Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2345382881737400.0
YER169W (RPH1)79684917180.0
AGR117C79953215230.0
KLLA0C17710g82154314310.0
CAGL0L11880g98056513331e-170
Scas_681.1986439812901e-165
Scas_76.12282266618e-81
YDR096W (GIS1)8943706423e-71
KLLA0D10758g8501863091e-28
Kwal_55.218555212982995e-28
Sklu_2303.67951573018e-28
ABR167C7761963001e-27
CAGL0H00528g7401572963e-27
Scas_691.277351562803e-25
YJR119C7281822741e-24
CAGL0G08107g625782052e-16
Scas_709.32822551742e-12
CAGL0E04884g1489711609e-11
YKL062W (MSN4)630741581e-10
Scas_649.28730561581e-10
AGR031W140641451e-10
Sklu_2181.1410561551e-10
Scas_602.9547571562e-10
Kwal_47.17241403561542e-10
ACL057W520541543e-10
CAGL0K02145g317571503e-10
AGR172W1057681544e-10
CAGL0L06072g300561485e-10
Kwal_26.8351698561517e-10
KLLA0C17072g474561508e-10
Scas_721.921152571491e-09
KLLA0F13046g1379731492e-09
ABR089C571511472e-09
Kwal_47.166211178941482e-09
Sklu_2443.22213811393e-09
Sklu_2357.7157551363e-09
Scas_703.231341601463e-09
CAGL0M13189g541541444e-09
YJR127C (ZMS1)1380601446e-09
KLLA0F26961g694511411e-08
AFL127C15212031421e-08
AER159C1191591411e-08
KLLA0B04477g1332601412e-08
YMR037C (MSN2)704761402e-08
YML081W1251591402e-08
CAGL0M00594g1020591402e-08
YER130C443571382e-08
Sklu_2351.6548551382e-08
CAGL0F05995g597541374e-08
YDR043C (NRG1)231551314e-08
Kwal_27.10925264551325e-08
CAGL0K12078g463661346e-08
KLLA0F18524g357631337e-08
Scas_575.34551031347e-08
Scas_718.44266501317e-08
CAGL0H04213g1321811358e-08
Kwal_56.2420615021941358e-08
Scas_707.31289571301e-07
YDR216W (ADR1)1323571331e-07
Scas_569.2293551272e-07
CAGL0L07480g314651273e-07
YOR113W (AZF1)914511294e-07
KLLA0E10989g474551274e-07
YGL035C (MIG1)504661266e-07
CAGL0A01628g424551257e-07
AFR471C389551248e-07
YPL038W (MET31)177531171e-06
CAGL0K09372g396551221e-06
AFR580C838491222e-06
Scas_378.1208601162e-06
Scas_712.42*290511183e-06
Kwal_14.2278463521203e-06
CAGL0K04631g1013761213e-06
ACR264W769511213e-06
KLLA0B07909g922491213e-06
YGL209W (MIG2)382581194e-06
Scas_697.35839511195e-06
YBR066C (NRG2)220651145e-06
KLLA0F23782g782501195e-06
Kwal_47.17888786501195e-06
Scas_717.17525561185e-06
Scas_693.31635801186e-06
Scas_719.681350591187e-06
KLLA0B03454g472891177e-06
KLLA0C16203g14542001179e-06
AGL207W277501149e-06
YGR067C794511161e-05
YDR146C (SWI5)709801151e-05
Scas_683.25879511152e-05
YMR176W (ECM5)14112141133e-05
YPL230W391571095e-05
Kwal_47.19045266771077e-05
CAGL0L03916g642501097e-05
KLLA0B00605g239511059e-05
YDR253C (MET32)191521031e-04
CAGL0H07557g476551071e-04
Scas_568.5199541012e-04
Kwal_26.8021507531042e-04
YJL056C (ZAP1)880481043e-04
CAGL0C02519g318501024e-04
AGL197W844731034e-04
CAGL0M06831g645481034e-04
Scas_636.14d275621014e-04
AEL174W661741034e-04
Scas_720.33316531015e-04
Kwal_27.11460531681025e-04
Scas_687.33288511005e-04
KLLA0C16005g331731005e-04
Kwal_23.5400429781016e-04
KLLA0F20636g285661006e-04
AGL071C396531006e-04
Kwal_56.23925745851016e-04
CAGL0M01870g31560997e-04
YMR070W (MOT3)490581007e-04
YER028C39451998e-04
Scas_627.17d27562980.001
KLLA0D16456g854471000.001
Scas_720.3914551991000.001
KLLA0F11682g37471990.001
CAGL0K03003g64763990.001
CAGL0J05060g71346990.001
KLLA0E08679g59642980.001
KLLA0E18645g43152970.002
CAGL0E06116g61343960.003
Scas_631.743365950.003
AEL278W47696950.003
YMR182C (RGM1)21144920.004
Sklu_2389.276744950.004
ADL198W54749940.004
Scas_717.60d16761890.005
CAGL0E01331g68973930.005
YLR131C (ACE2)77063930.007
CAGL0M04323g70379930.007
AGL246W22754890.008
Scas_711.5683241920.008
CAGL0B02651g18952880.009
CAGL0G10021g39453900.010
Scas_695.257149900.014
YPR186C (PZF1)42987890.015
Sklu_1527.120559870.015
CAGL0I02838g65541890.020
Kwal_14.220625448860.024
YNL027W (CRZ1)67858880.025
KLLA0F01463g78163880.026
KLLA0A04609g42355870.027
CAGL0L12562g22355840.033
Kwal_27.1046730250850.034
AFL136W40943860.035
Scas_721.5619953830.037
Kwal_14.254371154850.055
ADR308C27879830.055
Kwal_47.1657788150850.056
Scas_718.6747379830.072
Sklu_2126.544844820.11
Kwal_27.1182419953790.12
Scas_627.6120780820.13
Scas_718.36d33050800.16
KLLA0D11902g28954790.17
CAGL0E03762g58466800.19
CAGL0L00583g38839790.21
KLLA0E00726g51749790.22
Scas_604.458535790.23
Sklu_2244.327151780.28
Sklu_2289.129152770.37
Sklu_2436.951777770.38
CAGL0E04312g68878760.54
YDL020C (RPN4)53173760.58
CAGL0K01727g49957760.63
YHL027W (RIM101)62545760.66
YPR022C113351760.68
KLLA0A10373g20660730.68
Kwal_47.1833753680750.80
Scas_670.30864105750.86
AFR190C43244740.98
Scas_660.1236764731.1
Kwal_26.930030473731.1
CAGL0K02343g116267741.1
Scas_713.1146557731.1
CAGL0I02816g29155721.2
YLR375W34347731.3
KLLA0F10109g62364721.6
Scas_641.2453282721.6
Kwal_55.2063441966711.9
YGL254W (FZF1)29954711.9
AFR461C54489722.0
YDR463W (STP1)51986712.0
YHR006W (STP2)54190712.1
Kwal_33.1422755191712.3
Scas_670.243569702.9
Sklu_2359.572265703.6
ADL040W33051684.1
CAGL0K04697g51567684.7
Scas_712.232752675.5
Kwal_27.1016728573667.0
Scas_683.3047847677.0
Scas_677.33168568678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23453
         (817 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23453                                                        1445   0.0  
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...   666   0.0  
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...   591   0.0  
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...   555   0.0  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...   518   e-170
Scas_681.19                                                           501   e-165
Scas_76.1                                                             259   8e-81
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...   251   3e-71
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...   123   1e-28
Kwal_55.21855                                                         119   5e-28
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                          120   8e-28
ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2...   120   1e-27
CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces cer...   118   3e-27
Scas_691.27                                                           112   3e-25
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...   110   1e-24
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    84   2e-16
Scas_709.32                                                            72   2e-12
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    66   9e-11
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    65   1e-10
Scas_649.28                                                            65   1e-10
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    60   1e-10
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            64   1e-10
Scas_602.9                                                             65   2e-10
Kwal_47.17241                                                          64   2e-10
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    64   3e-10
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    62   3e-10
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    64   4e-10
CAGL0L06072g complement(679924..680826) some similarities with s...    62   5e-10
Kwal_26.8351                                                           63   7e-10
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    62   8e-10
Scas_721.92                                                            62   1e-09
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    62   2e-09
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    61   2e-09
Kwal_47.16621                                                          62   2e-09
Sklu_2443.22 , Contig c2443 45390-46027                                58   3e-09
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        57   3e-09
Scas_703.23                                                            61   3e-09
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    60   4e-09
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    60   6e-09
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    59   1e-08
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    59   1e-08
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    59   1e-08
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    59   2e-08
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    59   2e-08
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    59   2e-08
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    59   2e-08
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    58   2e-08
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       58   2e-08
CAGL0F05995g complement(598819..600612) some similarities with s...    57   4e-08
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    55   4e-08
Kwal_27.10925                                                          55   5e-08
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    56   6e-08
KLLA0F18524g complement(1701498..1702571) some similarities with...    56   7e-08
Scas_575.3                                                             56   7e-08
Scas_718.44                                                            55   7e-08
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    57   8e-08
Kwal_56.24206                                                          57   8e-08
Scas_707.31                                                            55   1e-07
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    56   1e-07
Scas_569.2                                                             54   2e-07
CAGL0L07480g complement(822240..823184) some similarities with s...    54   3e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    54   4e-07
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    54   4e-07
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    53   6e-07
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    53   7e-07
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    52   8e-07
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    50   1e-06
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    52   1e-06
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    52   2e-06
Scas_378.1                                                             49   2e-06
Scas_712.42*                                                           50   3e-06
Kwal_14.2278                                                           51   3e-06
CAGL0K04631g complement(440721..443762) some similarities with s...    51   3e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    51   3e-06
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    51   3e-06
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    50   4e-06
Scas_697.35                                                            50   5e-06
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    49   5e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    50   5e-06
Kwal_47.17888                                                          50   5e-06
Scas_717.17                                                            50   5e-06
Scas_693.31                                                            50   6e-06
Scas_719.68                                                            50   7e-06
KLLA0B03454g complement(314015..315433) some similarities with s...    50   7e-06
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    50   9e-06
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    49   9e-06
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    49   1e-05
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    49   1e-05
Scas_683.25                                                            49   2e-05
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    48   3e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    47   5e-05
Kwal_47.19045                                                          46   7e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    47   7e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    45   9e-05
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    44   1e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    46   1e-04
Scas_568.5                                                             44   2e-04
Kwal_26.8021                                                           45   2e-04
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    45   3e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    44   4e-04
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    44   4e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    44   4e-04
Scas_636.14d                                                           44   4e-04
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    44   4e-04
Scas_720.33                                                            44   5e-04
Kwal_27.11460                                                          44   5e-04
Scas_687.33                                                            43   5e-04
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    43   5e-04
Kwal_23.5400                                                           44   6e-04
KLLA0F20636g complement(1914452..1915309) some similarities with...    43   6e-04
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    43   6e-04
Kwal_56.23925                                                          44   6e-04
CAGL0M01870g complement(219813..220760) some similarities with t...    43   7e-04
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    43   7e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    43   8e-04
Scas_627.17d                                                           42   0.001
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    43   0.001
Scas_720.39                                                            43   0.001
KLLA0F11682g complement(1068992..1070116) some similarities with...    43   0.001
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    43   0.001
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    43   0.001
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    42   0.001
KLLA0E18645g complement(1648263..1649558) some similarities with...    42   0.002
CAGL0E06116g complement(604708..606549) some similarities with t...    42   0.003
Scas_631.7                                                             41   0.003
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    41   0.003
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    40   0.004
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            41   0.004
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    41   0.004
Scas_717.60d                                                           39   0.005
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    40   0.005
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    40   0.007
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    40   0.007
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    39   0.008
Scas_711.56                                                            40   0.008
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    39   0.009
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    39   0.010
Scas_695.2                                                             39   0.014
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    39   0.015
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             38   0.015
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    39   0.020
Kwal_14.2206                                                           38   0.024
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    39   0.025
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    39   0.026
KLLA0A04609g complement(411494..412765) some similarities with s...    38   0.027
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    37   0.033
Kwal_27.10467                                                          37   0.034
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    38   0.035
Scas_721.56                                                            37   0.037
Kwal_14.2543                                                           37   0.055
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    37   0.055
Kwal_47.16577                                                          37   0.056
Scas_718.67                                                            37   0.072
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            36   0.11 
Kwal_27.11824                                                          35   0.12 
Scas_627.6                                                             36   0.13 
Scas_718.36d                                                           35   0.16 
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    35   0.17 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    35   0.19 
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    35   0.21 
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    35   0.22 
Scas_604.4                                                             35   0.23 
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                35   0.28 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          34   0.37 
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          34   0.38 
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    34   0.54 
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    34   0.58 
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    34   0.63 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    34   0.66 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    34   0.68 
KLLA0A10373g complement(907244..907864) some similarities with c...    33   0.68 
Kwal_47.18337                                                          33   0.80 
Scas_670.30                                                            33   0.86 
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    33   0.98 
Scas_660.12                                                            33   1.1  
Kwal_26.9300                                                           33   1.1  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   1.1  
Scas_713.11                                                            33   1.1  
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    32   1.2  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    33   1.3  
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    32   1.6  
Scas_641.24                                                            32   1.6  
Kwal_55.20634                                                          32   1.9  
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    32   1.9  
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    32   2.0  
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    32   2.0  
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    32   2.1  
Kwal_33.14227                                                          32   2.3  
Scas_670.2                                                             32   2.9  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          32   3.6  
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    31   4.1  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    31   4.7  
Scas_712.2                                                             30   5.5  
Kwal_27.10167                                                          30   7.0  
Scas_683.30                                                            30   7.0  
Scas_677.33                                                            30   8.4  

>Kwal_56.23453
          Length = 828

 Score = 1445 bits (3740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/817 (86%), Positives = 709/817 (86%)

Query: 1   MSEVAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPG 60
           MSEVAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPG
Sbjct: 1   MSEVAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPG 60

Query: 61  VETLQKIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPXXXXXXXXXX 120
           VETLQKIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLP          
Sbjct: 61  VETLQKIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPDGGGEASGSS 120

Query: 121 XXXXXXTLGAXXXXXXXXXXXXXXXXXESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLE 180
                 TLGA                 ESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLE
Sbjct: 121 EADAGDTLGARKSPSPLKSSKIKLRSPESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLE 180

