Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.234421435141468890.0
YER164W (CHD1)1468130046950.0
KLLA0C17578g1525151846490.0
AGR123C1422142146420.0
Scas_576.61457132646000.0
CAGL0L11770g1476133545130.0
Scas_665.17106057712541e-151
YOR304W (ISW2)112057612471e-150
CAGL0I09614g103957912211e-147
Kwal_34.15925102557911911e-143
KLLA0F24838g106257811851e-141
CAGL0C01683g111559611761e-139
AFR537W102557911641e-139
Scas_652.17102558911551e-137
AFL040W108659011441e-135
Kwal_14.1600110252011311e-133
KLLA0F04521g134456211311e-131
AER375C128851911191e-130
KLLA0F06710g109660211041e-130
Scas_662.7134251911141e-129
Kwal_23.4777130156111061e-128
YBR245C (ISW1)112952210921e-128
Scas_597.8106559910811e-127
YIL126W (STH1)135951910951e-126
Kwal_26.9164145452210871e-124
YOR290C (SNF2)170352010941e-124
Scas_594.7170352110941e-124
KLLA0B08327g153451910861e-124
CAGL0G08756g135451810741e-123
AFR562C144451810701e-122
CAGL0M04807g173051810721e-121
KLLA0E04048g8266308731e-100
CAGL0J02662g8446298711e-100
YFR038W8535588594e-98
Kwal_47.180778095888531e-97
ADL098C8045657507e-84
KLLA0F07513g10485307009e-76
ACR286C10195406962e-75
Kwal_26.712310815466876e-74
Sklu_2125.310525276857e-74
Scas_549.410795236842e-73
CAGL0I01694g10715236761e-72
YJR035W (RAD26)10855306752e-72
CAGL0H05533g19045436842e-72
CAGL0H06193g11265556735e-72
YAL019W (FUN30)11315376656e-71
AEL256C18665336709e-71
KLLA0E22726g10335226601e-70
AEL065C10255616591e-70
Scas_664.918595436548e-69
KLLA0E23804g18735466531e-68
YPL082C (MOT1)18675436521e-68
Scas_548.410545366352e-67
Kwal_34.160827264805856e-63
Scas_668.188755115831e-61
CAGL0M01188g14503435893e-61
Kwal_14.15378424755756e-61
AEL297W8954915742e-60
KLLA0A03069g8954785742e-60
Scas_646.3*14563545822e-60
CAGL0I04224g9424805644e-59
ADR309W14863775681e-58
Kwal_55.2014314943275644e-58
YDR334W15143285634e-58
KLLA0F21758g15723275619e-58
YGL163C (RAD54)8984815511e-57
AGL212W9034765394e-56
AGR379W14143345456e-56
Scas_669.2013973325439e-56
Kwal_27.1138813343555411e-55
CAGL0E05038g14843305412e-55
Scas_718.409264965305e-55
YGL150C (INO80)14893335367e-55
Scas_520.58632835223e-54
KLLA0F11814g9314855244e-54
YBR073W (RDH54)9244785218e-54
KLLA0E08965g14893355261e-53
CAGL0M01958g9205014993e-51
Kwal_27.105139004874843e-49
Sklu_1582.22831624071e-43
ADL345C7462052451e-20
Kwal_23.36607681672308e-19
KLLA0C05368g16051282319e-19
KLLA0B09240g8001552201e-17
CAGL0K07766g8301672201e-17
Scas_591.107721672192e-17
YBR114W (RAD16)7901672182e-17
AAR147W15801332121e-16
Kwal_14.186813573462102e-16
Scas_721.10011371362093e-16
Kwal_47.177719723502041e-15
CAGL0A03432g11511382041e-15
YLR032W (RAD5)11691572003e-15
AFR220W10851762003e-15
CAGL0G09493g14083552004e-15
Scas_674.12d13231282004e-15
Sklu_2412.711272921922e-14
KLLA0F17479g11141341914e-14
YOR191W (RIS1)16191331842e-13
YLR247C15561301512e-09
KLLA0F12166g15281391476e-09
CAGL0B05049g14701311423e-08
Scas_573.915021191413e-08
Kwal_14.128715181221342e-07
AAL030C15391281332e-07
Sklu_2234.210061191153e-05
Sklu_2432.914751021010.001
ADL273C623178930.012
CAGL0L03047g715111860.073
KLLA0A05203g435140860.073
KLLA0F10505g812128850.10
Kwal_56.24760433140840.11
Sklu_2273.4435138810.23
YHR169W (DBP8)431141780.60
CAGL0L02915g617180770.75
CAGL0I02354g437138761.1
AFR082C71083751.7
Scas_588.1669360742.1
YLR404W28563695.0
CAGL0J06908g604148696.8
CAGL0H02651g1544103697.4
Kwal_33.1502871737698.7
YHR065C (RRP3)501100689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23442
         (1414 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23442                                                        2658   0.0  
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...  1813   0.0  
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...  1795   0.0  
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...  1792   0.0  
Scas_576.6                                                           1776   0.0  
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...  1743   0.0  
Scas_665.17                                                           487   e-151
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   484   e-150
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   474   e-147
Kwal_34.15925                                                         463   e-143
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   461   e-141
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   457   e-139
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   452   e-139
Scas_652.17                                                           449   e-137
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   445   e-135
Kwal_14.1600                                                          440   e-133
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   440   e-131
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   435   e-130
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   429   e-130
Scas_662.7                                                            433   e-129
Kwal_23.4777                                                          430   e-128
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   425   e-128
Scas_597.8                                                            421   e-127
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   426   e-126
Kwal_26.9164                                                          423   e-124
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   426   e-124
Scas_594.7                                                            426   e-124
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   422   e-124
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   418   e-123
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   416   e-122
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   417   e-121
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   340   e-100
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   340   e-100
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   335   4e-98
Kwal_47.18077                                                         333   1e-97
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   293   7e-84
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   274   9e-76
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   272   2e-75
Kwal_26.7123                                                          269   6e-74
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           268   7e-74
Scas_549.4                                                            268   2e-73
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   265   1e-72
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   264   2e-72
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   268   2e-72
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   263   5e-72
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   260   6e-71
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   262   9e-71
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   258   1e-70
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   258   1e-70
Scas_664.9                                                            256   8e-69
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   256   1e-68
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   255   1e-68
Scas_548.4                                                            249   2e-67
Kwal_34.16082                                                         229   6e-63
Scas_668.18                                                           229   1e-61
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   231   3e-61
Kwal_14.1537                                                          226   6e-61
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...   225   2e-60
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...   225   2e-60
Scas_646.3*                                                           228   2e-60
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   221   4e-59
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   223   1e-58
Kwal_55.20143                                                         221   4e-58
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   221   4e-58
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   220   9e-58
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   216   1e-57
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   212   4e-56
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   214   6e-56
Scas_669.20                                                           213   9e-56
Kwal_27.11388                                                         213   1e-55
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   213   2e-55
Scas_718.40                                                           208   5e-55
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   211   7e-55
Scas_520.5                                                            205   3e-54
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   206   4e-54
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   205   8e-54
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   207   1e-53
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   196   3e-51
Kwal_27.10513                                                         191   3e-49
Sklu_1582.2 , Contig c1582 197-1048                                   161   1e-43
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    99   1e-20
Kwal_23.3660                                                           93   8e-19
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    94   9e-19
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    89   1e-17
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    89   1e-17
Scas_591.10                                                            89   2e-17
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    89   2e-17
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    86   1e-16
Kwal_14.1868                                                           86   2e-16
Scas_721.100                                                           85   3e-16
Kwal_47.17771                                                          83   1e-15
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    83   1e-15
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    82   3e-15
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    82   3e-15
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    82   4e-15
Scas_674.12d                                                           82   4e-15
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          79   2e-14
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    78   4e-14
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    75   2e-13
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    63   2e-09
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    61   6e-09
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    59   3e-08
Scas_573.9                                                             59   3e-08
Kwal_14.1287                                                           56   2e-07
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    56   2e-07
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         49   3e-05
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              44   0.001
ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C (...    40   0.012
CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces c...    38   0.073
KLLA0A05203g complement(462167..463474) highly similar to sp|P38...    38   0.073
KLLA0F10505g complement(966736..969174) some similarities with s...    37   0.10 
Kwal_56.24760                                                          37   0.11 
Sklu_2273.4 YHR169W, Contig c2273 4981-6288                            36   0.23 
YHR169W (DBP8) [2456] chr8 (442180..443475) Essential nucleolar ...    35   0.60 
CAGL0L02915g complement(340834..342687) highly similar to sp|P06...    34   0.75 
CAGL0I02354g 209279..210592 highly similar to sp|P38719 Saccharo...    34   1.1  
AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH] (576175..57...    33   1.7  
Scas_588.16                                                            33   2.1  
YLR404W (YLR404W) [3781] chr12 (928741..929598) Protein of unkno...    31   5.0  
CAGL0J06908g complement(659917..661731) similar to sp|P24784 Sac...    31   6.8  
CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces c...    31   7.4  
Kwal_33.15028                                                          31   8.7  
YHR065C (RRP3) [2353] chr8 complement(227533..229038) Helicase r...    31   9.6  

