTV 100
                         +MVFVNYTV
Sbjct: 66  NRATPRSRKSSKKGQMVFVNYTV 88

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 563 SDIQNKDSLSSMNFNSAQNDDFLNLYMELDIGSRAEMMTD-QFERPNRTENDMSVNSAPM 621
           SDI   +  S +N NS +  D    Y++LD+ +  ++  D +F+ PN  E+  ++    +
Sbjct: 7   SDICGSNYYSQLNLNSHKTKDIETWYIKLDMSNIRDIKVDLEFKDPNTGESAATI----L 62

Query: 622 QGDMSTLNSMLNASP 636
           Q      N ++N  P
Sbjct: 63  QKYQFQRNELVNVIP 77

>Scas_692.4
          Length = 496

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 7/91 (7%)

Query: 598 EMMTDQFERPNRTENDMS--VNSA---PMQGDMSTL--NSMLNASPATITNTNVPSARQN 650
           E M DQ E  N+   +    VN A     Q D+ T   +  + A P +     + +A++N
Sbjct: 401 ESMNDQVENVNKKAGEFKDRVNEAFDTWSQKDLQTYLEDFGIKAKPTSTREELIQNAKEN 460

Query: 651 QQQDTTYNEPPPYTNFSHRIMHDIDQIAHSI 681
            Q    +++ P Y  + H   H + Q  +SI
Sbjct: 461 TQWFFGFDQEPYYKRYYHNAAHWMKQRLNSI 491

>Scas_636.16d
          Length = 620

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 17/81 (20%)

Query: 298 DENDASIAFSKMFT------RKRANTGGSMSSLVS--STASNNLPTL------HRNMSTH 343
           +ENDA+IAF+++ +       +R +   + S + +  S + + +PT+      +RNMS  
Sbjct: 234 EENDAAIAFNRIHSAEPFPIEERMDAIRAFSKITNKRSQSLSQVPTMKSNIQKNRNMSVT 293

Query: 344 SISS-MSN--RYSPIRAGSPA 361
           S+SS MSN  +YSP+   +P 
Sbjct: 294 SVSSNMSNLSKYSPLGTVTPG 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.122    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,715,405
Number of extensions: 734981
Number of successful extensions: 2932
Number of sequences better than 10.0: 68
Number of HSP's gapped: 3007
Number of HSP's successfully gapped: 79
Length of query: 685
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 577
Effective length of database: 12,857,365
Effective search space: 7418699605
Effective search space used: 7418699605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)