Query: 181 SYFWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWK 240
           SYFWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWK
Sbjct: 181 SYFWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWK 240

Query: 241 ASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKT 300
           ASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKT
Sbjct: 241 ASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKT 300

Query: 301 FLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIK 360
           FLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIK
Sbjct: 301 FLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIK 360

Query: 361 AKRCLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSAS 420
           AKRCLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSAS
Sbjct: 361 AKRCLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSAS 420

Query: 421 TKQPSEGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYE 480
           TKQPSEGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYE
Sbjct: 421 TKQPSEGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYE 480

Query: 481 LQAMEDNPQQSAIRSTTPNPGQYYXXXXXXXXXXXXXXXXXMMDLSNIVEPTLEDPTXXX 540
           LQAMEDNPQQSAIRSTTPNPGQYY                 MMDLSNIVEPTLEDPT   
Sbjct: 481 LQAMEDNPQQSAIRSTTPNPGQYYSGLSQSISRISSPLLSRMMDLSNIVEPTLEDPTLKF 540

Query: 541 XXXXXXXXXXXXTPQVLEDNDDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVAGDSM 600
                       TPQVLEDNDDN                              AVAGDSM
Sbjct: 541 KKSSNLSQQNSQTPQVLEDNDDNMLALSLASMASGASSPRYPLPPIQPRPYSPAVAGDSM 600

Query: 601 LASGPLYEQNPFSYYSTNFKSTMGSPQPSSPALSNLPFIKRLKSPNRVTLNISRESSRSP 660
           LASGPLYEQNPFSYYSTNFKSTMGSPQPSSPALSNLPFIKRLKSPNRVTLNISRESSRSP
Sbjct: 601 LASGPLYEQNPFSYYSTNFKSTMGSPQPSSPALSNLPFIKRLKSPNRVTLNISRESSRSP 660

Query: 661 ILLNSEFKSPLSNNIAANGNTAVNSNLSQATTVEHXXXXXXXXXXXXXADFSKRPIAPSK 720
           ILLNSEFKSPLSNNIAANGNTAVNSNLSQATTVEH             ADFSKRPIAPSK
Sbjct: 661 ILLNSEFKSPLSNNIAANGNTAVNSNLSQATTVEHSPPVSPPIPNNSIADFSKRPIAPSK 720

Query: 721 INSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVL 780
           INSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVL
Sbjct: 721 INSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVL 780

Query: 781 QHLNKKIPCTAEGGQSPSSKSTKDEEIVIERSGERFV 817
           QHLNKKIPCTAEGGQSPSSKSTKDEEIVIERSGERFV
Sbjct: 781 QHLNKKIPCTAEGGQSPSSKSTKDEEIVIERSGERFV 817

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/849 (45%), Positives = 474/849 (55%), Gaps = 149/849 (17%)

Query: 4   VAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVET 63
           +APS   GGVPVF+P YE+F+DFY Y +A++KYG KSG+VKVIPP+EW D+L++P   ET
Sbjct: 5   IAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAET 64

Query: 64  LQKIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPXXXXXXXXXXXXX 123
           LQKI+I++PIQQH +G+KG+F+VQNVEK+K+YNIIQWKD+S DY  P             
Sbjct: 65  LQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARR------ 118

Query: 124 XXXTLGAXXXXXXXXXXXXXXXXXESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYF 183
                 +                  SF+  +FE+F   Y  D L DF++  R +FLE Y+
Sbjct: 119 -----NSRKGSVSKSTKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYY 172

Query: 184 WKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASF 243
           WKTL FT PMYGAD+ GS+F + L+VWNV+KLPNILDHM TKVPGVN SYLYAGLWKASF
Sbjct: 173 WKTLNFTTPMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASF 232

Query: 244 SWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLV 303
           SWHLEDQDLYSINYIHFGAPKQWYSIPQED  KFYKFMQEQFPE A  C EFLRHK FL 
Sbjct: 233 SWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLA 292

Query: 304 SPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAKR 363
           SPK+L++NGIRCN+IVH++ EF+ITYPYGYHAGFNYGYNLAESVNFALE WL IG KA +
Sbjct: 293 SPKLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGK 352

Query: 364 CLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSASTKQ 423
           C CI D+V ID                                 V K AK  +D      
Sbjct: 353 CHCISDSVEID---------------------------------VKKLAKSWRD------ 373

Query: 424 PSEGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYELQA 483
                      N+K  K        TP    P N+L N   P       LLH  +  L+ 
Sbjct: 374 -----------NNKESKG-------TP----PLNQLPNPAMP-------LLHRPT--LKE 402

Query: 484 MEDNPQQSAIRSTTPNPGQYYXXXXXXXXXXXXXXXXXMMDLSNIVEPTLEDPTXXXXXX 543
           ME     S++RST+P+ G ++                 M D SNIVEPTLEDPT      
Sbjct: 403 MES----SSLRSTSPDVG-HFSNFKSKSSGVSSPLLSRMKDYSNIVEPTLEDPTLKLKRI 457

Query: 544 XX--------XXXXXXXTPQVLEDNDDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAV 595
                               +L D++DN                              + 
Sbjct: 458 SSFQEQPLNKLLKRETSQTAMLTDHEDNIVAMSLTSMANSAASSPRLPLSRLNSSNELSN 517

Query: 596 A------GDSMLA----SGPLYEQNPFSYYSTNFKSTMGSPQPSSPALSNLPFIKRLKSP 645
           A       ++ LA    +GP    NP  Y S    S +    P SP   N+  IKR+KSP
Sbjct: 518 AQPLLDMTNNTLAFPRPNGP-SGLNPLLYISNKNISGISHSAPHSPVNPNISLIKRVKSP 576

Query: 646 NRVTLNISRESSRSPILLNSEFKSPLSN-------NIAANGNTAVNSNLSQATTVE---- 694
           N VTLNISRESSRSPI LN E +   S        +  +N +T+V   LS    ++    
Sbjct: 577 NIVTLNISRESSRSPIALNYEARQQHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHP 636

Query: 695 ---HXXXXXXXXXXXXXADFSKRPIAPSKINS---------------------------- 723
              +              + SK  +  SK+ S                            
Sbjct: 637 ERPNHKTANRILKKESPVETSKSNLILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFA 696

Query: 724 -EEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
            EEI++S K K+Y+C+EC+R+FSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQH
Sbjct: 697 PEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQH 756

Query: 783 LNKKIPCTA 791
           LNKKIPC +
Sbjct: 757 LNKKIPCIS 765

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/532 (55%), Positives = 360/532 (67%), Gaps = 54/532 (10%)

Query: 6   PSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVETLQ 65
           P  +EGGVPVFRP++E F+DFY+YM  +D+YG KSG+VK+IPP+EW+++L   PGVE L+
Sbjct: 5   PDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLR 64

Query: 66  KIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPXXXXXXXXXXXXXXX 125
           +I IR+PIQQH +GSKGVFVVQNVE+ KSYNIIQWKD++ DY+LP               
Sbjct: 65  RIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMRGYGGSL------ 118

Query: 126 XTLGAXXXXXXXXXXXXXXXXXESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYFWK 185
            +  A                 +SFSD +F +F  HYN + L  + D S    LE+Y+WK
Sbjct: 119 -SRSAAAGGARPRPSNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWK 177

Query: 186 TLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASFSW 245
           TL FT PMYGAD+LG+LF D L  WNVS+LPN+LDH+  KVPGVN SYLYAGLWKASF+W
Sbjct: 178 TLNFTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAW 237

Query: 246 HLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSP 305
           HLEDQDLYSINY+HFGAPKQWYSIPQEDS KF+KFMQEQFPE +A+C EFLRHK F+VSP
Sbjct: 238 HLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSP 297

Query: 306 KILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAKRCL 365
           K+LE+NGIRCN IVH Q EF++TYPYGYH+GFNYGYNLAESVNFALE+WL IG KAK+C+
Sbjct: 298 KVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCM 357

Query: 366 CIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSASTKQPS 425
           C+DD+VGID++KL+  +  S Q                            +D A +  P 
Sbjct: 358 CVDDSVGIDIQKLKSAYFRSLQ----------------------------EDRAGSADPE 389

Query: 426 EGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYELQAME 485
              K   +K + +  S ++      G SL             K FNEL++HS+YELQAME
Sbjct: 390 PPRKR--LKQEPNTSSFVQAPILDTGDSL-------------KSFNELINHSAYELQAME 434

Query: 486 DNPQQSAIRSTTPNPGQYYXXXXXXXXXXXXXXXXXMMDLSNIVEPTLEDPT 537
           DNP Q +IRSTTPN  QY+                 MMDLSNIVEPTLEDPT
Sbjct: 435 DNPNQRSIRSTTPN--QYF--SNPSISRMSSPLLSRMMDLSNIVEPTLEDPT 482

 Score =  207 bits (527), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 141/248 (56%), Gaps = 53/248 (21%)

Query: 596 AGDSMLASGPLYEQNPFSYYSTNFKSTMGSPQPSSPALSNLPFIKRLKSPNRVTLNISRE 655
            GD++LA  P Y+QNP SYYST    T  SP         +P  KR+ SPNRVTLNISRE
Sbjct: 564 TGDAILAPRPSYDQNPLSYYSTQ---TTKSP---------MPLFKRINSPNRVTLNISRE 611

Query: 656 SSRSPILLNSEF-KSPLSNNIAANGNTAVNSNLSQATTVEHXXXXXXXXXXXX------- 707
           SSRSPI   SE+ K PLS     N      ++L+Q +T+E                    
Sbjct: 612 SSRSPISFGSEYGKPPLSKPHPLNAGAVNLTSLNQVSTIERNIPSHRDRSAKAYHGDKVN 671

Query: 708 --------------------------------XADFSKRPIAP-SKINSEEIIVSDKGKV 734
                                            A   +R  +P SKI++EEII+SDKGK 
Sbjct: 672 IHGVSSGKFVGHQINDSLALLNDDALTNSVLPGAGRPERATSPTSKISAEEIIISDKGKA 731

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGG 794
           YVCQEC+RQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC  E  
Sbjct: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVTEKH 791

Query: 795 QSPSSKST 802
           + P++ + 
Sbjct: 792 EDPATATA 799

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/543 (52%), Positives = 358/543 (65%), Gaps = 46/543 (8%)

Query: 6   PSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVETLQ 65
           P  +EG VPVF+P+YE F+DFY++M  V+KYG KSGI+K++PP++W+D++  PP  ETLQ
Sbjct: 5   PDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETLQ 64

Query: 66  KIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPXXXXXXXXXXXXXXX 125
           KI+I+TPIQQH +GSKGVFVVQNVEK KSYN+IQWK +S+DY+LP               
Sbjct: 65  KIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNE------ 118

Query: 126 XTLGAXXXXXXXXXXXXXXXXXESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYFWK 185
               +                 +SF+  +FEKF  ++N D+L  F D  R EFLESY+WK
Sbjct: 119 ---DSSGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWK 175

Query: 186 TLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASFSW 245
           TL FT PMYGADSLGSLF+D +  WN+S LP+IL++++ KVPGVN SYLYAGLWKASF+W
Sbjct: 176 TLNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAW 235

Query: 246 HLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSP 305
           HLEDQDLYSINYIHFGAPKQWYSIPQEDS+KFY FM+EQFPE +  C EFLRHK FLVSP
Sbjct: 236 HLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSP 295

Query: 306 KILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAKRCL 365
           K+L+ NGIRCN IVH QQEFI+TYP+GYHAGFNYGYNLAESVNFAL +WLDIG KAK+CL
Sbjct: 296 KLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCL 355

Query: 366 CIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSASTKQPS 425
           CIDDAVGI+V+KLR +++ S     + +   E+Q  +  S+  + +   E+     + P 
Sbjct: 356 CIDDAVGINVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEE-----RPPL 410

Query: 426 EGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYELQAME 485
           +  K  D     SD+S              F+ + +     +K  ++LL   +       
Sbjct: 411 KKFKMGD-----SDRS--------------FDSVKSTPEFLLKTNSDLLDEKANLDNLNN 451

Query: 486 DNPQQSAIRSTTPN---PGQY--------YXXXXXXXXXXXXXXXXXMMDLSNIVEPTLE 534
           +    S+IRSTTPN    G Y                          MMDLS+IVEPTLE
Sbjct: 452 N--NNSSIRSTTPNSQKTGLYGFGIKKEGAFNSNTSISRVSSPLLSRMMDLSHIVEPTLE 509

Query: 535 DPT 537
           DPT
Sbjct: 510 DPT 512

 Score =  188 bits (478), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/223 (49%), Positives = 133/223 (59%), Gaps = 24/223 (10%)

Query: 595 VAGDSMLASGPLYEQNPFSY-YSTNFKSTMGSPQPSSPALSNLPFIKRLKSPNRVTLNIS 653
           +  DS+L+  P Y  N  SY  + N KS +G    S+     LPFIKR++SPNRVTLNIS
Sbjct: 599 ILQDSILSPRPSYNSNVLSYGQAGNTKSPLGGFSSST----QLPFIKRIQSPNRVTLNIS 654

Query: 654 RESSRSPILLNSEFKSP--LSNNIAANGNTAVNSNLSQATTVEHXXXXXXXXXXXXX--- 708
           RESSRSP+ L+  + +P  +   I     ++  S L+Q +T E                 
Sbjct: 655 RESSRSPVSLSGMYGNPNAMMVPIPHPYQSSQTSTLNQVSTAERSPAVTPPTSPSKNKPA 714

Query: 709 -------------ADFSKRPIAPSKINSEEIIVSDKG-KVYVCQECRRQFSSGHHLTRHK 754
                         +     +A SKIN EEI+  D G KVYVCQEC RQFSSGHHLTRHK
Sbjct: 715 RKKAPKQPKAKIDPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHK 774

Query: 755 KSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGGQSP 797
           KSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC  +   +P
Sbjct: 775 KSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPDQDTAP 817

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score =  518 bits (1333), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 265/565 (46%), Positives = 354/565 (62%), Gaps = 44/565 (7%)

Query: 12  GVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVETLQKIRIRT 71
           GVPVFRP +E FKDF  YM  +  +G  SGIVKVIPP+EWLD+    P  + L+++RIR 
Sbjct: 6   GVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVRIRN 65