>Kwal_56.23442
          Length = 1435

 Score = 2658 bits (6889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1307/1414 (92%), Positives = 1307/1414 (92%)

Query: 1    MATKDVAMDMLDNPELYGLRRSGRAAASVQTRYFSDDDEDEDQVVTSRRGRKAKQDDGFX 60
            MATKDVAMDMLDNPELYGLRRSGRAAASVQTRYFSDDDEDEDQVVTSRRGRKAKQDDGF 
Sbjct: 1    MATKDVAMDMLDNPELYGLRRSGRAAASVQTRYFSDDDEDEDQVVTSRRGRKAKQDDGFS 60

Query: 61   XXXXXXXXXXXXXXXXXXXXXXXVVHGRSXXXXXXXXXXXXXXXXXSEEIELPTRFXXXX 120
                                   VVHGRS                 SEEIELPTRF    
Sbjct: 61   SDRLSEEDEVSDESDSMADDDSEVVHGRSKPRPKKKVATKTKKRTPSEEIELPTRFSSRN 120

Query: 121  XXXXXXXXXXXDEDLLESETEQADADMEEYDYTPTPSSQDGQGIDLVITHRLKPDTEESK 180
                       DEDLLESETEQADADMEEYDYTPTPSSQDGQGIDLVITHRLKPDTEESK
Sbjct: 121  NRSVNYNVDYSDEDLLESETEQADADMEEYDYTPTPSSQDGQGIDLVITHRLKPDTEESK 180

Query: 181  DIPDVATCKTNYEFLIKWVDESHLHNSWETYADIGQVRGIKKIDNYIKQFIILDKQIRSD 240
            DIPDVATCKTNYEFLIKWVDESHLHNSWETYADIGQVRGIKKIDNYIKQFIILDKQIRSD
Sbjct: 181  DIPDVATCKTNYEFLIKWVDESHLHNSWETYADIGQVRGIKKIDNYIKQFIILDKQIRSD 240

Query: 241  PYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSDRVTLEDGSSQLQYQVKWRRLNYDEA 300
            PYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSDRVTLEDGSSQLQYQVKWRRLNYDEA
Sbjct: 241  PYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSDRVTLEDGSSQLQYQVKWRRLNYDEA 300

Query: 301  TWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHYGSERPRFEKLVEQPSFIKGGELRDF 360
            TWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHYGSERPRFEKLVEQPSFIKGGELRDF
Sbjct: 301  TWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHYGSERPRFEKLVEQPSFIKGGELRDF 360

Query: 361  QLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPA 420
            QLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPA
Sbjct: 361  QLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPA 420

Query: 421  WQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDR 480
            WQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDR
Sbjct: 421  WQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDR 480

Query: 481  AELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 540
            AELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL
Sbjct: 481  AELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 540

Query: 541  MPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELS 600
            MPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELS
Sbjct: 541  MPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELS 600

Query: 601  DVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDG 660
            DVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDG
Sbjct: 601  DVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDG 660

Query: 661  RMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQ 720
            RMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQ
Sbjct: 661  RMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQ 720

Query: 721  RLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL 780
            RLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL
Sbjct: 721  RLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL 780

Query: 781  QAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKK 840
            QAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKK
Sbjct: 781  QAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKK 840

Query: 841  SDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEF 900
            SDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEF
Sbjct: 841  SDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEF 900

Query: 901  LRQFEVTDYKADVEWDDIIPXXXXXXXXXXXXXRMDEEYVQEQLQLMNRRNNALNRIKAS 960
            LRQFEVTDYKADVEWDDIIP             RMDEEYVQEQLQLMNRRNNALNRIKAS
Sbjct: 901  LRQFEVTDYKADVEWDDIIPEEELKKLKDEEQKRMDEEYVQEQLQLMNRRNNALNRIKAS 960

Query: 961  VXXXXXXXXXXXXXXXTGSKRKSRMSNLDSFGEREVRAIYKCILRYGNLDDKFEELIADG 1020
            V               TGSKRKSRMSNLDSFGEREVRAIYKCILRYGNLDDKFEELIADG
Sbjct: 961  VNGSGINNGDDNEDENTGSKRKSRMSNLDSFGEREVRAIYKCILRYGNLDDKFEELIADG 1020

Query: 1021 SLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSAAFASLEKSAQAYREKLKAHGQQLDEK 1080
            SLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSAAFASLEKSAQAYREKLKAHGQQLDEK
Sbjct: 1021 SLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSAAFASLEKSAQAYREKLKAHGQQLDEK 1080

Query: 1081 DKSNPIXXXXXXXXXXXXVLFEFYDVKSLNAETILTRPDEMGFLTTFLRKNYPDDPLKFK 1140
            DKSNPI            VLFEFYDVKSLNAETILTRPDEMGFLTTFLRKNYPDDPLKFK
Sbjct: 1081 DKSNPIAKLAAKKKEKKAVLFEFYDVKSLNAETILTRPDEMGFLTTFLRKNYPDDPLKFK 1140

Query: 1141 FVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYGAWAQIRDDPFLGLSDKIFLNEPQTNN 1200
            FVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYGAWAQIRDDPFLGLSDKIFLNEPQTNN
Sbjct: 1141 FVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYGAWAQIRDDPFLGLSDKIFLNEPQTNN 1200

Query: 1201 GKADNISAADQKTKNSGAGGSKKVPGSVHLGRRTDYLFAVLKDEIKPHXXXXXXXXXXXP 1260
            GKADNISAADQKTKNSGAGGSKKVPGSVHLGRRTDYLFAVLKDEIKPH           P
Sbjct: 1201 GKADNISAADQKTKNSGAGGSKKVPGSVHLGRRTDYLFAVLKDEIKPHTSSGTNSGNSSP 1260

Query: 1261 LPGASTGSKKRVRKAPTSRSATPDAKADEIRSGPAKRVKKMGMGRSSPPPLVATARKAKS 1320
            LPGASTGSKKRVRKAPTSRSATPDAKADEIRSGPAKRVKKMGMGRSSPPPLVATARKAKS
Sbjct: 1261 LPGASTGSKKRVRKAPTSRSATPDAKADEIRSGPAKRVKKMGMGRSSPPPLVATARKAKS 1320

Query: 1321 VKGGTAPRGNSAPDKEYDSMEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELR 1380
            VKGGTAPRGNSAPDKEYDSMEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELR
Sbjct: 1321 VKGGTAPRGNSAPDKEYDSMEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELR 1380

Query: 1381 TVGDHIETKKVSSKKYPPEKFRKHLWAFSSHYWP 1414
            TVGDHIETKKVSSKKYPPEKFRKHLWAFSSHYWP
Sbjct: 1381 TVGDHIETKKVSSKKYPPEKFRKHLWAFSSHYWP 1414

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
            ATP-dependent nucleosome remodeling activity, member of
            the Chromodomain-Helicase-DNA-binding (CHD) family [4407
            bp, 1468 aa]
          Length = 1468

 Score = 1813 bits (4695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 894/1300 (68%), Positives = 1031/1300 (79%), Gaps = 32/1300 (2%)

Query: 140  TEQADADMEEYDYTPTPSSQDGQGIDLVITHRLKPDTEESK----DIPDVATCKTNYEFL 195
            +E+A ++   ++ +  P  +D  GID+VI HRLK   EE K     +PD+  CK NYEFL
Sbjct: 155  SEEALSEENVHEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFL 214

Query: 196  IKWVDESHLHNSWETYADIGQVRGIKKIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEK 255
            IKW DESHLHN+WETY  IGQVRG+K++DNY KQFII D+Q+R DPY TAEDIE+MD+E+
Sbjct: 215  IKWTDESHLHNTWETYESIGQVRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMER 274

Query: 256  ERRLDEFEEYKIPERIIDSDRVTLEDGSSQLQYQVKWRRLNYDEATWESAGTIVKLAPEQ 315
            ERRLDEFEE+ +PERIIDS R +LEDG+SQLQY VKWRRLNYDEATWE+A  IVKLAPEQ
Sbjct: 275  ERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQ 334

Query: 316  VKHFQNRINSKILPQYSSHYGSERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKN 375
            VKHFQNR NSKILPQYSS+Y S+RPRFEKL  QP FIKGGELRDFQLTGINWMAFLWSK 
Sbjct: 335  VKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKG 394

Query: 376  DNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCI 435
            DNGILADEMGLGKTVQTVAFISWLI+ARRQNGPH++VVPLSTMPAW +TFEKWAPDLNCI
Sbjct: 395  DNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCI 454

Query: 436  YFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDE 495
             ++GNQKSRD IRE EF+TNP+AK KK  KFNVLLTTYEYILKDRAELG+IKWQF+AVDE
Sbjct: 455  CYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDE 514

Query: 496  AHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFEN 555
            AHRLKNAESSLYESLNSFKVANR+LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFEN
Sbjct: 515  AHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFEN 574

Query: 556  QDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNY 615
            QD EQE YI DLH R+QPFILRRLKKDVEKSLPSKTERILRVELSDVQT+YYKNILTKNY
Sbjct: 575  QDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNY 634

Query: 616  SALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSS 675
            SAL+AG+KG HFSLLNIMNELKKASNHPYLFD AE+RVL KFGDG+M+REN+LRGLIMSS
Sbjct: 635  SALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSS 694

Query: 676  GKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISI 735
            GKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYL+IKGI +QRLDGTVPSAQRRISI
Sbjct: 695  GKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISI 754

Query: 736  DHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHV 795
            DHFN+PDSNDFVFLLSTRAGGLGINLMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHV
Sbjct: 755  DHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHV 814

Query: 796  MVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFG 855
            MVYR VSKDTVEEEVLERARKKMILEYAIISLGVTDG+  T  KK++P+AGELS ILKFG
Sbjct: 815  MVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYT--KKNEPNAGELSAILKFG 872

Query: 856  AGNMFKATDNQRKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEW 915
            AGNMF ATDNQ+KLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFL+QFEVTDYKAD++W
Sbjct: 873  AGNMFTATDNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDW 932

Query: 916  DDIIPXXXXXXXXXXXXXRMDEEYVQEQLQLMNRRNNALNRIKASVX--XXXXXXXXXXX 973
            DDIIP             R DEEYV+EQL++MNRR+NAL +IK SV              
Sbjct: 933  DDIIPEEELKKLQDEEQKRKDEEYVKEQLEMMNRRDNALKKIKNSVNGDGTAANSDSDDD 992

Query: 974  XXXTGSKRKSRMSNLDSFGEREVRAIYKCILRYGNLDDKFEELIADGSLPVKTIDGYSGI 1033
                 S+R++R +++DS GE EVRA+YK IL++GNL +  +ELIADG+LPVK+ + Y   
Sbjct: 993  STSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGET 1052

Query: 1034 YHEMIAEAKSCIKIEEEKRSAAFASLEKSAQAYREKLKAHGQQLDEKDKSNPIXXXXXXX 1093
            Y EM+  AK C+  EE+ R      LEK A AYR KLK+   + + + K NP+       
Sbjct: 1053 YDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKK 1112

Query: 1094 XXXXXVLFEFYDVKSLNAETILTRPDEMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWN 1153
                 VLF F  VKSLNAE++L+R +++ +L   +  NY DDPLKF   N  PKPV NW+
Sbjct: 1113 REKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWS 1172

Query: 1154 CSWSKEDDEKLLVGVNKYGYGAWAQIRDDPFLGLSDKIFLNE---PQTNNGKADNISAAD 1210
             +W+KE+DEKLL+GV KYGYG+W QIRDDPFLG++DKIFLNE   P      + + +   
Sbjct: 1173 SNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLNEVHNPVAKKSASSSDTTPT 1232

Query: 1211 QKTKNSG-AGGSKKVPGSVHLGRRTDYLFAVLKDEIKPHXXXXXXXXXXXPLPGASTG-S 1268
               K  G  G SKKVPG++HLGRR DYL + L+  +              P     TG S
Sbjct: 1233 PSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLRGGLNTKSPSADIGSKKLP-----TGPS 1287

Query: 1269 KKRVRK-APTSRSATPDAKADEIRSG-PAKRVKKMGMG--------RSSP----PPLVAT 1314
            KKR RK A  S+S TP+  + E  +G P+KR+K +  G        R SP    PPL + 
Sbjct: 1288 KKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSK 1347

Query: 1315 ARKAKSVKGGTAPRGNSAPDKEYDSMEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATI 1374
              +    +  + P   SA +KEYDSM+EE+C+  M  ++ SLKRL RGGK LDRKEWA I
Sbjct: 1348 VSRDNGTRQSSNPSSGSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKI 1407

Query: 1375 LKEELRTVGDHIETKKVSSKKYPPEKFRKHLWAFSSHYWP 1414
            LK EL T+G+HIE++K SS+K  PEK+RKHLW++S+++WP
Sbjct: 1408 LKTELTTIGNHIESQKGSSRKASPEKYRKHLWSYSANFWP 1447

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/35 (62%), Positives = 27/35 (77%), Gaps = 1/35 (2%)

Query: 1  MATKDVAMDMLDNPELYGLRRSGRAAASVQTRYFS 35
          MA KD++ ++L NPELYGLRRS RAAA  Q  YF+
Sbjct: 1  MAAKDISTEVLQNPELYGLRRSHRAAAH-QQNYFN 34

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
            cerevisiae YER164w CHD1 transcriptional regulator, start
            by similarity
          Length = 1525

 Score = 1795 bits (4649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/1518 (61%), Positives = 1097/1518 (72%), Gaps = 120/1518 (7%)

Query: 3    TKDVAMDMLDNPELYGLRRSGRAAASVQTRYFSDDDEDEDQVVTSRRG---RKA-KQD-- 56
             +D+  ++L NPELYGLRRS RAA +  T    D D DE +V+  RRG   RKA KQ+  
Sbjct: 2    VQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDE-EVIRPRRGKQKRKAVKQEHN 60

Query: 57   -----------DGFXXXXXXXXXXXXXXXXXXXXXXXXVVHGRSXXXXXXXXXXXXXXXX 105
                       D F                        V  G S                
Sbjct: 61   YDEEEEEEEEIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESD--- 117

Query: 106  XSEEIELPTRFXXXXXXXX---XXXXXXXDEDLLESETEQ--------ADADMEE-YDYT 153
              E + LPTRF                  DEDL+ES  EQ         D D+++ Y  +
Sbjct: 118  -EENVVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSAS 176

Query: 154  PTPSSQDGQGIDLVITHRLKPDTEESKDIP----DVATCKTNYEFLIKWVDESHLHNSWE 209
            P+P  Q+   ID+V+ HRLK   + S        DV + + N+EFLIKW D+SHLHNSWE
Sbjct: 177  PSPQ-QETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWE 235

Query: 210  TYADIGQ--VRGIKKIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKI 267
            +Y D+ +   +G+K+I+NY KQFIILD+++R+DPYTT EDIEVMDLE ERR+DEFEE+K+
Sbjct: 236  SYEDLKENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKV 295

Query: 268  PERIIDSDRVTLEDGS--SQLQYQVKWRRLNYDEATWESAGTIVKLAPEQVKHFQNRINS 325
            PERIIDS+R   EDGS  SQL+Y VKWRRLNYDE TWE A  IVK+APEQVK FQNR NS
Sbjct: 296  PERIIDSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNS 355

Query: 326  KILPQYSSHY-GSERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEM 384
            KI+PQ SS+Y  ++RP+FEKL  QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEM
Sbjct: 356  KIMPQNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEM 415

Query: 385  GLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSR 444
            GLGKTVQTV+FISWLIYARRQNGPHLVVVPLSTMPAWQETF+KWAP LNC+Y++GNQ SR
Sbjct: 416  GLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASR 475

Query: 445  DAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAES 504
            D I++ EF+TNPQAK KKH KFNVLLTTYEYILKDR+ LG+IKWQFLAVDEAHRLKNAES
Sbjct: 476  DLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAES 535

Query: 505  SLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYI 564
            SLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQD +QE YI
Sbjct: 536  SLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYI 595

Query: 565  RDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKG 624
            RDLH RLQPFILRRLKKDVEKSLPSKTERILRVELSDVQT+YYKNILTKNYSAL++G KG
Sbjct: 596  RDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG 655

Query: 625  AHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQL 684
             H SLLN+MNELKKASNHPYLFD AE+RVL+KFGDG  SRENILRGLIMSSGKMVLLD+L
Sbjct: 656  GHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDKL 715

Query: 685  LTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSN 744
            LTRLKKDGHRVLIFSQMVR+LDILGDYL+IKGI +QRLDGTVPSAQRRISIDHFNA DSN
Sbjct: 716  LTRLKKDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSN 775

Query: 745  DFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKD 804
            DFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKD
Sbjct: 776  DFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKD 835

Query: 805  TVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATD 864
            TVEEEVLERARKKMILEYAIISLGVTDG+ I+ +KK++PSAGELSEILKFGAGNMFK  D
Sbjct: 836  TVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPND 895

Query: 865  NQRKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWDDIIPXXXX 924
            NQ+KLEDLNLD+VLNHAEDH+TTP+LGES+LGGEEFLRQFEVTDYKADV+WDDIIP    
Sbjct: 896  NQQKLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPEDEL 955

Query: 925  XXXXXXXXXRMDEEYVQEQLQLMNRRNNALNRIKASVXXXXXXXXXXXXXXXTGSKRKSR 984
                     R+DEEYV+EQL +MNR+  A+++IK SV               + S+++S+
Sbjct: 956  KKLKDEEQRRIDEEYVREQLDIMNRKTAAIDKIKRSV-NGETFGSDSEDEGNSKSRKRSK 1014

Query: 985  MSNLDSFGEREVRAIYKCILRYGNLDDKFEELIADGSLPVKTIDGYSGIYHEMIAEAKSC 1044
             +NLD+FGERE+RA+YKCILR+G++++KFEELIADGSLPVK+ID Y  +YHEMI EA++ 
Sbjct: 1015 ANNLDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETL 1074