Query: 72  PIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPXXXXXXXXXXXXXXXXTLGAX 131
           PIQQH +GSKGV+++ NVEK+K+YN+IQWKD+SYD+R+P                     
Sbjct: 66  PIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDN--ER 123

Query: 132 XXXXXXXXXXXXXXXXESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYFWKTLAFTP 191
                           +S ++ +F+ F   YN +N+ DF D  R +FLESY+WKTL FT 
Sbjct: 124 SQQRRRSSSGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLNFTT 183

Query: 192 PMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQD 251
           P+YGADS GS+F   L+ WNV+KLPN+L H++  +PGVN +YLYAGLWKASF+WHLEDQD
Sbjct: 184 PLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQD 243

Query: 252 LYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSPKILEKN 311
           LYSINYIHFGAPKQWYSIPQED +KFY+FM+E+FPE A+KC EFLRHK FLVSPK+L++N
Sbjct: 244 LYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVLKEN 303

Query: 312 GIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAKRCLCIDDAV 371
            I+CNK+ HY+ EFIITYPYGYHAGFNYGYNLAESVNFALE+WL+IG KA +C CI D+V
Sbjct: 304 NIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCISDSV 363

Query: 372 GIDVEKLRDDW--LSSKQKAEKPKVKHEIQESQRGSNGVSKK------AKFEKDSASTKQ 423
            +DV+KL ++W     K++ E P+ +   Q+ ++ S   S +      A  E D    + 
Sbjct: 364 EVDVDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATKEDDEVKNED 423

Query: 424 PSEGSK-------------------NADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKEN 464
             + SK                   + DV+   +D +  +   P     +  N+   + N
Sbjct: 424 NDDNSKLIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTKIEAN 483

Query: 465 -----PRMKGFNELLHHSSYELQAME----DNP---QQSAIRSTTPNPGQYYXXXXXXXX 512
                 +++GF+ELL+ S      ME    ++P   + S +RS +P    ++        
Sbjct: 484 VPGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFARDSPLRSNSPGTNLFF---NQSIQ 540

Query: 513 XXXXXXXXXMMDLSNIVEPTLEDPT 537
                    M+DLSNIVEPTL+DPT
Sbjct: 541 RMSSPILSKMIDLSNIVEPTLDDPT 565

 Score =  145 bits (367), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (80%), Gaps = 3/94 (3%)

Query: 720 KINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 779
           K    E+I+SD GK+YVCQEC+RQFSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHV
Sbjct: 887 KFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHV 946

Query: 780 LQHLNKKIPCTAEGGQSPSS---KSTKDEEIVIE 810
           LQHLNKKIPC    G S  +   +  KD++ ++E
Sbjct: 947 LQHLNKKIPCIPGVGSSAGTDMVQVMKDDDRIME 980

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 611 PFSYYSTNFKST---MGSPQPSSPALSNLPFIKRLKSPNRVTLNISRESSRSPILLNSEF 667
           P  YY   F+ T   M SP P SP  SN+PFIKRLKSPN VTLNISRE S+SP+ L +E 
Sbjct: 700 PVPYYGNQFERTFNSMPSPIPMSPGGSNMPFIKRLKSPNIVTLNISREGSKSPVSLQNEV 759

Query: 668 KSPLSNNIA 676
           +SPL  N  
Sbjct: 760 RSPLGLNTT 768

>Scas_681.19
          Length = 864

 Score =  501 bits (1290), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 289/398 (72%), Gaps = 7/398 (1%)

Query: 2   SEVAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGV 61
           S++ P+  E G+P+F+P ++ FKDFY++M A++K+G +SGIVKVIPP EWL  L+ PP V
Sbjct: 5   SDIKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSV 64

Query: 62  ETLQKIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPXXXXXXXXXXX 121
           E LQ I+I+ PI+Q  +G+ G+F+  N+E+SK+Y+IIQWK++S DY LP           
Sbjct: 65  EALQGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKD 124

Query: 122 XXXXXTLGAXXXXXXXXXXXXXXXXXESFSDAEFEKFSAHYNHDN--LGDFRDPSRREFL 179
                  G                   SFS  +F+ F  ++N  +  L  F D  R  FL
Sbjct: 125 PDTNN--GKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFL 182

Query: 180 ESYFWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLW 239
           E+Y+WKTL FT PMYGAD+ GS+F + L+VWNVSKLPN+LD+++ ++PGVN S+LYAGLW
Sbjct: 183 ENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLW 242

Query: 240 KASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHK 299
           KASF WHLEDQDLYSIN+IHFGAPKQWYSIPQED   FY FM+EQFPE A KC EFLRHK
Sbjct: 243 KASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHK 302

Query: 300 TFLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGI 359
           TF+ SPK+L +NGIRCNKIVHYQ EF+IT+PYGYHAGFNYGYNLAESVNFALE WL+IG 
Sbjct: 303 TFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGE 362

Query: 360 KAKRCLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHE 397
           +A +CLC++D+V IDV KL  +W   K    KP +K+E
Sbjct: 363 RANKCLCVNDSVEIDVRKLASNWYIFKN---KPNLKNE 397

 Score =  207 bits (527), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 160/440 (36%), Positives = 194/440 (44%), Gaps = 97/440 (22%)

Query: 459 LTNKENPRMKGFNELLHHSSYELQAMEDNPQ------------QSAIRSTTPNPGQYYXX 506
           L N+ + R++ F ELL+HSS ELQ ++   Q              ++RST+P P Q++  
Sbjct: 394 LKNETDLRVRSFTELLNHSSQELQNIQKKQQVQPIRTFTESNKDVSLRSTSPTPSQFFTT 453

Query: 507 XXXXXXXXXXXXX---XXMMDLSNIVEPTLEDPTXXXXXXXXXXXXXXXTPQ-------- 555
                             MMDLSNIVEPTLEDPT                          
Sbjct: 454 NETNKPVISRVSSPFLSRMMDLSNIVEPTLEDPTLKFKRKLNAPSVSQNNTLPPISMPPL 513

Query: 556 ----VLEDNDDNXXXXXXXXXXXXXXXX--------------XXXXXXXXXXXXXXAVAG 597
               +LEDN+DN                                             +A 
Sbjct: 514 FQSPLLEDNEDNMIALSLANMANSGTSSPRLIIPALNSSIDPINSSSSNGNDRISSILAP 573

Query: 598 DSMLASGPLY---EQNPFSY---YSTNFKSTMGSPQPSSPA-LSNLPFIKRLKSPNRVTL 650
              L+S P       NP +Y   +S +  +   +  P SP   SNL FIKR+KSPN VTL
Sbjct: 574 KPSLSSSPYVTSNNNNPMTYNSTFSNHNNNIQNNVVPLSPGGRSNLSFIKRIKSPNIVTL 633

Query: 651 NISRESSRSPIL-------------------------LNS-EFKSPLSNNIAANGNTAVN 684
           NISRE+SRSPIL                         LN  E  +PL N+   N NT  N
Sbjct: 634 NISRETSRSPILTSVPDFRSNNNNTGTLPYSAIPQSSLNQMELNNPLGND-DTNNNTVTN 692

Query: 685 SNLS---------QATT-------------VEHXXXXXXXXXXXXXADFSKRPIAPSKIN 722
           S LS         Q  T             VE               + +       K  
Sbjct: 693 SELSILNQPPQKKQRLTNGTRSNQRKMELGVEQPSGDGVLIGNSSSNNNNNTNAQAPKFT 752

Query: 723 SEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           S+EII+S+ GKVYVC EC+RQF+SGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH
Sbjct: 753 SDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812

Query: 783 LNKKIPCTAEGGQSPSSKST 802
           LNKKIPC  E G S +  +T
Sbjct: 813 LNKKIPCVPEEGSSNAIATT 832

>Scas_76.1
          Length = 228

 Score =  259 bits (661), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 150/226 (66%), Gaps = 19/226 (8%)

Query: 86  VQNVEKSKSYNIIQWKDISYDYRLPXXXXXXXXXXXXXXXXTLGAXXXXXXXXXXXXXXX 145
           VQNVEK+K YNIIQWKD+S+DY+ P                +  A               
Sbjct: 1   VQNVEKNKIYNIIQWKDLSHDYKPPEGSSSTDPSTKGMNTRSRNASVGEEDAEHETNSEH 60

Query: 146 XX-------------------ESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYFWKT 186
                                E+F+  +FE+F   YN +NL    +PSR EFLESY+W+T
Sbjct: 61  VTQKKKSQSPMKSSKIKLRNHENFTLEDFEEFLPSYNCENLSQLTEPSRLEFLESYYWRT 120

Query: 187 LAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASFSWH 246
           L FT PMYGAD+LGSLF DKLD WNVS+LPN+LDHM+ ++PGVN SYLYAGLWKASF+WH
Sbjct: 121 LNFTTPMYGADTLGSLFNDKLDTWNVSRLPNLLDHMDRRLPGVNDSYLYAGLWKASFAWH 180

Query: 247 LEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKC 292
           LEDQDLYSINY+HFGAPKQWYSIPQ+DS KFYKFMQ+QFPE AAK 
Sbjct: 181 LEDQDLYSINYLHFGAPKQWYSIPQQDSHKFYKFMQDQFPEDAAKL 226

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score =  251 bits (642), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 132/370 (35%), Positives = 198/370 (53%), Gaps = 53/370 (14%)

Query: 3   EVAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVE 62
           E+ P     GVPVF+P+   F +F  ++  + K+G ++GIVKVIPP+EWL+ LE  P  E
Sbjct: 2   EIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAE 61

Query: 63  TLQKIRIRTPIQQHFN----GSKGVFVVQNVEKSKSYNIIQWKDI--SYDYRLPXXXXXX 116
           +L+ I++ +PIQQ          GVF ++N   +KSYN+ QWK++  S D R+       
Sbjct: 62  SLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRI------- 114

Query: 117 XXXXXXXXXXTLGAXXXXXXXXXXXXXXXXXESFSDAEFEKFSAHYNHDNLGDFRDPSRR 176
                                           S  D   +    +   D+  D  D ++ 
Sbjct: 115 --------------------------------SQGDFNDKTLKENCRVDSQQDCYDLAQL 142

Query: 177 EFLESYFWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYA 236
           + LES FWKT+AF+ P Y  D   S+F   L +WN++ LP+ ++  N +        L  
Sbjct: 143 QILESDFWKTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLT 194

Query: 237 GLWKASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFL 296
           G  K  F WHL++Q+  SINY+HFGAPKQWYSIP  ++D+F K + ++   +   C  F+
Sbjct: 195 GQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFI 254

Query: 297 RHKTFLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLD 356
           RH+  + SP  L KN I+ N++V +Q EFIIT+PY  ++GFNYGYN  ES+ F L+    
Sbjct: 255 RHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAV 314

Query: 357 IGIKAKRCLC 366
           +  +  +C C
Sbjct: 315 VRKQPLKCGC 324

 Score =  144 bits (363), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (90%)

Query: 719 SKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDH 778
           SK    E+I+SD GK+Y+C+EC RQFSSGHHLTRHKKSVHSGEKPHSCP+CGK+FKRRDH
Sbjct: 812 SKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDH 871

Query: 779 VLQHLNKKIPCTAE 792
           VLQHLNKKIPCT E
Sbjct: 872 VLQHLNKKIPCTQE 885

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (55%), Gaps = 13/84 (15%)

Query: 466 RMKGFNELLHHSSYELQAMEDN------------PQQSAIRSTTPNP-GQYYXXXXXXXX 512
           +++ F+ELL+HSS ELQ +EDN            PQ S++RSTTPN   Q+         
Sbjct: 362 KVRSFDELLNHSSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQTTIS 421

Query: 513 XXXXXXXXXMMDLSNIVEPTLEDP 536
                    MMDLSNIVEPTL+DP
Sbjct: 422 RISSPLLSRMMDLSNIVEPTLDDP 445

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 5/75 (6%)

Query: 599 SMLASGPLYEQNPFSYYSTNFKSTMGSP-QPSSPALSNLPFIKRLKSPNRVTLNISRESS 657
           S+++  P Y  NP S Y TN K+ + S   P SP+ SN+PF+KR    N VTLNISRE+S
Sbjct: 638 SIVSPNPTYSPNPLSLYLTNSKNPLNSGLAPLSPSTSNIPFLKR---NNVVTLNISREAS 694

Query: 658 RSPI-LLNSEFKSPL 671
           +SPI    ++++SPL
Sbjct: 695 KSPISSFVNDYRSPL 709

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score =  123 bits (309), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 186 TLAFTPPMYGADSLGSLFQDKLDV----WNVSKLP----NILDHMNTKVPGVNGSYLYAG 237
           T+ + PP +  D     F+  L V    WN+  LP    ++L  +N K+ G+   ++Y G
Sbjct: 423 TMGYVPP-FITDKESDEFKQFLKVSSHPWNLINLPRARGSLLSIINRKISGMTIPWIYVG 481

Query: 238 LWKASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLR 297
              ++F WHLEDQ   S NY H G+ K WYSIP+  +  F + M+   P+   +  + L 
Sbjct: 482 STFSTFCWHLEDQYTLSANYQHIGSQKIWYSIPERSTSAFDEMMKNISPDLFERQPDLLH 541

Query: 298 HKTFLVSP--KILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWL 355
               LVSP  K   + GI C K +    E+I+TYP  YHAGFN G+N  E+VNF L+ WL
Sbjct: 542 QLITLVSPYSKRFVEAGIDCYKAIQNPGEYIVTYPKCYHAGFNSGFNFNEAVNFTLDLWL 601

Query: 356 DIGIKA 361
             G+++
Sbjct: 602 PYGLQS 607

>Kwal_55.21855
          Length = 521

 Score =  119 bits (299), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 88/298 (29%), Positives = 136/298 (45%), Gaps = 42/298 (14%)

Query: 211 NVSKLPN----ILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQW 266
           N+  LP+    +L     K+ G+   ++Y G   ++F WHLEDQ   S N+ H G PK W
Sbjct: 140 NLVNLPSAKGSLLSVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANFQHEGDPKVW 199

Query: 267 YSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSP--KILEKNGIRCNKIVHYQQE 324
           YSIP    DKF   M++  P+   K  + L     L++P     +   I C K + Y  E
Sbjct: 200 YSIPGSSCDKFNTLMRQMAPDLFQKQPDLLHQLVTLIAPYDSAFKDAKISCYKAIQYPGE 259