Query: 1045 IKIEEEKRSAAFASLEKSAQAYREKLK-AHGQQLDEKDKSNPIXXXXXXXXXXXXVLFEF 1103
            ++ EE KR   F+ LEK A  YR+K+K    +  D+  K  PI            +LFEF
Sbjct: 1075 MRDEEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEF 1134

Query: 1104 YDVKSLNAETILTRPDEMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWNCSWSKEDDEK 1163
            +D K+LNA+T++ R D + FL+ F+ +NY DDPL+FKFVNK PKPV+ WNC W KEDDEK
Sbjct: 1135 HDTKALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEK 1194

Query: 1164 LLVGVNKYGYGAWAQIRDDPFLGLSDKIFLNEPQTNNG----------KADNISAADQKT 1213
            LL+G+ KYGYGAW QIRDDPFLGL++K+FLN   T              A   S A   T
Sbjct: 1195 LLIGIYKYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKAATPAAPSLTPSAPGASVAGSST 1254

Query: 1214 ------------------------KNSGAGGSKKVPGSVHLGRRTDYLFAVLKDEIKPHX 1249
                                    +N+     KK PG+VHLGRR DYLF VL+DE K   
Sbjct: 1255 PGADAVKTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAK--- 1311

Query: 1250 XXXXXXXXXXPLPGASTGS------KKRVRKAPTS------------------------- 1278
                      P   +STG+      K++ +K+ T+                         
Sbjct: 1312 --GPQTDPSHPAGSSSTGTTTPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLT 1369

Query: 1279 -RSATPDAKADEIRSGPAKRVKKMGMGRSSPPPLVATARKAKSVKGGTAPRGN-SAPDKE 1336
             + +TPD  + E + G A   ++    RS  P + +  ++ K      AP+ +   PDKE
Sbjct: 1370 GKDSTPD-NSSETKRGKAHHHQQPS-SRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKE 1427

Query: 1337 YDSMEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELRTVGDHIETKKVSSKKY 1396
            YDSM+EEECK  M  +++SLKRL  GG GL+RK+WA +LK+EL+ VGD+IE+ K  S K 
Sbjct: 1428 YDSMDEEECKKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKT 1487

Query: 1397 PPEKFRKHLWAFSSHYWP 1414
             PEK+++HLW+F+++YWP
Sbjct: 1488 SPEKYKRHLWSFTAYYWP 1505

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..985231)
            [4269 bp, 1422 aa]
          Length = 1422

 Score = 1792 bits (4642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/1421 (64%), Positives = 1062/1421 (74%), Gaps = 32/1421 (2%)

Query: 3    TKDVAMDMLDNPELYGLRRSGR--AAASVQTRYFSDDDEDEDQVVTSRRGR---KAKQDD 57
             KD+  ++L NPELYGLRRS R     S Q  Y+  +D DED VV S RGR   KA   D
Sbjct: 2    AKDLPDEVLANPELYGLRRSHRTPVGGSTQATYYESND-DEDSVVVSGRGRKRKKAIDID 60

Query: 58   GFXXXXXXXXXXXXXXXXXXXXXXXXVVHGRSXXXXXXXXXXXXXXXXXSEEIELPTRFX 117
             +                                                ++I LPTRF 
Sbjct: 61   SYSEEEPADNESTNEDISGDEDEDFGA-------PVRRRRKKGRRELSAEDDIMLPTRFS 113

Query: 118  XXXXXXXXXXXXXXDEDLLESETEQADADMEEYDY----TPTPSSQDGQGIDLVITHRLK 173
                          D+DLLES  E+ + D  +         TP   D  GID V+THRL 
Sbjct: 114  SRNNKAVNYNIDYSDDDLLESAEEEYEGDEGDEGEEEAYAQTPQIPDEHGIDFVVTHRLH 173

Query: 174  PDTEESKDIPDVATCKTNYEFLIKWVDESHLHNSWETYADIGQVRGIKKIDNYIKQFIIL 233
                E  +  DV  CK  YEFLIKW +ESH+HN+WET   +G VRG+KK+DNYIKQ+I+L
Sbjct: 174  EGHTEPVEW-DVPECKECYEFLIKWNNESHIHNTWETAESLGNVRGVKKVDNYIKQYILL 232

Query: 234  DKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSDRVTLEDGSSQLQYQVKWR 293
            D ++R+D YTT EDIEVMDLE ERR DEFEE+K  ERIIDSDRVTL+DGSSQLQY VKW+
Sbjct: 233  DHELRTDKYTTREDIEVMDLEHERRCDEFEEFKKVERIIDSDRVTLDDGSSQLQYLVKWK 292

Query: 294  RLNYDEATWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHYGSERPRFEKLVEQPSFIK 353
            RLNYDEATWE+A  IVK+APE+VK FQ+R +SKILPQ+SS+YGS+RP FEKL  QPSFIK
Sbjct: 293  RLNYDEATWENASVIVKMAPEEVKRFQSRSSSKILPQHSSNYGSQRPGFEKLSVQPSFIK 352

Query: 354  GGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVV 413
            GGELRDFQLTGINWMAFLWSK+DNGILADEMGLGKTVQTV+FISWLI+ARRQNGPHLVVV
Sbjct: 353  GGELRDFQLTGINWMAFLWSKSDNGILADEMGLGKTVQTVSFISWLIFARRQNGPHLVVV 412

Query: 414  PLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTY 473
            PLSTMPAWQETFEKWAP+LNC+Y++GNQKSRD IRE EF+TNP  K KK+ KFNVLLTTY
Sbjct: 413  PLSTMPAWQETFEKWAPELNCVYYMGNQKSRDVIREYEFYTNPHTKGKKNIKFNVLLTTY 472

Query: 474  EYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKEL 533
            EYILKDR ELGAIKWQFLAVDEAHRLKNAESSLYESL+SFKVANR+LITGTPLQNNIKEL
Sbjct: 473  EYILKDRLELGAIKWQFLAVDEAHRLKNAESSLYESLSSFKVANRMLITGTPLQNNIKEL 532

Query: 534  AALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTER 593
            AALVNFLMPG+FTIDQEIDFENQD +QE YIRDLH RLQP+ILRRLKKDVEKSLPSKTER
Sbjct: 533  AALVNFLMPGKFTIDQEIDFENQDEKQENYIRDLHKRLQPYILRRLKKDVEKSLPSKTER 592

Query: 594  ILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRV 653
            ILRVELSDVQT+YYKNILTKNY+AL+AG+KG HFSLLNIMNELKKASNHPYLF  AE+RV
Sbjct: 593  ILRVELSDVQTEYYKNILTKNYNALTAGTKGTHFSLLNIMNELKKASNHPYLFGNAENRV 652

Query: 654  LAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLN 713
            LAKFGDG  SRENILRGLIMSSGKMVLLD+LLTRLKKDGHRVLIFSQMVRMLDILGDYL+
Sbjct: 653  LAKFGDGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRVLIFSQMVRMLDILGDYLS 712

Query: 714  IKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSD 773
            IKGI +QRLDGTVPS+QRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSD
Sbjct: 713  IKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSD 772

Query: 774  WNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGS 833
            WNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDG+
Sbjct: 773  WNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGN 832

Query: 834  NITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNHAEDHVTTPDLGES 893
              T   K++PSAGELSEILKFGAGNMFKA DNQ+KLEDLNLDDVLNHAEDHVTTPDLGES
Sbjct: 833  KYTSKSKAEPSAGELSEILKFGAGNMFKAHDNQKKLEDLNLDDVLNHAEDHVTTPDLGES 892

Query: 894  HLGGEEFLRQFEVTDYKADVEWDDIIPXXXXXXXXXXXXXRMDEEYVQEQLQLMNRRNNA 953
            HLGGEEFL+QFEVTDYKADVEWDDIIP             R DEEYVQEQLQ+MNRRN A
Sbjct: 893  HLGGEEFLKQFEVTDYKADVEWDDIIPEDELRKLKDEEQKRKDEEYVQEQLQMMNRRNVA 952

Query: 954  LNRIKASVXXXXXXXXXXXXXXXTGSKRKSRMSNLDSFGEREVRAIYKCILRYGNLDDKF 1013
            LN+IK SV               + SK++++ +NL+S GERE+RA+YK IL+YG+L ++ 
Sbjct: 953  LNKIKNSV--NGDGAQSLSDKEDSRSKKRAKSNNLNSIGEREIRALYKAILKYGDLTERL 1010

Query: 1014 EELIADGSLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSAAFASLEKSAQAYREKLKAH 1073
             +LIADG+LPVK+++ Y  +Y E+++ A+  I  EE KR+ A + LE+  + Y+ K+K+ 
Sbjct: 1011 GDLIADGTLPVKSLEKYGELYDELMSIARKQINDEESKRNEAISRLERDVEEYKTKVKSG 1070