Query: 325 FIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKA--------KRCL--CIDDAVGID 374
           +IIT+P  YH+GFN GYN  E+VNF L+ WL  GI+A        KRC+    +  + + 
Sbjct: 260 YIITFPKCYHSGFNTGYNFNEAVNFTLDLWLPYGIEATHDYIESKKRCVFDMWELMLTVL 319

Query: 375 VEKLRDDWLSSKQKAEK------PKVKHEIQESQRGSNGVSKKAK---FEKDSASTKQPS 425
           VE L D  L  +    +       K   E++   + SN +S + +   F +   + K  +
Sbjct: 320 VEYLEDPTLFDEALIRRCHLELLEKFNQEVKVMDQLSNILSNRVEATGFTRRHMAGKGQT 379

Query: 426 E---------GSKNADVKNDKSDKSNI--------EVVCPTPGRSLPFNRLTNKENPR 466
           +            N D ++D  D ++I        ++ C       PF  + + EN R
Sbjct: 380 QFEVQVTVRRSYYNGDSEDDSHDDASITSEDDGDEDIFCTKCKTICPFAFVAHFENAR 437

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score =  120 bits (301), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (56%), Gaps = 6/157 (3%)

Query: 211 NVSKLP----NILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQW 266
           N+  LP    ++L     K+ G+   ++Y G   ++F WHLEDQ   S NY H G PK W
Sbjct: 411 NLLNLPQAKGSLLPVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVW 470

Query: 267 YSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSP--KILEKNGIRCNKIVHYQQE 324
           YSIP+   DKF + M++  P+   K  + L     L+SP  K  ++  I C K +    E
Sbjct: 471 YSIPEHSCDKFNRLMKDIAPDLFEKQPDLLHQLITLISPYDKRFQQAKISCYKALQKPGE 530

Query: 325 FIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKA 361
           +IIT+P  YHAGFN GYN  E+VNF L+ WL  GI+A
Sbjct: 531 YIITFPKCYHAGFNTGYNFNEAVNFTLDTWLPYGIEA 567

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 13 VPVFRPNYERFKDFYEYMRA--VDKYGKKSGIVKVIPPQEW 51
          VPV  P  + F+D   Y+    V + G   G++K++PP+E+
Sbjct: 7  VPVLYPTLQEFEDPISYLSQPQVQRQGHICGMIKLVPPREF 47

>ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2331
           bp, 776 aa]
          Length = 776

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 98/196 (50%), Gaps = 16/196 (8%)

Query: 186 TLAFTPPMY--GADSLGSLFQDKLDVWNVSKLP----NILDHMNTKVPGVNGSYLYAGLW 239
           TL + PP    G     +  Q      N+  LP    ++L      + G+   +LY G  
Sbjct: 367 TLEWVPPHITKGTPEYDAFLQYVEHPMNLLNLPMARGSLLPVFGRSISGMTVPWLYIGST 426

Query: 240 KASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHK 299
            ++F WHLEDQ   S NY H G PK WYSIP++ +  F K M+   P+   K  + +   
Sbjct: 427 FSTFCWHLEDQYTLSANYQHEGDPKVWYSIPEQSATAFNKLMKNIAPDLFEKQPDLMHQL 486

Query: 300 TFLVSP--KILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDI 357
             L+SP  +  E   I C K V Y  E+IITYP  YHAGFN GYN  E+VNF L+ W+  
Sbjct: 487 VTLISPYDEKFEAANIACYKAVQYPGEYIITYPKCYHAGFNTGYNFNEAVNFTLDLWVPY 546

Query: 358 GIKA--------KRCL 365
           G+ A        KRC+
Sbjct: 547 GLSASEDYRLTGKRCV 562

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 13 VPVFRPNYERFKDFYEYMR--AVDKYGKKSGIVKVIPPQ 49
          VPV  P  + F+D   Y+   AV + G   G+VK++PP+
Sbjct: 9  VPVLHPTEDEFRDPIGYLSKAAVQRLGHVYGMVKLVPPR 47

>CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, hypothetical start
          Length = 740

 Score =  118 bits (296), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 91/157 (57%), Gaps = 6/157 (3%)

Query: 211 NVSKLP----NILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQW 266
           N+  LP    ++L  +N  + G+   ++Y G   ++F WHLEDQ   S NY H G+PK W
Sbjct: 390 NLLNLPQASSSLLPFLNRNISGMTIPWIYVGSKFSTFCWHLEDQYTLSANYQHEGSPKVW 449

Query: 267 YSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSPK--ILEKNGIRCNKIVHYQQE 324
           YSIP    D F+K + +  P+   K  + L     L+SP   + +K  ++  K V +  E
Sbjct: 450 YSIPDNSCDNFHKLLHDLTPDLFEKQPDLLHQLVSLISPYDPLFKKYNVKWYKAVQHPNE 509

Query: 325 FIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKA 361
           +I+T+P  YHAGFN GYN+ E+VNF  E+WL  G++A
Sbjct: 510 YIVTFPKCYHAGFNTGYNINEAVNFTSESWLPYGLEA 546

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 13 VPVFRPNYERFKDFYEYMR--AVDKYGKKSGIVKVIPP 48
          VPV  P  E F D  +Y+   A+ + GK  G+V+++PP
Sbjct: 6  VPVVYPTEEEFADPIDYLNQPALRRLGKVYGMVRIVPP 43

>Scas_691.27
          Length = 735

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 84/156 (53%), Gaps = 6/156 (3%)

Query: 211 NVSKLPNILDHM-----NTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQ 265
           N+  LPN L  +     N  + G+   ++Y G   ++F WH+EDQ   S NY H GA K 
Sbjct: 390 NLVNLPNALGSLLPLLSNKTISGMTIPWIYVGSTFSTFCWHMEDQYTLSANYQHEGASKI 449

Query: 266 WYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSPKILEKNGIRCNKIVHYQQEF 325
           WYSIP    + F K +    P+   K  + +     LVSP  L K+ I C K +    E+
Sbjct: 450 WYSIPASSCEPFQKLLHSMTPDLFIKQQDLIHQLVSLVSPYDLPKS-INCYKAIQNPNEY 508

Query: 326 IITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKA 361
           IIT+P  +H+GFN GYNL E+VNF    WL  G++A
Sbjct: 509 IITFPKCFHSGFNTGYNLNEAVNFTTPFWLPFGVEA 544

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 90/182 (49%), Gaps = 6/182 (3%)

Query: 186 TLAFTPPMYGADSLGSLFQDKLDVWNVSKLP----NILDHMNTKVPGVNGSYLYAGLWKA 241
           T  F P     D L    +      N++ LP    ++L      + G+   ++Y G   +
Sbjct: 363 TREFIPKNINGDELIDYLKYCDHPMNLTNLPMAHNSLLPLFKRNISGMTIPWIYIGSLFS 422

Query: 242 SFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTF 301
           +F WH+EDQ   S NY H G PK WYSIP+    KF   + +  P+   K  + L     
Sbjct: 423 TFCWHMEDQYTLSANYQHEGDPKVWYSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVT 482

Query: 302 LVSPKI--LEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGI 359
           L+SP     +K+GI   K V    E+IIT+P  YHAGFN GYN  E+VNF ++ WL  G 
Sbjct: 483 LISPYDPNFKKSGIPVYKAVQKPNEYIITFPKCYHAGFNTGYNFNEAVNFTIDFWLPYGF 542

Query: 360 KA 361
            A
Sbjct: 543 GA 544

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/104 (19%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query: 13  VPVFRPNYERFKDFYEYMR--AVDKYGKKSGIVKVIPPQEW-------LDQLEMPPGVET 63
           +P   P  + FK+  +Y+    + + G + G+VKV+PP  +       ++     P ++ 
Sbjct: 4   IPALYPTEQEFKNPIDYLSNPHIKRLGVRYGMVKVVPPNGFCPPLSIDMENFTFQPRIQN 63

Query: 64  LQKIRIRTPIQQHF-----NGSKGVFVVQNVEKSKSYNIIQWKD 102
           L+ + ++   +  F     N  + V     +   + Y I+++ D
Sbjct: 64  LENLDLKNRCRLFFMKQLNNFKRSVKDPSKLILREPYTIVEYSD 107

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%)

Query: 712 SKRPIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 771
           SK   +  +I + +I  SD  K + C+ C   F S +HL RH+ SVHS EKP++CP C K
Sbjct: 539 SKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSK 598

Query: 772 KFKRRDHVLQHLNKKIPC 789
            FKR+DHV QHL KK PC
Sbjct: 599 GFKRKDHVSQHLKKKTPC 616

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%)

Query: 245 WHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVS 304
           W ++  + Y + +  FG P QWY +   + D    ++++  P+ +  C+ F  HK +   
Sbjct: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253

Query: 305 PKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLA 344
           P  LE+  I    +V    +  I+ P      F+YGY++ 
Sbjct: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293

>Scas_709.32
          Length = 822

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%)

Query: 729 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           SD+ K + C+ C + F    HL RH +SVHS E+P +CP C KKF R D++ QH+
Sbjct: 759 SDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHI 813

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 715 PIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 774
           P  P  +  +    S K +++VCQ C R F+   HLTRH++S H+ EKP+ C  C ++F 
Sbjct: 10  PSIPEHLKYKGFTPSGKPRLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFT 68

Query: 775 RRDHVLQHLNK 785
           RRD +L+H +K
Sbjct: 69  RRDLLLRHAHK 79

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 2/78 (2%)

Query: 731 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCT 790
           K K Y C  C R+F+    L RH   VH G    S  +  KK  +R    Q  N   P  
Sbjct: 54  KEKPYCCGICDRRFTRRDLLLRHAHKVHGGNCGESLLR--KKRSKRMSSKQMSNSNGPLQ 111

Query: 791 AEGGQSPSSKSTKDEEIV 808
              G  P+   + D+ I 
Sbjct: 112 QSPGSLPTENHSNDKIIA 129

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 713 KRPIAPSKINSEEIIVS---DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKC 769
           K P+ P K  S   I     DK K + C++C + F    HL RH +SVHS E+P +C  C
Sbjct: 548 KVPVQPRKRKSITTIDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFC 607

Query: 770 GKKFKRRDHVLQHL 783
            KKF R D++ QHL
Sbjct: 608 EKKFSRSDNLSQHL 621

>Scas_649.28
          Length = 730

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           + DK K + C EC + F    HL RH +SVHS E+P +C  C KKF R D++ QHL
Sbjct: 666 LDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHL 721

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKI 787
           +K + ++CQ C + F++  HL RH + +H+GEK H+C  P CG++F R D+ LQH    +
Sbjct: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133

Query: 788 PCTA 791
             TA
Sbjct: 134 KRTA 137

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           + D  K + C+ C R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 347 ILDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHI 402

>Scas_602.9
          Length = 547

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           ++ D  K + C  C R+F    HL RH +S+H GEKP++C  C K F R D++ QH+
Sbjct: 487 LLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHI 543

>Kwal_47.17241
          Length = 403

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           + D  K + C  C R+F    HL RH +S+H GEKP  C  CGKKF R D++ QH+
Sbjct: 339 ILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHI 394

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (64%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           D  K + C+ C R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 455 DATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHI 508

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           +V D  K + C+ C R+F    HL RH +S+H GEKP+ C  C KKF R D++ QH+
Sbjct: 256 LVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHI 312

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 718 PSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 777
           P  +    +  S K +++VC  C R F+   HL RHK+S H+ EKP+ C  C ++F RRD
Sbjct: 32  PENLRLNGVTPSGKPRLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICGICDRRFSRRD 90

Query: 778 HVLQHLNK 785
            +L+H +K
Sbjct: 91  LLLRHAHK 98

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           ++ D  K++ C  C R+F    HL RH  S+H GE+P+SC  C K F R D++ QH
Sbjct: 210 LLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>Kwal_26.8351
          Length = 698

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           V ++ K + CQEC + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 634 VEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHL 689

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           + D  K + C+ C R+F    HL RH +S+H  EKP+ C  CGKKF R D++ QHL
Sbjct: 411 ILDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHL 466

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 757 VHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 789
           +    KP  C  C ++FKR++H+ +H+     C
Sbjct: 411 ILDASKPFGCEYCDRRFKRQEHLKRHIRSLHIC 443

>Scas_721.92
          Length = 1152

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 729 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           S K +++VC  C R F+   HL RH +S H+ EKP+ C  C KKF RRD +L+H  K
Sbjct: 72  SGKPRLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 713 KRPIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK 772
           K  + P  +    +  S K +++VC+ C R F+   HLTRH++S H+ EKP+ C  C ++
Sbjct: 103 KFDMLPDHLRLNGVTPSGKPRLFVCKVCTRAFARQEHLTRHERS-HTKEKPYVCGICERR 161

Query: 773 FKRRDHVLQHLNK 785
           F RRD +++H  K
Sbjct: 162 FTRRDLLIRHCQK 174

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 7/56 (12%)

Query: 731 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           K K YVC  C R+F+    L RH + +H G        CG   +R    ++  +KK
Sbjct: 149 KEKPYVCGICERRFTRRDLLIRHCQKLHGG-------NCGDYIRRTSRKVRRDSKK 197

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (62%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K + CQEC + F    HL RH +SVHS ++P  C  C KKF R D++ QHL
Sbjct: 502 KPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHL 552

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 6/36 (16%)

Query: 761 EKPHSCPKCGKKFKRRDHVLQHL------NKKIPCT 790
           EKP  C +C K F+R +H+ +H+      ++  PCT
Sbjct: 501 EKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCT 536

>Kwal_47.16621
          Length = 1178

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           I +D+ + ++C  C R F+   HL RH+++ H+ EKP  C  CG+ F RRD VL+H  K 
Sbjct: 70  IKTDRPRPFLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRCFARRDLVLRHQQKL 128

Query: 787 IPCTAEGG-----QSPSSKSTKDEEIVIERSGER 815
               A+ G      +  SKS  +E  +I  SG +
Sbjct: 129 HSTLADSGPEEVAVNRDSKSHLNERHIITISGNK 162

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           I +DK + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  +K
Sbjct: 40  IKTDKPRPFLCPICTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRH-QQK 97

Query: 787 IPCTAEGGQSPSSKSTKDEEI 807
           +  +      P S +T D+E+
Sbjct: 98  LHASLMDQDKPLSSTTNDKEL 118

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782
           ++ + YVC+ C R F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>Scas_703.23
          Length = 1341