Query: 1074 GQQLDEKDKSNPIXXXXXXXXXXXXVLFEFYDVKSLNAETILTRPDEMGFLTTFLRKNYP 1133
              + D+  K  PI            VLFEFY++K LNAETI+ R D++ FL  FL+ NYP
Sbjct: 1071 EIKPDDNAKDLPIARLAAKRREKRAVLFEFYEIKGLNAETIVNRTDDLRFLHNFLKNNYP 1130

Query: 1134 DDPLKFKFVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYGAWAQIRDDPFLGLSDKIFL 1193
             DP+KF+F+N++PKP+TNWNC+W++EDDEKLLVGV+KYGYG+W+Q+RDDPFLGLSDKIFL
Sbjct: 1131 SDPMKFRFLNRLPKPITNWNCTWTQEDDEKLLVGVDKYGYGSWSQVRDDPFLGLSDKIFL 1190

Query: 1194 NEPQTNNGKADNISAADQKTKNSGAGGSKKVPGSVHLGRRTDYLFAVLKDEIKPHXXXXX 1253
            NEP T    +    A     K   A  +KKVPGSVHLGRR DYL  VL++E K       
Sbjct: 1191 NEPGTQTNDSAAADADAADKKTRLANAAKKVPGSVHLGRRVDYLLTVLREEAKGTDSAAA 1250

Query: 1254 XXXXXXPLPGASTGSKKRVRKAPTSRSATPDAKADEIRSGPAKRVKKMGMGRSSPPPLVA 1313
                      A   S        +S+SATPDA+ ++  S    R        SS  P   
Sbjct: 1251 PQAALAAKKRARKSSG-------SSKSATPDARPEDSPSIKRTRALPAASRPSSGSPGPQ 1303

Query: 1314 TARKAKSVKGGTAPRGNSAPDKEYDSMEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWAT 1373
              R  K      AP      ++EY+SM+E+EC+  M  ++ SLKRL RGG GLDR EWA 
Sbjct: 1304 LKRNGKKQASPKAPM-----EREYESMDEDECRRTMHSVRASLKRLKRGGAGLDRNEWAA 1358

Query: 1374 ILKEELRTVGDHIETKKVSSKKYPPEKFRKHLWAFSSHYWP 1414
            ILK EL  VG++IE  K  S      +F++HLW++S+ +WP
Sbjct: 1359 ILKRELLAVGNYIERHKGDSADRDRAQFKRHLWSYSAQFWP 1399

>Scas_576.6
          Length = 1457

 Score = 1776 bits (4600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 882/1326 (66%), Positives = 1032/1326 (77%), Gaps = 36/1326 (2%)

Query: 112  LPTRFXXXXXXXXXXXXXXXDEDLLESETEQADADMEE---------------YDYTPTP 156
            +P RF               D+DLL SE    D DM                  +Y+ TP
Sbjct: 122  VPVRFSERNNKTVNYNVDYSDDDLLVSE---EDYDMNSDDEDEENDEEDTGNRLEYSATP 178

Query: 157  SSQDGQGIDLVITHRLKPDTEES--KDIPDVATCKTNYEFLIKWVDESHLHNSWETYADI 214
              +D   ID+VITH+LK   +ES  K + ++  CK N +FLIKW D+SHLHN+WETY  +
Sbjct: 179  QLEDVHSIDMVITHKLKDGVDESVWKKVMNLQECKDNIQFLIKWTDQSHLHNTWETYESL 238

Query: 215  GQVRGIKKIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDS 274
            GQ++G+K++DNY KQFII D+Q+R DPY T ED+EVMD+E+ERRLDEF+E+ IPERI+DS
Sbjct: 239  GQIKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEFTIPERIVDS 298

Query: 275  DRVTLEDGSSQLQYQVKWRRLNYDEATWESAGTIVKLAPEQVKHFQNRINSKILPQYSSH 334
             RVTL+DG+S+LQY VKW+RLNYDEATWE+A  IVK APEQVKHFQNRINSKILPQ S++
Sbjct: 299  QRVTLDDGTSELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRINSKILPQNSTN 358

Query: 335  YG-SERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 393
            Y  S RP+FEKLVEQPS++K GELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV
Sbjct: 359  YNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 418

Query: 394  AFISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFF 453
            AFISWLIYARRQNGPH+VVVPLSTMPAWQETF+KWAPDLN I ++GNQ+SRDAIRE EF+
Sbjct: 419  AFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFY 478

Query: 454  TNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSF 513
            TNP AK KK+ KFNVLLTTYEYILKDR+ELG+IKWQFLAVDEAHRLKNAESSLYESLNSF
Sbjct: 479  TNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSLYESLNSF 538

Query: 514  KVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQP 573
            KV NRLLITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQD EQE YIRDLH RLQP
Sbjct: 539  KVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEEYIRDLHKRLQP 598

Query: 574  FILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIM 633
            FILRRLKKDVEKSLPSKTERILRVELSDVQT+YYKNILTKNYSAL+AGSKG HFSLLNIM
Sbjct: 599  FILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIM 658

Query: 634  NELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH 693
            +ELKKASNHPYLFD AE+RVL KFGDG+MSREN+LRGLIMSSGKMVLLDQLL +LKKDGH
Sbjct: 659  SELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGH 718

Query: 694  RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTR 753
            RVLIFSQMVRMLDILGDYL+IKGIT+QRLDGTVPSAQRRISIDHFNAPDS D VFLLSTR
Sbjct: 719  RVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTR 778

Query: 754  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 813
            AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLER
Sbjct: 779  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLER 838

Query: 814  ARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLN 873
            ARKKMILEYAIISLGVTDGS  T  KK++P+ GELSEILKFGAGNMF A DNQ+KLEDLN
Sbjct: 839  ARKKMILEYAIISLGVTDGSKYT--KKNEPNPGELSEILKFGAGNMFAAKDNQKKLEDLN 896

Query: 874  LDDVLNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWDDIIPXXXXXXXXXXXXX 933
            LDDVLNHAEDHVTTPDLGESHLGGEEFL+QFEVTDYKADV+WDDIIP             
Sbjct: 897  LDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLKDEEQK 956

Query: 934  RMDEEYVQEQLQLMNRRNNALNRIKASVXXXXXXXXXXXXXXXTGSKRKSRMSNLDSFGE 993
            R D+EY++EQL +MNRR+NAL +IK SV                 SKR++R ++L S GE
Sbjct: 957  RKDDEYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRRAR-NDLTSIGE 1015

Query: 994  REVRAIYKCILRYGNLDDKFEELIADGSLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRS 1053
             E+RAIYK +L+YG+L + FEELI+DG+LPVK+ID Y  +Y EM+  A+  +  EE KR 
Sbjct: 1016 SEIRAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARENLHSEEAKRK 1075

Query: 1054 AAFASLEKSAQAYREKLKAHGQQLDEKDKSNPIXXXXXXXXXXXXVLFEFYDVKSLNAET 1113
                 LEK A  YR KLK+   + D++ K NP             +LF FYDVKSLNAE+
Sbjct: 1076 EIMEKLEKKAHEYRLKLKSGEIKPDDQPKDNPNAELAMKRKEKKAILFTFYDVKSLNAES 1135

Query: 1114 ILTRPDEMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGY 1173
             + R + + FL  ++ +++ DDPLKF   N+ PK V NW+ +W+KEDDEKLLVGV KYGY
Sbjct: 1136 FIGRAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDEKLLVGVFKYGY 1195

Query: 1174 GAWAQIRDDPFLGLSDKIFLNEPQTNN-GKADNISAADQKTKNSGA-GGSKKVPGSVHLG 1231
            G+W QIRDDPFLGL++KIFLN+  ++   K +  +      K  G  G SKKVPG++HLG
Sbjct: 1196 GSWTQIRDDPFLGLTNKIFLNDSSSDPVMKKETATNTTNTKKGKGVTGSSKKVPGAIHLG 1255

Query: 1232 RRTDYLFAVLKDEIKPHXXXXXXXXXXXPLPGASTGSKKRVRKAPTSRS---ATPDAKAD 1288
            RR DYL +V++DE + +           P  G     + ++ K PT++S   +TP +K  
Sbjct: 1256 RRVDYLISVMRDESQEN----TPSATATPTSGLKRKRQTKLSKPPTAKSSVNSTPSSKRT 1311

Query: 1289 EIRSGPAKRVKKMGMGRSSPPPLVATARKAKSVKGGTAPRGNSAPDKEYDSMEEEECKAA 1348
            ++     K+V K     S+ P  V    K ++    T P   +  +KEY+SM+E+EC+ A
Sbjct: 1312 KLTPKTLKKVTKASKSVSNSPTPV---NKKRTTSNMTPPGSENVIEKEYESMDEDECRHA 1368

Query: 1349 MQPMKNSLKRLSRGGKGLDRKEWATILKEELRTVGDHIETKKVSSKKYPPEKFRKHLWAF 1408
            M P++ SLK+L  G KGLDRKE+A +LK EL  +GDHIE++K +SKK  P  F+KHLW++
Sbjct: 1369 MAPVRLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPVNFKKHLWSY 1428