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 726 IIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           +I +DK + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 63  VIKTDKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLRHQHK 121

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           D  K + C +C + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 479 DGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHL 532

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 726 IIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           II +DK + ++C  C R F    HL RH+ S H+ EKP+ C  CG+ F RRD VL+H  K
Sbjct: 142 IIKTDKPRPFLCPTCTRGFVRQEHLKRHQHS-HTREKPYLCIFCGRCFARRDLVLRHQQK 200

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (60%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K + C +C + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 619 KPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHL 669

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 76/203 (37%), Gaps = 54/203 (26%)

Query: 207 LDVWNVSKLP----NILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGA 262
           LD WN++ +P    ++L +++     +    ++ G+  ++  W L DQ L +I Y H G 
Sbjct: 541 LDPWNINNVPLAANSLLSYLDIDYGCLTRPKMHVGMTFSTRGWSLGDQYLPTIEYNHLGC 600

Query: 263 PKQWYSIPQEDSDKFYKFMQE--------------------------------------- 283
              WY I  E  + F K ++E                                       
Sbjct: 601 SLLWYFIAPESQEAFEKLVEEINLGKRDHPTDELDVDPEFKKSEFYNSYLETNMRNRLND 660

Query: 284 -----------QFPEHAAKCDEFLRHKTFLVSPKILEKNGIRCNKIVHYQQEFIITYPYG 332
                       F + A     +L      + P+ L+K GI+    +   + FII YP  
Sbjct: 661 THKLRSKNGSHMFGQAARGPKSYLLPNDIQIHPEELQKRGIKFYNAIQEAKTFIIKYPRA 720

Query: 333 YHAGFNYGYNLAESVNFALENWL 355
           Y+     G++++ES   A E+WL
Sbjct: 721 YNTSIAAGFHVSESCYLAPESWL 743

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           I +DK + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 72  IKTDKPRPFLCPVCTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 129

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 726 IIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           +I +D+ + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 74  LIKTDRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 132

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 711 FSKRPIAPSKINSEEIIVSDKG---KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP 767
           + ++ + PS+  S  +I S K    K + C  C + F    HL RH +SVHS E+P +C 
Sbjct: 621 YRRKSMTPSR-RSSVVIESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACH 679

Query: 768 KCGKKFKRRDHVLQHL 783
            C KKF R D++ QH+
Sbjct: 680 ICDKKFSRSDNLSQHI 695

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           I +DK + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 53  IKTDKPRPFLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQHK 110

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           + +DK + ++C  C R F    HL RH+ S H+ EKP  C  CGK F R+D VL+HL K
Sbjct: 19  VKTDKPRPFLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLRHLQK 76

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           ++ D  K + C+ C R+F    HL RH +S+H  EKP +C  C K F R D++ QH+
Sbjct: 381 LIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHV 437

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           D  + YVC  C R F    H TRH ++ H+GEKPH+C  P CGK+F R D + +H
Sbjct: 29  DSPRPYVCPICSRAFHRLEHQTRHIRT-HTGEKPHACEFPGCGKRFSRSDELTRH 82

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           D  K + C  C + F    HL RH +SVHS ++P SC  C KKF R D++ QH+
Sbjct: 530 DIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHI 583

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782
           ++ + Y+C+ C R F++  HL RH + +H+GEK H CP   C ++F R D+ LQH
Sbjct: 169 EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCLQH 222

>Kwal_27.10925
          Length = 264

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 782
           ++ + YVC+ C + F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 196 EQRRRYVCKICVKGFTTSGHLARHNR-IHTGEKNHVCPHEGCGQRFSRHDNCVQH 249

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 719 SKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRR 776
           S  NS++I +  K   Y+C+ C + F++  HL RH + +H+GEK H CP   CG++F R 
Sbjct: 389 SLCNSDDIELRRK---YLCKVCGKGFTTSGHLARHNR-IHTGEKRHVCPYEGCGQRFNRH 444

Query: 777 DHVLQH 782
           D+ LQH
Sbjct: 445 DNCLQH 450

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 43/63 (68%), Gaps = 4/63 (6%)

Query: 722 NSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHV 779
           N++++ ++++ K Y+C+ C R F++  HL RH + +H+GEK H C  P C ++F R D+ 
Sbjct: 272 NTKDLPLAERRK-YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNY 329

Query: 780 LQH 782
           +QH
Sbjct: 330 IQH 332

>Scas_575.3
          Length = 455

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 13/103 (12%)

Query: 713 KRPIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCG 770
           K+P   S+ N +     D  + +VC  C+R F    H TRH ++ H+GEKPH C  P C 
Sbjct: 50  KKPRPRSRANKD----GDAPRPHVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCV 104

Query: 771 KKFKRRDHVLQHLNKKIPCTAEGGQSPSSKSTKDEEIVIERSG 813
           KKF R D + +H  K+I    +    P  K  + +++V +++G
Sbjct: 105 KKFSRSDELTRH--KRIHTNPQ----PRGKRGRKKKVVTDQTG 141

>Scas_718.44
          Length = 266

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782
           +VC+ C   F++  HL+RH + +H+GEK HSCP   C +KF R D+ LQH
Sbjct: 210 HVCKICSTGFTTSGHLSRHNR-IHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           I +DK + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H  K 
Sbjct: 25  IKTDKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQYKL 83

Query: 787 IPCTAEGGQSPSSKSTKDEEI 807
            P         S  ++++  +
Sbjct: 84  HPTLVSKNNEGSLDNSRNNSV 104

>Kwal_56.24206
          Length = 1502

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 83/194 (42%), Gaps = 56/194 (28%)

Query: 220 DHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYK 279
           +H++TK        L  G+  +   W +ED  L SI+Y H G+ K WY IP +D +KF +
Sbjct: 531 NHLDTK--------LDIGMLFSVKGWSIEDNFLASIHYHHVGSSKLWYVIPPQDMEKFER 582

Query: 280 FMQ--EQFPE-------HAAKCDEFLR---HKTFL------------------------- 302
            ++  E  P+       +  +  +F +   +++FL                         
Sbjct: 583 LIEFYESQPQDVESSYPNGVETKQFEKSEFYQSFLDTTPSRPTSMRPHRVNTHTLNKNFQ 642

Query: 303 -----------VSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFAL 351
                        P+ L+ +GI   K+V   + FI  +P  Y +  + G++++E   FA 
Sbjct: 643 SSNSTLANDWNFHPETLKDHGITVYKVVQDPRSFIFRFPKSYSSNISSGFSVSEFALFAP 702

Query: 352 ENWLDIGIKAKRCL 365
            +WL I I+ ++ L
Sbjct: 703 TSWLGIAIEGEKWL 716

>Scas_707.31
          Length = 289

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           I+ D  K Y C  C+++F    HL RH +++H   +P  C  C K+F R D++ QH+
Sbjct: 215 ILPDDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHV 271

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 729 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           S K + +VC+ C R F+   HL RH +S H+ EKP+ C  C + F RRD +++H  K
Sbjct: 98  SGKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

>Scas_569.2
          Length = 293

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           +K + Y+C+ C + F++  HL RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 223 EKRRKYICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 6/65 (9%)

Query: 720 KINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRD 777
           K N+++I   ++ + ++CQ C   F++  HL+RH K +H+GEK H CP   C + F R D
Sbjct: 240 KDNTQKI---EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHD 295

Query: 778 HVLQH 782
           + LQH
Sbjct: 296 NCLQH 300

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K +VC  C ++F+ G +L  H++ +H+GEKP+SC  C KKF R+ ++  HL
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           K + C  C R FS   HL  H +S H G KP  C  CGK+F +  ++  H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGGNLRTH 639

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           D  + YVC  C+R F    H TRH ++ H+GE+PH+C  P C K+F R D + +H
Sbjct: 21  DGPRPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRH 74

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 753 HKKSVHS----GEKPHSCPKCGKKFKRRDHVLQHL 783
           HKKS++     G +P+ CP C + F R +H  +H+
Sbjct: 11  HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHI 45

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 719 SKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRR 776
           SK  S+    S+  + + C  C R F    H TRH + +H+GEKPH+C  P C K+F R 
Sbjct: 22  SKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCVKRFSRS 80

Query: 777 DHVLQH 782
           D + +H
Sbjct: 81  DELTRH 86

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           D  + +VC  C R F    H TRH ++ H+GEKPH+C  P C K+F R D + +H
Sbjct: 38  DAPRPHVCPICGRAFHRLEHQTRHMRT-HTGEKPHACDFPGCVKRFSRSDELTRH 91

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 762 KPHSCPKCGKKFKRRDHVLQHL 783
           +PH CP CG+ F R +H  +H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHM 62

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           D  + YVC  C R F    H TRH ++ H+GEKPH+C    CGK+F R+D + +H
Sbjct: 17  DAPRPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRH 70

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 732 GKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 784
            ++Y C +C+ +FS    L RH+K VHS   PH C  CGK F R+D + +H N
Sbjct: 92  AQLYSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRHSN 143

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           +K + + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H
Sbjct: 12  NKERPFKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRH 65

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           Y+C  C + FS   H TRH++S H+G KP SC  C   F RRD + +H+
Sbjct: 8   YICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHI 55

>Scas_378.1
          Length = 208

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           +  D   VY C  C + F     L RH  + HS ++ +SCPKC  K KR+D++LQHL  K
Sbjct: 76  VERDTPSVYQCHMCVKSFRRHSWLKRHLLA-HSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>Scas_712.42*
          Length = 290

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 783
           + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +HL
Sbjct: 18  FRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHL 67

>Kwal_14.2278
          Length = 463

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           + Y+C  C R F    H TRH ++ H+GEKPH+C    C K+F R D + +H
Sbjct: 21  RPYICPICSRAFHRLEHQTRHIRT-HTGEKPHACDFAGCTKRFSRSDELTRH 71

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 731 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK--KIP 788
           K K + C  C + FS   H TRH++S H+G KP  C  C   F RRD + +H+    +I 
Sbjct: 8   KTKRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHIRTVHRIL 66

Query: 789 CTAEGGQSPSSKSTKD 804
              + G +PS ++ KD
Sbjct: 67  LLRDTG-APSQENEKD 81

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K + C+ C ++F+ G +L  H + +H+GE+P+ C KCGK+F R+ ++  H+
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 786
           K + C  C + F+   HL  H +S H G KP  C  CGK+F +    R HV  H  ++
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGER 541

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           Y+C  C + FS   H  RH++S H+G KP SC  C   F RRD + +H+
Sbjct: 8   YICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHI 55

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 783
           V ++ + + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHM 66

>Scas_697.35
          Length = 839

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K Y C  C ++F+ G +L  H++ +H+GEKP+ C  C KKF R+ ++  HL
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQR-LHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 732 GKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
            K + C  C R F+   HL  H +S H G KP+ C  CGK+F +  ++  H
Sbjct: 512 SKQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTH 561

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 755 KSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K++H G K H CP C + F +  H+  H+
Sbjct: 506 KTLHEGSKQHKCPYCHRLFAQSTHLEVHI 534

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 3/65 (4%)

Query: 720 KINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRD 777
           K+ S +   + +   + C+ C   F++  HL+RH + +H+GEK H CP   CG++F R D
Sbjct: 138 KLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNR-IHTGEKNHICPHEGCGQRFSRHD 196

Query: 778 HVLQH 782
           +  QH
Sbjct: 197 NCNQH 201

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           K + C+ C ++F+ G +L  H + +H+GEKP+ C +CG+KF R+ ++  H
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIR-LHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 786
           K + C  C + F+   HL  H +S H G KP SC  CGK+F +    R H+  H  +K
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEK 577

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 785
           K Y C+ C R+FS   +L  HK + H   KP  C    C K F +  ++  H N+
Sbjct: 577 KPYECERCGRKFSRKGNLAAHKLT-HDNLKPFECKLDDCNKNFTQLGNMKAHQNR 630

>Kwal_47.17888
          Length = 786

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           K + C+ C ++F+ G +L  H + +H+GEKP+ C KCG++F R+ ++  H
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 786
           K + C  C + F+   HL  H +S H G KP  C  CGK+F +    R HV  H  +K
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEK 557

>Scas_717.17
          Length = 525

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 731 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           +  VY+C  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

>Scas_693.31
          Length = 635

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 45/80 (56%), Gaps = 15/80 (18%)

Query: 735 YVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAE 792
           Y C    C + F   H L RHKK VHS EK ++CP CGKKF R D ++ H ++ I C   
Sbjct: 519 YACDFPNCDKAFVRNHDLVRHKK-VHS-EKSYACP-CGKKFNREDALIVHRSRMI-CA-- 572

Query: 793 GGQSPSSKSTKDEEIVIERS 812
           GG+       K + +VI+RS
Sbjct: 573 GGK-------KFDNVVIKRS 585

>Scas_719.68
          Length = 1350

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 727 IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 785
           I +DK + ++C  C R      HL RH++S H+ EKP  C  CG+ F RRD VL++  K
Sbjct: 33  IKTDKPRPFLCPICTRT----EHLKRHQRS-HTREKPFVCVFCGRCFARRDLVLRYQTK 86

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 7/89 (7%)

Query: 731 KGKVYVC--QECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL----- 783
           + KVY C  Q C + F+    LT H+ +VH G KP  C  CGK+F ++ H+ +H+     
Sbjct: 102 RSKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHMFSHTD 161

Query: 784 NKKIPCTAEGGQSPSSKSTKDEEIVIERS 812
           +K   C+  G    + +  K  EI   +S
Sbjct: 162 DKPFTCSICGKGVTTRQQLKRHEITHTKS 190

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 718 PSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 777
           PS +   ++ V    K + C  C ++F+   HL RH  S H+ +KP +C  CGK    R 
Sbjct: 120 PSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQ 178

Query: 778 HVLQH---LNKKIPCTAEG 793
            + +H     K   C+ EG
Sbjct: 179 QLKRHEITHTKSFHCSYEG 197

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 80/200 (40%), Gaps = 50/200 (25%)

Query: 207 LDVWNVSKL----PNILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGA 262
           +D WN++ +     ++L + +     + G  +  G+  ++  W LED+ L  +++ + G+
Sbjct: 535 IDAWNLNTINLSEKSLLQYQDLDFGNLAGGKIDVGMMLSTSGWALEDEFLPLLDFSYLGS 594