Query: 1409 SSHYWP 1414
            SSH+WP
Sbjct: 1429 SSHFWP 1434

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 37/57 (64%), Gaps = 4/57 (7%)

Query: 2  ATKDVAMDMLDNPELYGLRRSGRAAASVQTRYFSDDDEDEDQVVT-SRRGRKAKQDD 57
          + KD+  ++L NPELYGLRRS RA       YF D+++DED V T SRRGRK    D
Sbjct: 3  SVKDLPNEILQNPELYGLRRSHRAPTH---NYFEDEEDDEDAVKTSSRRGRKKSNVD 56

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
            Saccharomyces cerevisiae YER164w CHD1 transcriptional
            regulator, start by similarity
          Length = 1476

 Score = 1743 bits (4513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 870/1335 (65%), Positives = 1024/1335 (76%), Gaps = 38/1335 (2%)

Query: 108  EEIELPTRFXXXXXXXXXXXXXXXDEDLLESETEQA-------DADMEEYDYTPTPSSQD 160
            +++ +PTRF               D+DLLESE E         D D E    + TP  +D
Sbjct: 132  KQVAIPTRFSSRANKQVNYNIDYSDDDLLESEEEFDSDEDELLDEDQESRARSNTPPQED 191

Query: 161  GQGIDLVITHRLKPDTEE---SKDIPDVATCKTNYEFLIKWVDESHLHNSWETYADIGQV 217
              GID+VITHR+K  +++   +K +P++  CK NYEF IKW D+SHLHN+WETY  +  V
Sbjct: 192  VHGIDMVITHRIKEGSDKEHLAKIVPELNVCKENYEFQIKWTDQSHLHNTWETYESLAGV 251

Query: 218  RGIKKIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKIPERIIDSDRV 277
            +GIK++DNY KQ+II ++Q+R DPY T EDIE+MD+E ERRLDE +E+  PERIIDS RV
Sbjct: 252  KGIKRLDNYCKQYIIQEQQVRLDPYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQRV 311

Query: 278  TLEDGSSQLQYQVKWRRLNYDEATWESAGTIVKLAPEQVKHFQNRINSKILPQYSSHYGS 337
             LEDG+SQLQY VKWR LNYDEATWE A  IVK+APE VKHFQ+R NSKILPQYSS+Y S
Sbjct: 312  ELEDGTSQLQYLVKWRHLNYDEATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNYTS 371

Query: 338  ERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFIS 397
            ERPRFEKL  QP FIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFIS
Sbjct: 372  ERPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFIS 431

Query: 398  WLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQ 457
            WLI+ARRQNGPHLVVVPLSTMPAW ETFEKWAPD++ I ++GNQKSRD  RE EF++NP+
Sbjct: 432  WLIFARRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPK 491

Query: 458  AKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 517
             K KK  KFNVL+TTYEYILKDRAELG+IKWQFLAVDEAHRLKNAESSLYESLNSFKVAN
Sbjct: 492  GKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 551

Query: 518  RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILR 577
            RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQD EQE YIRDLH RLQPFILR
Sbjct: 552  RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPFILR 611

Query: 578  RLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELK 637
            RLKKDVEKSLPSKTERILRVELSDVQT+YYKNILTKNYSAL+AG+KG  FS+LNIMN L 
Sbjct: 612  RLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLM 671

Query: 638  KASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLI 697
            KASNHPYLFD AE++VL KFG G MSRENILRGLIMSSGKMVLLD+LLTRLKKDGHRVLI
Sbjct: 672  KASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRVLI 731

Query: 698  FSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGL 757
            FSQMVR+LDILGDYL+IKGI +QRLDGTVPS QRRI+IDHFNAP S+DFVFLLSTRAGGL
Sbjct: 732  FSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGL 791

Query: 758  GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 817
            GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERARKK
Sbjct: 792  GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 851

Query: 818  MILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDV 877
            MILEYAIISLGVTDG+  T  KK++PSAGELSEILKFGAGNMF A DNQ+KLEDLNLDDV
Sbjct: 852  MILEYAIISLGVTDGNKYT--KKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDV 909

Query: 878  LNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWDDIIPXXXXXXXXXXXXXRMDE 937
            L+HAEDHVTTPDLGESHLGGEEFL+QFEVTDYKADV+WDDIIP               DE
Sbjct: 910  LSHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEEELKKLQDEEQRHKDE 969

Query: 938  EYVQEQLQLMNRRNNALNRIKASVXXXXXXXXXXXXXXXTGSKRKSRMSNLDSFGEREVR 997
            EYV+EQL++MNRRNNAL +IK SV               + S+R+++ ++L+S G+ EVR
Sbjct: 970  EYVKEQLEMMNRRNNALKKIKDSVNGEGSTVTSDDEDGRS-SRRRAKTNDLNSIGDSEVR 1028

Query: 998  AIYKCILRYGNLDDKFEELIADGSLPVKTIDGYSGIYHEMIAEAKSCIKIEEEKRSAAFA 1057
            A+Y+ +LR+G++ DK +ELIADG+LPVK+I+ Y  I  E++ EAKS  + E+ KR+    
Sbjct: 1029 ALYRAVLRFGDVTDKLDELIADGTLPVKSIEKYKEILEELLDEAKSIYEEEDTKRTQTLR 1088

Query: 1058 SLEKSAQAYREKLKAHGQQLDEKDKSNPIXXXXXXXXXXXXVLFEFYDVKSLNAETILTR 1117
              E +A  Y+ KLK    + +E++K NPI            +LF F+ VKSLNAE+I+ R
Sbjct: 1089 EFEAAAHEYKMKLKTGEIKAEEQEKDNPITRLTMKRREKKAILFTFHKVKSLNAESIVNR 1148

Query: 1118 PDEMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWNCSWSKEDDEKLLVGVNKYGYGAWA 1177
              ++ F+  + + ++ +DPL+FKF    PKPVTNWNC W++ DDEKL+VG++KYGYGAWA
Sbjct: 1149 CRDLEFVNNYFKTHFKNDPLEFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAWA 1208

Query: 1178 QIRDDPFLGLSDKIFLNEPQTNNGKADNISAADQKTKNSGAGG-------SKKVPGSVHL 1230
            QIRDDPFLGL++KIFL++   ++   D +    ++      GG       SKKVPG++HL
Sbjct: 1209 QIRDDPFLGLTNKIFLSD--VSSAATDKVKEEVKQETPDATGGKRSKGRESKKVPGALHL 1266

Query: 1231 GRRTDYLFAVLKDEIKPHXXXXXXXXXXXPLPGASTGSKKRVRK-------APTSRSATP 1283
            GRR DYL   L+++ KP                 +   +KR RK       + TS S TP
Sbjct: 1267 GRRVDYLIDFLQNDGKPTTGASGSSSISESSRKTAANPRKRNRKPNNTSSFSETSASGTP 1326

Query: 1284 DAKADEIRSGPAKRVKKMGMGRSSPPPLVATARKAKS-VKGGTAPRGN---SAPDKEYDS 1339
            +    +    P KR+K +  G   P  LV+  +K  S  + G     N    A  KEYDS
Sbjct: 1327 ELGKLDSPGQPTKRIKALPKG---PASLVSRNKKTNSPQRDGNKENENGTSGAHAKEYDS 1383

Query: 1340 MEEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELRTVGDHIETKKVSSKKYPPE 1399
            M+EEEC+  M  M++SLKRL RGGKGLDR+EWA ILK EL  +GD+IE +  + K   P+
Sbjct: 1384 MDEEECRHTMTSMRSSLKRLRRGGKGLDRREWAKILKSELTAIGDYIEAQ--AKKNKNPD 1441

Query: 1400 KFRKHLWAFSSHYWP 1414
            + RKHLW++SS++WP
Sbjct: 1442 RHRKHLWSYSSNFWP 1456

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 4  KDVAMDMLDNPELYGLRRSGRAAA 27
          K++  ++L NPELYGLRRS RA A
Sbjct: 2  KEIDEEVLQNPELYGLRRSHRAVA 25

>Scas_665.17
          Length = 1060

 Score =  487 bits (1254), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/577 (44%), Positives = 376/577 (65%), Gaps = 34/577 (5%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P+FIKGG+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L Y ++ +
Sbjct: 127 ESPAFIKGGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKKID 186

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP L+VVP ST+  W+  F KW P++N I   G+++ R  I                AKF
Sbjct: 187 GPFLIVVPKSTLDNWRREFNKWTPEVNAIVLHGDKEERHKILYDIVL---------EAKF 237

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           +VL+T+YE ++K++  L    WQ++ +DEAHR+KN +S L + +  F   NRLLITGTPL
Sbjct: 238 DVLITSYEMVIKEKNVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPL 297

Query: 527 QNNIKELAALVNFLMPGRF----TIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F      D+  +  N + +QE  ++ LH+ L PF+LRR+K D
Sbjct: 298 QNNLHELWALLNFLLPDVFGDSGIFDEWFEQNNSEQDQEIVVQQLHTVLNPFLLRRIKAD 357

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKKAS 640
           VEKSL  K E  + V ++++Q  +YK++L K+  A+  + G +     LLNI+ +L+K  
Sbjct: 358 VEKSLLPKIETNVYVGMTEMQVKWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCC 417

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLF+ AE       G    + E+    L+ ++GKM++LD+LL RLK+ G RVLIFSQ
Sbjct: 418 NHPYLFEGAEP------GPPYTTDEH----LVFNAGKMIVLDKLLKRLKEKGSRVLIFSQ 467

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +G  Y R+DG+     R  +ID +N P+S+ FVFLL+TRAGGLGIN
Sbjct: 468 MSRLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGIN 527

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L+TADTVI++DSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K+ L
Sbjct: 528 LVTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRL 587

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNH 880
           +  +I  G    +    S K D     L E++++GA NMF+  + Q+  +D ++D++L  
Sbjct: 588 DQLVIQQGTGKKTASLGSNKDD-----LLEMIQYGAKNMFENKE-QQITKDADIDEILKK 641

Query: 881 AEDHVTTPDLGESHLG-GEEFLRQFEVTDYKADVEWD 916
            +  + T +L   +   G + L++F   D ++  EW+
Sbjct: 642 GQ--LKTKELNAKYQALGLDDLQKFNDVDNQSAYEWN 676

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  484 bits (1247), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 255/576 (44%), Positives = 372/576 (64%), Gaps = 32/576 (5%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E PSF+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L Y ++  
Sbjct: 174 ESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIE 233

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP L++VP ST+  W+  F KW P++N +   G++ +R  I                A+F
Sbjct: 234 GPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL---------EARF 284

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           +VL+T+YE +++++  L  + WQ++ +DEAHR+KN +S+L + +  F   NRLLITGTPL
Sbjct: 285 DVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPL 344

Query: 527 QNNIKELAALVNFLMPGRF----TIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F      D+  +  N + +QE  I+ LHS L PF+LRR+K D
Sbjct: 345 QNNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKAD 404

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKKAS 640
           VEKSL  K E  + V ++D+Q  +YK++L K+  A+  + G +     LLNI+ +L+K  
Sbjct: 405 VEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCC 464

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLF+ AE       G    + E+    LI +SGKM++LD+LL RLK+ G RVLIFSQ
Sbjct: 465 NHPYLFEGAEP------GPPYTTDEH----LIFNSGKMIILDKLLKRLKEKGSRVLIFSQ 514

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +   Y R+DG+    +R  +ID +N P+S  FVFLL+TRAGGLGIN
Sbjct: 515 MSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGIN 574

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L+TADTVI+FDSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K+ L
Sbjct: 575 LVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRL 634

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNH 880
           +  +I  G    +    + K D     L ++++FGA NMF+   ++  + D ++DD+L  
Sbjct: 635 DQLVIQQGTGKKTASLGNSKDD-----LLDMIQFGAKNMFEKKASKVTV-DADIDDILKK 688

Query: 881 AEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWD 916
            E      +     LG ++ L++F   + ++  EW+
Sbjct: 689 GEQKTQELNAKYQSLGLDD-LQKFNGIENQSAYEWN 723

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  474 bits (1221), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 251/579 (43%), Positives = 370/579 (63%), Gaps = 34/579 (5%)

Query: 345 LVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 404
           + E PS+I+ G+LRD+Q+ G+NWM  L     +GILADEMGLGKT+QT++F+ +L Y ++
Sbjct: 121 VTESPSYIQSGKLRDYQIQGLNWMISLHENKISGILADEMGLGKTLQTISFLGYLRYVKK 180

Query: 405 QNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHA 464
             GP LV+VP ST+  W+  F KW P+++     G ++ R  I +              A
Sbjct: 181 IEGPFLVIVPKSTLDNWRREFFKWTPNVSTTVLQGTKEQRQDILQNIVL---------EA 231

Query: 465 KFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 524
           +F+VL+T+YE +++++  L  + W+++ +DEAHR+KN +S+L + +  F   NRLLITGT
Sbjct: 232 RFDVLITSYEMVIREKGYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGT 291

Query: 525 PLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLK 580
           PLQNN+ EL AL+NFL+P  F      D      N D +QE  ++ LH+ L PF+LRR+K
Sbjct: 292 PLQNNLHELWALLNFLLPDVFGDSEVFDDWFQQNNSDQDQEVVVQQLHAVLNPFLLRRIK 351

Query: 581 KDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKK 638
            DVEKSL  K E  + V ++D+Q  +YK++L K+  A+  + G +     LLNI+ +L+K
Sbjct: 352 ADVEKSLLPKIETNVYVGMTDMQVQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 411

Query: 639 ASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 698
             NHPYLF+ AE       G    + E+    LI ++GKM++LD+LL RLK+ G RVLIF
Sbjct: 412 CCNHPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKRLKEKGSRVLIF 461

Query: 699 SQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLG 758
           SQM R+LDIL DY   +   Y R+DG+    +R  +ID +N P+S  FVFLL+TRAGGLG
Sbjct: 462 SQMSRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLG 521

Query: 759 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 818
           INL+TADTV++FDSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+VLERA +K+
Sbjct: 522 INLVTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKL 581

Query: 819 ILEYAIISLGV-TDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDV 877
            L+  +I  G     +N+  SK       +L E++++GA N+F+       + D ++D++
Sbjct: 582 RLDQLVIQQGSGKKTANLGNSK------DDLIEMIQYGAKNVFEKNGTTISV-DADIDEI 634

Query: 878 LNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWD 916
           L   E      +     LG ++ L++F   + ++  EW+
Sbjct: 635 LKKGEAKTHELNARYEALGLDD-LQRFNGMENQSAYEWN 672

>Kwal_34.15925
          Length = 1025

 Score =  463 bits (1191), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/579 (43%), Positives = 370/579 (63%), Gaps = 34/579 (5%)

Query: 345 LVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 404
           L E PS+IK G LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT+AF+ +L Y + 
Sbjct: 117 LTESPSYIKSGVLRDYQVQGLNWLLSLHDNRLSGILADEMGLGKTLQTIAFLGYLRYLKD 176

Query: 405 QNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHA 464
            +GPH+V+VP ST+  W+  F KW P++  +   G+++ R  + +               
Sbjct: 177 IDGPHIVIVPKSTLNNWKREFSKWTPEVEAVVLSGDKEERQHLLKDIVL---------EC 227

Query: 465 KFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 524
           KF+VL+T+YE ++K+++ L    WQ++ VDEAHR+KN +S+L + +  F   +RLLITGT
Sbjct: 228 KFDVLITSYEMVIKEKSTLKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITGT 287

Query: 525 PLQNNIKELAALVNFLMPGRFTIDQEID--FENQDAE--QETYIRDLHSRLQPFILRRLK 580
           PLQNN+ EL AL+NFL+P  F      D  FE  D E  Q+  ++ LH+ L PF+LRRLK
Sbjct: 288 PLQNNLHELWALLNFLLPDVFGDSDAFDRWFEQSDTEKDQDVVVQQLHTVLSPFLLRRLK 347

Query: 581 KDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSA--GSKGAHFSLLNIMNELKK 638
            +VE SL  K E  L V ++D+Q  +YK++L K+  A++   G +  +  LLNI+ +L+K
Sbjct: 348 SEVETSLLPKIETNLYVGMTDMQVQWYKSLLEKDLDAVNGAIGKREGNTRLLNIVMQLRK 407

Query: 639 ASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 698
             NHPYLF+ AE       G    + E+    LI ++GKM++LD+LL + K+ G RVLIF
Sbjct: 408 CCNHPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKKKKEAGSRVLIF 457

Query: 699 SQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLG 758
           SQM R+LDIL DY   +   Y R+DG+    +R  +ID FN P S  F+FLL+TRAGGLG
Sbjct: 458 SQMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAGGLG 517

Query: 759 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 818
           INL+TADTV+I+DSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K+
Sbjct: 518 INLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKL 577

Query: 819 ILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLE-DLNLDDV 877
            L+  +I  GV   ++   + K     GEL  ++++GA ++F   D  RK+  D ++D++
Sbjct: 578 RLDQLVIQQGVGKKTSAIGNSK-----GELLGMIQYGAKDVF--GDGARKITVDDDIDEI 630

Query: 878 LNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWD 916
           L   E      +     LG ++ L++F     ++  EW+
Sbjct: 631 LKKGEQKTQQLNAKYEKLGLDD-LQKFNGLGDQSAYEWN 668

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  461 bits (1185), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/578 (42%), Positives = 369/578 (63%), Gaps = 32/578 (5%)

Query: 345 LVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 404
           L + PSFIK G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+Q+++F+ +L Y + 
Sbjct: 124 LTQSPSFIKEGKLRDYQVYGLNWLISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKG 183

Query: 405 QNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHA 464
             GP++V+VP ST+  WQ  F KW P++  +   G++  R  + E +  T          
Sbjct: 184 IEGPYIVIVPKSTLDNWQREFAKWTPEVKTVILQGDKDFRKELIETKILT---------C 234