Query: 263 PKQWYSIPQE-------------------DSDKF-YKFMQEQFPEHAAKCDEFLRHKT-- 300
            K WY +P +                    SD+F   F +  F +   + +   +HKT  
Sbjct: 595 SKVWYFVPPQYRNSLEALFDDIRNKKEVKSSDQFEADFTESDFFQSFQETNFLDQHKTSR 654

Query: 301 ------------------------FLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAG 336
                                   F +S   L  + IR  K++   + FI+ YP  Y   
Sbjct: 655 KRSINHMFLKNLVQDKHNSYTPNDFQISTSELSASHIRYFKVIQDPKTFIMKYPQVYSTS 714

Query: 337 FNYGYNLAESVNFALENWLD 356
            + G+ ++E   FA E W++
Sbjct: 715 ISSGFQISEKSLFAPEEWVN 734

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782
           YVC EC + F+    L  H+ ++H+G++P +CP   CGK F  R ++L+H
Sbjct: 183 YVCTECGKGFARASSLRTHR-NIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K Y+C  C + FS   H  RH++S H+G KP  C  C   F RRD + +H+
Sbjct: 6   KKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHI 55

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 15/80 (18%)

Query: 735 YVCQE--CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAE 792
           Y C    C + F   H L RHKKS    EK ++CP CGKKF R D ++ H ++ I C+  
Sbjct: 580 YSCDHPGCDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSRMI-CS-- 633

Query: 793 GGQSPSSKSTKDEEIVIERS 812
           GG+       K E +VI+RS
Sbjct: 634 GGK-------KYENVVIKRS 646

>Scas_683.25
          Length = 879

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K ++C  C + FS   H  RH++S H+G KP+ C  C   F R D  L+H+
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHI 62

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in
           cell wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 79/214 (36%), Gaps = 57/214 (26%)

Query: 207 LDVWNVSKLP----NILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGA 262
           LD WN+  +P    ++L H++  +     +    G+  +   W + D  L SI++ H G+
Sbjct: 479 LDQWNLDNIPLNELSLLQHLDLDMANFTRTTYDIGMLFSCQGWSVSDHFLPSIDFNHLGS 538

Query: 263 PKQWYSIPQEDSDKFYKFMQ---------EQFPEHAAKCDE---FLR---HKTFL----- 302
            K  YSI  +D +KF   +          +  P ++   DE   F+    +K+FL     
Sbjct: 539 TKLVYSIAPKDMEKFEALIARGKSEWDTIQSRPRYSTSDDELKSFIETDFYKSFLDAEQS 598

Query: 303 ---------------------------------VSPKILEKNGIRCNKIVHYQQEFIITY 329
                                              P  +  NGI+  K    Q  +I  +
Sbjct: 599 ADYSNTGDNSKNSFPEDKIAGNTLHDGSQSDFIFEPNFILANGIKLYKTTQEQGSYIFKF 658

Query: 330 PYGYHAGFNYGYNLAESVNFALENWLDIGIKAKR 363
           P  +      G+ L+++  FA  +WL    +A +
Sbjct: 659 PKAFTCSIGSGFYLSQNAKFAPSSWLRFSSEAAK 692

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 729 SDKGKVYVCQE---CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           S + K + C     C   F+   HL RH +  H+GEKP  CP C K F R D++ QH
Sbjct: 35  SARRKTFKCTGYDGCTMSFTRAEHLARHIRK-HTGEKPFQCPACLKFFSRVDNLKQH 90

>Kwal_47.19045
          Length = 266

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKIPCTAE 792
           + C  C + F    H  RH ++ H+GEKPHSC  P C K+F R D + +H+   +  +  
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTSRG 72

Query: 793 GGQSPSSKSTKDEEIVI 809
            G+  S  S   E  V+
Sbjct: 73  KGRKRSGSSPVLEHPVV 89

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           K + C+ C ++F+   +L  H++ +H+GE+P  C KC K F RR ++  H
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRR-LHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           Y C  C + FS   HL  H K+ H G KP  C  CGK+F +  ++  H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKA-HMGYKPFECEFCGKRFTQAGNLRTH 526

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 783
           Y+C+ C  +F    H TRH ++ H+GEKP +C  P C K+F R D + +H+
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHI 61

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 784
           K + C +C  +FS    L RH+K+ H    P+ CP+CGK F R+D + +H +
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDALKRHYD 146

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 5/55 (9%)

Query: 732 GKVYVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           G+ YVCQ   C+R+FS    L +H+ + H+ E+P+ C  P CGK+F R  H+  H
Sbjct: 54  GRKYVCQIDGCKREFSVPSLLAQHRNA-HTDERPYVCDEPNCGKRFLRPCHLRVH 107

>Scas_568.5
          Length = 199

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           K Y C +C   F     L RH+K+ H    PH C +CGK F R+D + +H N +
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFARKDALKRHFNTQ 168

>Kwal_26.8021
          Length = 507

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 726 IIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 773
           + V  K K Y C+ C+R FSS   L +H ++ HSGEKP+ C  C KKF
Sbjct: 759 LKVHSKYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKF 805

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL---NKKIPC 789
           K Y C  C ++F+    L  H ++ H+GEKP  C  CGK+F    ++ +H+    KK  C
Sbjct: 794 KPYKCHICNKKFAISSSLKIHIRT-HTGEKPLQCKICGKRFNESSNLSKHIKTHQKKYKC 852

Query: 790 T 790
           +
Sbjct: 853 S 853

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           + C+ C R F    H  RH ++ H+GEKPH C  P C K F R D + +H
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSRADELKRH 68

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 39/73 (53%), Gaps = 13/73 (17%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGGQSPSS 799
           C + F   H L RHKK+    EK  +CP CGKKF R D +L H  + I C   GG+    
Sbjct: 711 CTKAFVRNHDLIRHKKT--HAEKTFTCP-CGKKFSREDALLTHRTRMI-CV--GGK---- 760

Query: 800 KSTKDEEIVIERS 812
              K + IVI++S
Sbjct: 761 ---KFDNIVIKKS 770

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           YVC+ C + FS  ++L  H ++ H+ EKP+ C  CGK F R+    +H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFARQHDKKRH 567

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 783
           K Y C  C + F+  H   RH + +H+G+K + C           CGKKF R D + +H 
Sbjct: 547 KPYQCSICGKAFARQHDKKRH-EDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

>Scas_636.14d
          Length = 275

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGG 794
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC     
Sbjct: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQ 273

Query: 795 QS 796
           +S
Sbjct: 274 KS 275

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 715 PIAPSKINSEEIIV----SDKG-KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKC 769
           P  P   ++++I+     +  G + + C  CR+QFS+   L  H ++ H+GEKP SC  C
Sbjct: 547 PHCPKTFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVC 605

Query: 770 GKKFKRRDHVLQHL 783
           GK+F    ++ +H+
Sbjct: 606 GKRFNESSNLSKHM 619

>Scas_720.33
          Length = 316

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 733 KVYVCQ---ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           K + CQ   +C   F+   HL RH +  H+GEKP  C  C + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>Kwal_27.11460
          Length = 531

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 719 SKINSEEII----VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 774
           S +N+  II    +     VY C+ C ++F+  ++L  H ++ H+ E+P SC  CGK F 
Sbjct: 393 SPLNATGIIRRKSLQKNASVYACELCDKKFTRPYNLKSHLRT-HTDERPFSCAICGKAFA 451

Query: 775 RRDHVLQH 782
           R+    +H
Sbjct: 452 RQHDRKRH 459

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 16/70 (22%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHLNK 785
           + C  C + F+  H   RH+  +H+G+K ++C           CGKKF R D + +H   
Sbjct: 441 FSCAICGKAFARQHDRKRHE-DLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFK- 498

Query: 786 KIPCTAEGGQ 795
                 EGG+
Sbjct: 499 -----TEGGK 503

>Scas_687.33
          Length = 288

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 783
           + C  C R F    H  RH ++ H+GEKPH C    CGK F R D + +H+
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRGDELKRHI 66

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 733 KVYVCQ---ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 789
           K + CQ   +CR +F+   HL RH +  H+GE+P  C  C + F R D++ QH+      
Sbjct: 18  KSFKCQGFGDCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHVESVHSV 76

Query: 790 TAEGGQSPSSKST 802
           +    Q  +SKST
Sbjct: 77  SMATSQLKNSKST 89

>Kwal_23.5400
          Length = 429

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL-----NKKIPCTAEGG 794
           C + FS    LT H++ VH G KP  C  C ++F R+ H+ +H+     +K   C+  G 
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGK 116

Query: 795 QSPSSKSTKDEEIVIERS 812
              + +  +  EI   RS
Sbjct: 117 GVTTKQQLRRHEITHTRS 134

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 718 PSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK----KF 773
           PS++   + +V    K + C  C RQFS   HL RH  S HS +KP  C  CGK    K 
Sbjct: 64  PSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKGVTTKQ 122

Query: 774 KRRDHVLQHLNKKIPCTAEGGQ 795
           + R H + H  +   C  EG +
Sbjct: 123 QLRRHEITH-TRSFVCPHEGCE 143

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 722 NSEEIIVSDK--GKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRD 777
           NS   +V  K  GK  +C +C +QF+    L  H   VHSG+KP  C    C KKF  + 
Sbjct: 217 NSPTTVVKGKANGKADICAQCGKQFTRPSALRTHML-VHSGDKPFECTWEGCNKKFNVKS 275

Query: 778 HVLQHL 783
           ++++HL
Sbjct: 276 NLIRHL 281

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           ++ C  C + F     L RH  S HS  KP+SCP C  + KR+D++ QHL  K
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 235

>Kwal_56.23925
          Length = 745

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 15/85 (17%)

Query: 733 KVYVC--QECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCT 790
           + Y C  + C + F   H L RHKK+    EK + CP CGKKF R D +L H ++ I C 
Sbjct: 613 RPYFCDFEGCHKAFVRNHDLIRHKKT--HAEKCYVCP-CGKKFVREDALLVHRSRMI-CV 668

Query: 791 AEGGQSPSSKSTKDEEIVIERSGER 815
                     + K   +VI++S  R
Sbjct: 669 G---------AKKYSNVVIKKSPRR 684

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 725 EIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782
           EI  + +   ++C+ C ++F     L+ H  ++H+GEKP+ CP   C K F  + ++L+H
Sbjct: 163 EINKTSEDTKFICKVCLKKFKRPSSLSTHM-NIHTGEKPYPCPFDNCTKSFNAKSNMLRH 221

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 729 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           SD   ++ CQ C + F     L RH  S HS ++   CP C  + KR+D++LQH+  K
Sbjct: 340 SDHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 396

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 783
           + C+ C R F    H  RH ++ H+GEKPH C    C K F R D + +HL
Sbjct: 17  FRCEICSRGFHRLEHKKRHGRT-HTGEKPHKCTVQGCPKSFSRSDELKRHL 66

>Scas_627.17d
          Length = 275

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGG 794
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC     
Sbjct: 215 FPCPHCQKTYLTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQ 273

Query: 795 QS 796
           +S
Sbjct: 274 KS 275

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           C++ F   H L RHKKS    EK +SC  CGKKF   D +++H  +K
Sbjct: 730 CQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERK 774

>Scas_720.39
          Length = 1455

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 69/199 (34%), Gaps = 53/199 (26%)

Query: 210 WNVSKLP----NILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQ 265
           W +  +P    ++L +++  +     +    G++ +   W + D  L SI+Y H G+ K 
Sbjct: 499 WRLENIPLSEDSLLRYLDLDLGCNTRTKFDIGMFLSVAGWSVTDNFLPSIDYHHMGSSKL 558

Query: 266 WYSIPQEDSDKFYKFM----------QEQFPEHAAKCDEFLRHKTF-------------- 301
           WY +  +D +K    M          Q Q     +  D F   + F              
Sbjct: 559 WYVVSPKDLEKLEALMKNVDTEIEKTQTQMLASISLNDNFKESEFFIAYDMTKQTNFSIQ 618

Query: 302 -------------------------LVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAG 336
                                    L +   L+KNGI    +      +I TYP  Y + 
Sbjct: 619 TSADFRKDLSLTKENNFEQPSKPASLFTTAFLKKNGIEVRTVSQDSGSYIFTYPKTYTSY 678

Query: 337 FNYGYNLAESVNFALENWL 355
              G  L++   FA ++WL
Sbjct: 679 IGAGVYLSQHATFAPKSWL 697

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 5/71 (7%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH--LNKKIPCT 790
           Y C EC + F+    L+ H  ++H+G+KP+ C  P C K+F  + ++L+H  L+ K P  
Sbjct: 304 YRCAECGKAFARPSSLSTHM-NIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTPKV 362

Query: 791 AEGGQSPSSKS 801
               ++ S KS
Sbjct: 363 KAKSRTRSPKS 373

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 724 EEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           E+I VS     + C  C + F     L RH  S HS ++   CP C  + KRRD++LQH+
Sbjct: 523 EKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKRRDNLLQHM 581

Query: 784 NKK 786
             K
Sbjct: 582 KLK 584

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 773
           V  K K Y C +C++ FS+   L +HK+ VHSGEKP+ C  C K+F
Sbjct: 590 VHSKYKPYQCPQCQKCFSTEDTLNQHKR-VHSGEKPYECHICHKRF 634

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 724 EEIIVSDKGKVYVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 781
           EE+ ++     Y C+   C + FS    L RH K VHS  KP+ CP+C K F   D + Q
Sbjct: 556 EEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLK-VHSKYKPYQCPQCQKCFSTEDTLNQ 614

Query: 782 H 782
           H
Sbjct: 615 H 615

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K Y C  C ++F+  + L  H ++ H+GEKP  C  CG+ F    ++ +H+
Sbjct: 623 KPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNESSNLSKHM 672

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 775
           VY C  C ++F+  ++L  H +S H+ E+P+ C  CGK F R
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVCGKAFAR 508

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 10/62 (16%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHLNK 785
           YVC  C + F+  H   RH+  +H+G++ + C           CGKKF R D + +H   
Sbjct: 497 YVCSVCGKAFARMHDKNRHED-LHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKT 555

Query: 786 KI 787
           ++
Sbjct: 556 EL 557

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           Y C  C +QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           C   FS   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHIRR-HTGEKPFKCDICLKYFSRIDNLKQH 74

>Scas_631.7
          Length = 433

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 718 PSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 777
           PS ++  ++      K + C++C +QFS   HL RH  S HS  KP  C  CGK    R 
Sbjct: 71  PSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHLIS-HSDSKPFCCLHCGKGVTTRQ 129

Query: 778 HVLQH 782
            + +H
Sbjct: 130 QLKRH 134

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL-----NKKIPCTAEGG 794
           C + F+    L+ H+ + H G KP  C +C K+F R+ H+ +HL     +K   C   G 
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHLISHSDSKPFCCLHCGK 123

Query: 795 QSPSSKSTKDEEIVIERS 812
              + +  K  E+   +S
Sbjct: 124 GVTTRQQLKRHEVTHTKS 141

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 7/96 (7%)

Query: 724 EEIIVSDKGKVYVC--QECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 781
           E    S + K + C  + C + F+    LT H+++ H G + + C +CG+ F ++ H+ +
Sbjct: 108 ESTASSTRRKTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLER 167

Query: 782 HL-----NKKIPCTAEGGQSPSSKSTKDEEIVIERS 812
           HL      K   CT  G    + +  +  EI   +S
Sbjct: 168 HLFSHSETKPFSCTVCGKGVTTRQQLRRHEITHTKS 203

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 718 PSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 777
           PS +   +       + Y C++C R F+   HL RH  S HS  KP SC  CGK    R 
Sbjct: 133 PSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLERHLFS-HSETKPFSCTVCGKGVTTRQ 191

Query: 778 HVLQH---LNKKIPCTAEG 793
            + +H     K   C  EG
Sbjct: 192 QLRRHEITHTKSFKCPHEG 210

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 739 ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           +C   F+   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 26  DCNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFFSRIDNLRQH 68

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           C + F+    L RH K VHSG KP  CP C KKF   D + QH+
Sbjct: 635 CSKSFTQRQKLLRHLK-VHSGYKPFKCPHCTKKFSTEDILQQHI 677

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 713 KRPIAPSKINSEEI----IVSDKG-KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP 767
           K P    K ++E+I    I +  G + + C  C +QF++   L  H ++ H+GEKP  C 
Sbjct: 659 KCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT-HTGEKPLKCK 717

Query: 768 KCGKKFKRRDHVLQHL 783
            CGK+F    ++ +H+
Sbjct: 718 ICGKRFNESSNLSKHM 733

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           +Y C  C ++F+  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRT-HTDERPFSCSVCGKAFARQHDRKRH 472

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 783
           + + C  C + F+  H   RH+  +HSG+K + C           CGKKF R D + +H 
Sbjct: 452 RPFSCSVCGKAFARQHDRKRHED-LHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHF 510

>Scas_717.60d
          Length = 167

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 722 NSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 781
           +S EI+ S++  ++ C+EC + F +   L +H K  HS         CGK FKR+D    
Sbjct: 88  SSCEILTSNE--LFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEYNCGKAFKRKDQRKS 145

Query: 782 H 782
           H
Sbjct: 146 H 146

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 13/73 (17%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGGQSPSS 799
           C + F   H L RHKK+    EK ++CP CGK F R D +  H ++ I C   GG+    
Sbjct: 593 CDKAFVRNHDLVRHKKTHQ--EKSYACP-CGKMFNREDALAVHRSRMI-CI--GGK---- 642

Query: 800 KSTKDEEIVIERS 812
              K   +VI+RS
Sbjct: 643 ---KYANVVIKRS 652

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 8/63 (12%)

Query: 735 YVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAE 792
           Y C    C + F   H L RHK S H+ +K + CP CGK+F R D ++ H ++ I CT  
Sbjct: 633 YSCDFPGCTKAFVRNHDLIRHKIS-HNAKK-YICP-CGKRFNREDALMVHRSRMI-CT-- 686

Query: 793 GGQ 795
           GG+
Sbjct: 687 GGK 689

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 13/79 (16%)

Query: 733 KVYVC--QECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK----- 785
           K Y C  + C + F   H L RHKK+    +K  SCP CGKKF     +++H N+     
Sbjct: 551 KPYKCDFEGCTKAFVRNHDLARHKKT---HDKHFSCP-CGKKFSSEQSMMKHKNRHNCTG 606

Query: 786 --KIPCTAEGGQSPSSKST 802
             ++P +    +SP  +S+
Sbjct: 607 PARVPDSKMVSKSPRKQSS 625

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 38.9 bits (89), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           + GK + C +C   F     L RH+K VH    P+ C  CGK F R+D + +H 
Sbjct: 142 NDGKRFHCTKCELVFRRSGDLRRHEK-VHLPILPNICSLCGKGFARKDALKRHF 194

>Scas_711.56
          Length = 832

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 773
           K + C  C++ FS+   L +H+++ HSGEKP  C  CGK+F
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRF 763

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 735 YVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           Y C    C + FS    L RH + VHSG KP  C  C K F   + + QH
Sbjct: 696 YECHWANCHKIFSQRQRLVRHMR-VHSGYKPFQCSICKKHFSNEETLKQH 744

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K + C  C ++F+    L  H ++ H+GEKP  C  CGK F    ++ +H+
Sbjct: 752 KPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHM 801

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 784
           K+Y C  C   +     L +H+++ H  ++ + C  CGKKF R+D + +H +
Sbjct: 118 KIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRHFD 169

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 733 KVYVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K Y+C+   C + F+    LT H+ +VH G KP  C +C   F ++ H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 4/79 (5%)

Query: 718 PSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 777
           PS +   +  V    K + C +C   F+   HL RH  + H+ E+P  C  CGK    R 
Sbjct: 50  PSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQ 108

Query: 778 HVLQH---LNKKIPCTAEG 793
            + +H     K   C  EG
Sbjct: 109 QLKRHEVTHTKSFNCEYEG 127

>Scas_695.2
          Length = 571

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
            Y C+ C + F+  ++L  H ++ H+ E P  C  CGK F R+    +H
Sbjct: 451 AYACELCDKTFTRPYNLKSHLRT-HTNEXPFVCNICGKAFARQHDRKRH 498

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 783
           +VC  C + F+  H   RH + +H+G+K + C           C KKF R D + +H 
Sbjct: 480 FVCNICGKAFARQHDRKRH-EDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHF 536

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 733 KVYVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL-----NK 785
           K Y C    C + F+    LT H+ SVH G +   C KC K F ++ H+ +HL      K
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTK 106

Query: 786 KIPCTAEGGQSPSSKSTKDEEIVIERS 812
              C+  G    + +  K  E+   +S
Sbjct: 107 PFQCSYCGKGVTTRQQLKRHEVTHTKS 133

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 4/79 (5%)

Query: 718 PSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 777
           PS +   ++ V    + + C +C + F    HL RH  + HS  KP  C  CGK    R 
Sbjct: 63  PSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYT-HSDTKPFQCSYCGKGVTTRQ 121

Query: 778 HVLQH---LNKKIPCTAEG 793
            + +H     K   C  EG
Sbjct: 122 QLKRHEVTHTKSFICPEEG 140

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 724 EEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           E++   ++ K Y C +C   F     L RH+++ H    P+ C  CGK F R+D + +H
Sbjct: 114 EDVQQLNEDKKYQCDKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRH 171

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 773
           K + CQ C R F+   HL  H +S H G+KP+ C  CGK  
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRS-HLGKKPYQCEYCGKPL 651

>Kwal_14.2206
          Length = 254

 Score = 37.7 bits (86), Expect = 0.024,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 737 CQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
           C+ C + FS    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 783
           ++C  C + F+  H   RH+  +H+G+K + C           CGKKF R D + +H 
Sbjct: 597 FICSICGKAFARQHDRKRHE-DLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           + C  C ++F+  ++L  H ++ H+ E+P  C  CGK F R+    +H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRT-HTNERPFICSICGKAFARQHDRKRH 615

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 721 INSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVL 780
           I ++ + V    + + C  C + +S+   L  H ++ H+GEKP SCP C K+F    ++ 
Sbjct: 706 ILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPICNKRFNESSNLA 764

Query: 781 QHL 783
           +H+
Sbjct: 765 KHI 767

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           C + F     L RH K VHS  KP  C +CGK F  +D + QHL
Sbjct: 669 CNKVFVQKQKLIRHLK-VHSKYKPFRCAECGKCFNTQDILTQHL 711

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHL 783
           V  K K + C EC + F++   LT+H + VHSGE+P  C  C K +      R H+  H 
Sbjct: 685 VHSKYKPFRCAECGKCFNTQDILTQHLR-VHSGERPFKCHLCPKSYSTSSSLRIHIRTHT 743

Query: 784 NKK 786
            +K
Sbjct: 744 GEK 746

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 8/55 (14%)

Query: 731 KGKVYVC-QECRRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 782
           K + ++C + C R  +   HL     S+H+G+KP+ CPK  C K+F  + ++L+H
Sbjct: 340 KNQCHICGRICSRPSTLQTHL-----SIHTGDKPYKCPKRNCHKRFNVKSNMLRH 389

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 729 SDKGKVY-VCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           S++  VY  C +C  +F+    L RH+++ H    P+ C +CGK F R+D + +H
Sbjct: 135 SEEDTVYHYCSQCSLKFNRSSDLRRHERA-HLLVLPYICTQCGKGFARKDALKRH 188

>Kwal_27.10467
          Length = 302

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782
           Y C +C + F+    L  H  + H+G+KP+ CP   C K+F  R ++ +H
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNT-HTGDKPYCCPFDNCDKQFNARSNMTRH 246

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           C R F+   HL RH +   +GEKP  C  C + F R D++ QH
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQH 69

>Scas_721.56
          Length = 199

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 729 SDKGKV--YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 779
           SD+G    + C +C   F     L RH+K+ H    P+ C +CGK F R+D +
Sbjct: 107 SDEGSRTGFQCNKCELYFIRSSDLRRHEKT-HLSILPNICSQCGKGFARKDAL 158

>Kwal_14.2543
          Length = 711

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 737 CQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 786
           C  C + FS+   L +H ++ HSGEKP+ C  CGK F      R H+  H  +K
Sbjct: 608 CVHCLKTFSTQDILQQHMRT-HSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEK 660

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           K Y C  C + F++   L  H ++ H+GEKP  C  CGK+F    ++ +H+
Sbjct: 632 KPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFNESSNLSKHM 681

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 735 YVC--QECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           YVC  + C R  +    L RH + VH+  KP  C  C K F  +D + QH+
Sbjct: 576 YVCGWENCGRVITQRQKLLRHLR-VHTRYKPCKCVHCLKTFSTQDILQQHM 625

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 709 ADFSKRPIAPS-KINSEEIIVSDKGKVY-VC-QECRRQFSSGHHLTRHKKSVHSGEKPHS 765
           +  S  P++P   +      VS K  V  VC +ECRR  +   H+       H+G++P S
Sbjct: 179 STMSTHPLSPGMSVAKPNYSVSTKKNVCKVCGRECRRPSTLKTHML-----THTGQRPFS 233

Query: 766 C--PKCGKKFKRRDHVLQH 782
           C  P C K F  R ++L+H
Sbjct: 234 CRHPGCSKSFNVRSNMLRH 252

>Kwal_47.16577
          Length = 881

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKI 787
           C + FS   HL RHK + HS EK + C  P CG++F R D   +H  + +
Sbjct: 20  CSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGRHL 67

>Scas_718.67
          Length = 473

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 18/79 (22%)

Query: 726 IIVSDKGKVYVC--------QECRRQFSSGHHLTRHKKSVHSGEKP-HSCPKC------- 769
           I  S   + Y C        + C  QFS  + LTRH+ ++H+ +K    C +C       
Sbjct: 370 ITESSTDETYTCRIINLTTNEPCCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKSLGNE 429

Query: 770 --GKKFKRRDHVLQHLNKK 786
              K F R D + +H+  K
Sbjct: 430 GYDKTFSRLDALTRHIKSK 448

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           C  +     H+T H + VH   KP  C  CGKKFKR   + +HL
Sbjct: 95  CNTKTVKRDHITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHL 137

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 12/100 (12%)

Query: 717 APSKINSEEIIVSDKGKVYVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPH-----SC--P 767
           +PS+I+  +    D  ++ VCQ   C + F     L  H  + H G K       +C   
Sbjct: 37  SPSEISGSD---DDSSEMLVCQWQGCSQVFPQPELLYHHLCNDHVGRKSQKNLQLNCNWG 93

Query: 768 KCGKKFKRRDHVLQHLNKKIPCTAEGGQSPSSKSTKDEEI 807
            C  K  +RDH+  HL   +P    G  +   K  + +++
Sbjct: 94  NCNTKTVKRDHITSHLRVHVPLKPFGCSTCGKKFKRPQDL 133

>Kwal_27.11824
          Length = 199

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 732 GKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 784
            K + C +C   F     L RH+++ H    P+ C  CGK F R+D + +H +
Sbjct: 116 AKKFPCAKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRHFD 167

>Scas_627.6
          Length = 1207

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 15/80 (18%)

Query: 713 KRPIAPSKINSEEIIVSDKGKVYVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCP--- 767
           +R  AP +  S ++ V+++   Y+C   +C + F+   HL+RHK + H  ++   CP   
Sbjct: 24  RRASAPVQ-KSAKLAVTER---YICPHPDCNKSFTRQEHLSRHKLN-HWPKEIFVCPFIF 78

Query: 768 -----KCGKKFKRRDHVLQH 782
                 C K F R+D +++H
Sbjct: 79  PNTNITCNKTFVRKDLLIRH 98

>Scas_718.36d
          Length = 330

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782
           Y C  C + F     L  H  ++ SG +P+ CP   C K F  + ++L+H
Sbjct: 239 YFCDVCGKGFRRPSSLRTHS-NIRSGNRPYKCPYSNCTKSFNAKSNMLRH 287

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786
           K + C++C   F     L RH++  H    P+ C  CGK F R+D + +H + +
Sbjct: 202 KRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCGKGFARKDALKRHFDTQ 254

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 737 CQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGG 794
           CQ   C  +     H+T H + VH   KP +C  C K+FKR   + +HL  KI  +  G 
Sbjct: 191 CQWDNCTSKTEKRDHMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHL--KIHLSDLGI 247

Query: 795 QSPSSK 800
            +P  K
Sbjct: 248 DAPKKK 253

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 744 FSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           F+   H  RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 737 CQ--ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           CQ  +C+ +     H+T H + VH   KP +C  C KKFKR   + +HL
Sbjct: 149 CQWGDCQTKTVKRDHITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHL 196

>Scas_604.4
          Length = 585

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 749 HLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           H+T H + VH   KP +C KC KKFKR   + +HL
Sbjct: 233 HITSHLR-VHVPLKPFACKKCTKKFKRPQDLKKHL 266

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 782
            Y C +C+++F     L  H   +H G  P  C  P C KKF  + ++L+H
Sbjct: 215 TYCCPKCKKEFKRPSGLRTHM-VIHYGRNPFFCKWPNCSKKFNVKSNLLRH 264

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 733 KVYVCQE--CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782
           + +VC+E  C + F    HL  HK S HS  KP +CP C K F     + +H
Sbjct: 36  RPFVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRH 86

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 13/77 (16%)

Query: 722 NSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGK 771
           + EEI   ++   YVC  C  +F    +LTRH K  H+ EK + CP          +C  
Sbjct: 149 DGEEIDDEEQRGKYVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSKLPPESRCHT 207

Query: 772 K--FKRRDHVLQHLNKK 786
              F RRD    HL  +
Sbjct: 208 TGGFSRRDTYKTHLKSR 224

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 13/78 (16%)

Query: 728 VSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP----------KC--GKKFKR 775
           + D  K +VC  C  +F    +LTRH K  H+ EK + CP          +C     F R
Sbjct: 191 LDDDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEVPSKRCHNSGGFSR 249

Query: 776 RDHVLQHLNKKIPCTAEG 793
           RD    H+  +     EG
Sbjct: 250 RDTYKTHMKARHLIYPEG 267

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 18/73 (24%)

Query: 732 GKVYVCQ--------ECRRQFSSGHHLTRHKKSVHSGEK-PHSCPKC---------GKKF 773
            +++ CQ         C  QFS  + LTRH+ ++H+  K    C +C          K F
Sbjct: 434 NEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCSECIKILGSEGYQKTF 493

Query: 774 KRRDHVLQHLNKK 786
            R D + +H+  K
Sbjct: 494 SRLDALTRHIKSK 506

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKKFKRRDHVLQHLNKK 786
           C  QFS  + LTRH+ ++H+ ++    C +C          K F R D + +H+  K
Sbjct: 418 CGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFSRLDALTRHIKAK 474

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 739 ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           +C  +     H+T H + VH   KP  C  C KKFKR   + +HL
Sbjct: 188 DCTTKTEKRDHITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHL 231

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 739 ECRRQFSSGHHLTRHKKS-------VHSGEKPHSCPKCGKKFKRRDHVLQH 782
           EC + FS   HL+RHK +       V S   P +   C K F R+D +++H
Sbjct: 37  ECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 728 VSDKGKVYVC--QECRRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHL 783
           +  + K YVC  + C +++S    L +H +S H+ EKP  CP+  C K F R  H+  H+
Sbjct: 1   MEKRPKRYVCPIESCGKKYSRPCLLRQHVRS-HTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

>Kwal_47.18337
          Length = 536

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 33/80 (41%), Gaps = 13/80 (16%)

Query: 719 SKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP----------K 768
           SK   EE       K +VC  C  +F    +LTRH K  H+ EK + CP          +
Sbjct: 141 SKTEDEEKDAHKGQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKAYYCPFFNADAPKDAR 199

Query: 769 CGKK--FKRRDHVLQHLNKK 786
           C     F RRD    HL  +
Sbjct: 200 CHTTGGFSRRDTYKTHLRSR 219

>Scas_670.30
          Length = 864

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 18/105 (17%)

Query: 201 SLFQDKLDVWNVSK---LPNILDHMNTKVPGVNGSYLYAGLWKASFSWHLEDQDLYS--- 254
           ++F +KL+VW  S+   +PNI    + K+      +  + L+++  S+   D DL S   
Sbjct: 713 NIFVEKLEVWKESESLNIPNITSLSSNKIL-----WRLSTLFESRLSYGTLDHDLNSLET 767

Query: 255 ----INYIHFGAPKQW---YSIPQEDSDKFYKFMQEQFPEHAAKC 292
               INYI     + +   +S  + D+  F KFM+E        C
Sbjct: 768 IINQINYITINIAETFLKAFSENEIDTKMFMKFMEELLTSALGSC 812

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 783
           C  +     H+T H + VH   KP SC  C +KFKR   + +HL
Sbjct: 113 CTTKTVKRDHITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHL 155

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 11/86 (12%)

Query: 712 SKRPIAPSKINSEEIIVSDKGKVYVCQ--ECRRQFSSGHHLTRHKKSVHSGEKPH----- 764
           S  P +PS ++++    +D+ +  +CQ   C  +FS    L  H    H G K       
Sbjct: 49  STLPTSPSDVSTD--TENDEHQRLLCQWDACGSEFSQPELLYHHLCQDHVGRKSQRNLQL 106

Query: 765 SC--PKCGKKFKRRDHVLQHLNKKIP 788
           +C    C  K  +RDH+  HL   +P
Sbjct: 107 NCHWGSCTTKTVKRDHITSHLRVHVP 132

>Scas_660.12
          Length = 367

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKK--FKRRDHVLQH 782
           YVC  C+ +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 783 LNKK 786
           L  +
Sbjct: 155 LKAR 158

>Kwal_26.9300
          Length = 304

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 714 RPIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKS-VHSGEKPHSCPKCGKK 772
           +P  P +I       S   +   C  C   +++   L+ H+ S +    KPH CP CG+ 
Sbjct: 125 KPFTPLQIPVSSKPASKPRRKKECPICHNFYAN---LSTHRSSHLQPENKPHKCPVCGRG 181

Query: 773 FKRRDHVLQHLNK 785
           F R + +L+H  +
Sbjct: 182 FTRHNDLLRHRKR 194

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 726 IIVSDKGKV-YVCQE--CRRQFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKKFKR 775
           ++V + G+  Y C    C + FS   HL+RHK +    E        P S   CGK F R
Sbjct: 35  MVVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVR 94

Query: 776 RDHVLQH 782
           RD + +H
Sbjct: 95  RDLLNRH 101

>Scas_713.11
          Length = 465

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 740 CRRQFSSGHHLTRHKKSVHSGEK-PHSCPKC---------GKKFKRRDHVLQHLNKK 786
           C  QFS  + L RH+ ++H+ +K    C +C          K F R D + +HL  K
Sbjct: 383 CSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCIKLFGERGFSKTFSRLDALSRHLKSK 439

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 733 KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 785
           K Y C  C+++FS   +L  HK + H   +P  C    C K F +  ++  H NK
Sbjct: 9   KPYECDICKKRFSRKGNLAAHKMT-HGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 759 SGEKPHSCPKCGKKFKRRDHVLQH 782
           +GEKP+ C  C K+F R+ ++  H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 737 CQECRRQFSSGHHLTRHKKSVHSGE-KPHSCPKCGKKFKRRDHVLQH 782
           C  CR  +++   LT HK +  + E +PH CP C + F R + +L+H
Sbjct: 144 CPICRNFYAN---LTTHKATHLTPEDRPHKCPICHRGFARNNDLLRH 187

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKK--FKRRDHVLQH 782
           +VC  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKK-HAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTH 300

Query: 783 LNKK 786
           L  +
Sbjct: 301 LRSR 304

>Scas_641.24
          Length = 532

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 17/82 (20%)

Query: 717 APSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--------- 767
            P+K   EE   +D G  ++C  C  +F    +LTRH K  H+ EK + CP         
Sbjct: 169 TPTKEEDEE---TDDGP-FICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDILSE 223

Query: 768 -KCGKK--FKRRDHVLQHLNKK 786
            +C     F RRD    HL  +
Sbjct: 224 SRCHNTGGFSRRDTYKTHLKAR 245

>Kwal_55.20634
          Length = 419

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 739 ECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKKIPCTAEGG 794
           +C  +     H+T H + VH   KP +C  C K FKR    + H+  HL  +       G
Sbjct: 98  KCTAKTVKRDHITSHLR-VHVPLKPFACSTCTKTFKRPQDLKKHLKVHLEDETIVRRRRG 156

Query: 795 QSPSSK 800
             P+SK
Sbjct: 157 PKPNSK 162

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 733 KVYVCQE--CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 784
           K Y C E  C ++F    HL  HK + HS  KP +C  C K+F     + +HLN
Sbjct: 40  KPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQQLRRHLN 92

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 18/89 (20%)

Query: 715 PIAPSKINSEEIIVSDKG-----KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP-- 767
           P++P   +S   +  + G     + +VC  C  +F    +LTRH K  H+ EK + CP  
Sbjct: 127 PLSPRSSSSAAQLKDEDGDELSKERFVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFF 185

Query: 768 --------KCGKK--FKRRDHVLQHLNKK 786
                   +C     F RRD    HL  +
Sbjct: 186 NSHVPPETRCHTTGGFSRRDTYKTHLRSR 214

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 15/86 (17%)

Query: 715 PIAPSKINSEEI--IVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP----- 767
           P++PS    E    ++++  + ++C  C   F    +LTRH K  H+ EK + CP     
Sbjct: 138 PLSPSGSTPEHSTKVLNNGEEEFICHYCDATFRIRGYLTRHIKK-HAIEKAYHCPFFNSA 196

Query: 768 -----KCGKK--FKRRDHVLQHLNKK 786
                +C     F RRD    HL  +
Sbjct: 197 TPPDLRCHNSGGFSRRDTYKTHLKAR 222

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 16/90 (17%)

Query: 712 SKRPIAPSKINSEEIIVSDKGKV---YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP- 767
           SK+ I  S ++ E   ++D+      Y+C  C  +F    +LTRH K  H+  K + CP 
Sbjct: 178 SKKSIDESPLSDEVQGIADESSETLPYICHYCDARFRIRGYLTRHIKK-HAKRKAYHCPF 236

Query: 768 ---------KCGKK--FKRRDHVLQHLNKK 786
                    +C     F RRD    HL  +
Sbjct: 237 FDNSISQELRCHTSGGFSRRDTYKTHLKSR 266

>Kwal_33.14227
          Length = 551

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 10/91 (10%)

Query: 715 PIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVH-SGEKPHSCPKC---- 769
           P   +  N +E+           + C ++FS  + L RH+K++H S +K   C  C    
Sbjct: 446 PFTTASGNLQEVHTCQLMNPITSEPCSKKFSRPYDLIRHQKTIHASKKKVFRCVFCIQQQ 505

Query: 770 -----GKKFKRRDHVLQHLNKKIPCTAEGGQ 795
                 K F R D + +H+  K   T    Q
Sbjct: 506 GAEGYQKTFSRGDALSRHIKVKHELTGAEAQ 536

>Scas_670.2
          Length = 435

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 715 PIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKS-VHSGEKPHSCPKCGKKF 773
           P   + IN   +    K +   C  C   ++   +LT HK + +   ++PH CP C + F
Sbjct: 232 PTNATLINDPLVSAKTKRRKKQCPICSGYYA---NLTTHKATHLVPEDRPHKCPICQRGF 288

Query: 774 KRRDHVLQH 782
            R + +++H
Sbjct: 289 GRNNDLIRH 297

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 728 VSDKGK-VYVCQE--CRRQFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKKFKRRD 777
           V  +GK  YVC    C + F+   HL+RHK +    E        P     C + F RRD
Sbjct: 8   VQQQGKPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRD 67

Query: 778 HVLQH 782
            +++H
Sbjct: 68  LLVRH 72

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 736 VCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLN 784
            C  C R+ +    L  H   +H+GE P  C  P C K+F  R ++ +H+N
Sbjct: 259 TCLVCGRRCTRPSTLKTHML-IHTGELPFQCSWPGCSKRFNVRSNMNRHVN 308

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 720 KINSEEIIVSDKGKV---YVCQECRRQFSSGHHLTRHKKS-VHSGEKPHSCPKCGKKFKR 775
           +IN ++ +++D  K      C  C + F+   +L+ HK + + S ++PH C  C   F R
Sbjct: 306 EINLKKALLADYSKTKKKRQCPICHKYFA---NLSTHKSTHLTSQDRPHKCIICQSGFAR 362

Query: 776 RDHVLQH 782
            + +++H
Sbjct: 363 NNDLIRH 369

>Scas_712.2
          Length = 327

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 735 YVC--QECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 784
           Y+C  + C ++F    HL  HK + HS  KP  C  C K F     + +HLN
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHKWT-HSKVKPLKCAFCEKGFITNQQLKRHLN 93

>Kwal_27.10167
          Length = 285

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 4/73 (5%)

Query: 713 KRPIAPSKINSEEIIVSDKGKVYVCQE--CRRQFSSGHHLTRHKKSVHSGEKPHSCPKCG 770
           KR   PS +  E +   +  + + C E  C ++F    H+  H+ + HS  KP  C +C 
Sbjct: 44  KRYRKPSSLR-EHVNSHNNNRPFACPEPNCGKRFLRVCHMNVHRWT-HSKIKPLKCEECS 101

Query: 771 KKFKRRDHVLQHL 783
           K F  +  + +HL
Sbjct: 102 KGFTTKQQLSRHL 114

>Scas_683.30
          Length = 478

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 737 CQECRRQFSSGHHLTRHKKSVHSGE-KPHSCPKCGKKFKRRDHVLQH 782
           C  C   ++   +L+ HK +  + E +PH CP C + F R + +++H
Sbjct: 289 CPTCLNYYA---NLSTHKSTHLTPEDRPHKCPICERGFARNNDLIRH 332

>Scas_677.33
          Length = 1685

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 15   VFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVETLQKIRIRTPIQ 74
            V R    + K F+   +++D     + I + +  Q+ L+   MP   E+L+K+    P+ 
Sbjct: 935  VTRITTNQLKKFFGDSKSIDNIELPTNIDEKVLRQDGLEN--MPDAAESLKKLEKEYPLP 992

Query: 75   QHFNGSKG 82
            Q F+G++G
Sbjct: 993  QPFSGTQG 1000

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,134,567
Number of extensions: 1142381
Number of successful extensions: 3762
Number of sequences better than 10.0: 245
Number of HSP's gapped: 3677
Number of HSP's successfully gapped: 327
Length of query: 817
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 707
Effective length of database: 12,788,129
Effective search space: 9041207203
Effective search space used: 9041207203
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)