Query: 465 KFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 524
            F+VL+T+YE +LK++  L    W+++ +DEAHR+KN +S+L + +  F   NRLLITGT
Sbjct: 235 NFDVLITSYEMVLKEKLTLKRFAWEYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGT 294

Query: 525 PLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLK 580
           PLQNN+ EL AL+NFL+P  F      D+      ++ +QE  ++ LHS LQPF+LRR+K
Sbjct: 295 PLQNNLHELWALLNFLLPDVFGDSEVFDEWFQQNGKEEDQEVVVQQLHSVLQPFLLRRVK 354

Query: 581 KDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKK 638
            +VEKSL  K E  L V ++D+Q ++YK++L K+  A+  + G +     LLNI+ +L+K
Sbjct: 355 SEVEKSLLPKKEINLYVGMTDMQIEWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 414

Query: 639 ASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 698
             NHPYLF+ AE       G    + E+    L+ +SGKM++LD+LL + K+ G RVLIF
Sbjct: 415 CCNHPYLFEGAEP------GPPYTTDEH----LVFNSGKMIVLDKLLKKKKEQGSRVLIF 464

Query: 699 SQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLG 758
           SQM R+LDIL DY   +G  Y R+DG+    +R  +ID +N P+S  F+FLL+TRAGGLG
Sbjct: 465 SQMSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLG 524

Query: 759 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 818
           INL+TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K+
Sbjct: 525 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKL 584

Query: 819 ILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVL 878
            L+  +I  G    ++   + K D     L ++++FGA +M +       + D ++D++L
Sbjct: 585 RLDQLVIQQGTGKKTSALTNNKDD-----LIDMIQFGARDMLQHGSGNITV-DEDIDEIL 638

Query: 879 NHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWD 916
              E      +     LG ++ L++F     ++  EW+
Sbjct: 639 KKGERKTLELNAKYESLGLDD-LQKFNGMADQSAYEWN 675

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  457 bits (1176), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 255/596 (42%), Positives = 372/596 (62%), Gaps = 45/596 (7%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P++I  G+LRD+Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y ++  
Sbjct: 166 ESPAYI-NGQLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLRYIKKIP 224

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP LV+ P ST+  W     KW P++N     G+++ R  + + +F             F
Sbjct: 225 GPFLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERARLIQDKFMA---------CDF 275

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           +V++ +YE I++++A    + W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 276 DVVIASYEIIIREKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPL 335

Query: 527 QNNIKELAALVNFLMPGRFTIDQEID----FENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F+  Q+ D     E  + +QE  ++ LH+ LQPF+LRR+K D
Sbjct: 336 QNNLHELWALLNFLLPDIFSDSQDFDEWFSKETDEEDQEKIVKQLHTVLQPFLLRRIKSD 395

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSA--GSKGAHFSLLNIMNELKKAS 640
           VE SL  K E  + V +S +Q  +Y+ IL K+  A++A  GSK +   LLNI+ +L+K  
Sbjct: 396 VETSLLPKKELNVYVGMSPMQKKWYRQILEKDIDAVNADSGSKESKTRLLNIVMQLRKCC 455

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLFD AE       G    + E+    L+ +S K+ +LD+LL +LK+ G RVLIFSQ
Sbjct: 456 NHPYLFDGAEP------GPPYTTDEH----LVYNSEKLKVLDKLLRKLKEAGSRVLIFSQ 505

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +   Y R+DG+     R  +ID +NAPDS  F+FLL+TRAGGLGIN
Sbjct: 506 MSRVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGIN 565

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L TAD V++FDSDWNPQADLQAM RAHRIGQK  V V+RFV+ ++VEE++LERA +K+ L
Sbjct: 566 LTTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRL 625

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKA-TDNQR--------KLED 871
           +  +I       +N  +  K+D     LS +++ GA ++FK+ T ++R        K ED
Sbjct: 626 DQLVIQQNRP--TNKKKENKNDSKDALLS-MIQHGAADVFKSNTTSERGTPQPDDDKGED 682

Query: 872 LNLDDVLNHAEDHVTTPDLGESHLGGEEFLR-------QFEVTDYKADVEWDDIIP 920
           ++LD++L  +E    + +     LG ++  +       ++  TD+K  V+ D I P
Sbjct: 683 VDLDELLAQSESKTQSLNAKYESLGLDDLQKFNQDSAYEWNGTDFKKKVQKDIISP 738

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  452 bits (1164), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 253/579 (43%), Positives = 372/579 (64%), Gaps = 34/579 (5%)

Query: 345 LVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 404
           + E PSF+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L + + 
Sbjct: 116 VTESPSFVKAGKLRDYQIYGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKD 175

Query: 405 QNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHA 464
            +GP +VVVP ST+  W+  F KW P++N I   G++++R  + E    T          
Sbjct: 176 IDGPFIVVVPKSTLDNWKREFAKWTPEVNTIVLHGDRETRTQLIEERILT---------C 226

Query: 465 KFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 524
            F+VL+T+YE ++K++A L    WQ++ +DEAHR+KN +S+L + +  F   +RLLITGT
Sbjct: 227 DFDVLITSYEMVIKEKAILKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGT 286

Query: 525 PLQNNIKELAALVNFLMPGRFTIDQEID---FENQDAE-QETYIRDLHSRLQPFILRRLK 580
           PLQNN+ EL AL+NFL+P  F   +  D    +N+ A+ QE  ++ LH+ LQPF+LRR+K
Sbjct: 287 PLQNNLHELWALLNFLLPDVFGESEVFDEWFQQNEKAQDQEIVVQQLHAVLQPFLLRRVK 346

Query: 581 KDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKK 638
            DVEKSL  K E  + V ++ +Q  +Y+++L K+  A+  + G +     LLNI+ +L+K
Sbjct: 347 ADVEKSLLPKIETNVYVGMTAMQLQWYRSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 406

Query: 639 ASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 698
             NHPYLF+ AE       G    + E+    LI +SGKM++LD+LL R KK+G RVLIF
Sbjct: 407 CCNHPYLFEGAEP------GPPYTTDEH----LIYNSGKMIVLDKLLKRKKKEGSRVLIF 456

Query: 699 SQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLG 758
           SQM R+LDIL DY   +   Y R+DG     +R  +ID FNA DS  F+FLL+TRAGGLG
Sbjct: 457 SQMSRLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLG 516

Query: 759 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 818
           INL+TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+
Sbjct: 517 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKL 576

Query: 819 ILEYAIISLGVTDGS-NITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDV 877
            L+  +I  G    S N+  +K      GEL ++++FGA ++F     +  + D ++D +
Sbjct: 577 RLDQLVIQQGAGRKSANLGNTK------GELIDMIQFGARDVFDKKLTEATVAD-DIDAI 629

Query: 878 LNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWD 916
           L   E      +     LG ++ L++F     ++  EW+
Sbjct: 630 LMKGEQKTHALNARYEALGLDD-LQKFNGMADQSAYEWN 667

>Scas_652.17
          Length = 1025

 Score =  449 bits (1155), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 246/589 (41%), Positives = 364/589 (61%), Gaps = 44/589 (7%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P +I G  LR +Q+ G+NW+  L      GILADEMGLGKT+QT+AF+ +L Y    N
Sbjct: 104 ESPKYIHGT-LRPYQIQGLNWLVSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGIN 162

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP LV+ P ST+  W     KW PD+      G+++ R ++ + +  T           F
Sbjct: 163 GPFLVIAPKSTLNNWLREINKWTPDVKAFVLQGDKQERASLIKEKLMT---------CDF 213

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           ++++ +YE I++++A      W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 214 DIVVASYEIIIREKAAFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPL 273

Query: 527 QNNIKELAALVNFLMPGRFTIDQEID----FENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F+  Q+ D     E  + +Q+  ++ LH+ LQPF+LRR+K D
Sbjct: 274 QNNLHELWALLNFLLPDIFSSSQDFDDWFSSETTEEDQDKVVKQLHTVLQPFLLRRIKND 333

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSA--GSKGAHFSLLNIMNELKKAS 640
           VE SL  K E  L V +S++Q  +YK IL K+  A++    SK +   LLNI+ +L+K  
Sbjct: 334 VETSLLPKKELNLYVGMSNMQKKWYKKILEKDLDAVNGENSSKESKTRLLNIVMQLRKCC 393

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLFD AE       G    + E+    L+ +S K+ +LD+LL ++K+DG RVLIFSQ
Sbjct: 394 NHPYLFDGAEP------GPPYTTDEH----LVYNSKKLQVLDKLLKKMKEDGSRVLIFSQ 443

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +G  Y R+DG+     R  SID +NAPDS+ F+FLL+TRAGGLGIN
Sbjct: 444 MSRVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLGIN 503

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+RFV+ ++VEE++LERA +K+ L
Sbjct: 504 LTSADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKLRL 563

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDN-------------QR 867
           +  +I       +   +  K D     LS +++ GA ++F++ ++               
Sbjct: 564 DQLVIQQNKASMNKNKKESKKDAKDALLS-MIQHGAADIFQSGNSTTTESTPQPGEAKSE 622

Query: 868 KLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWD 916
           ++ED++L+ +L  +E+  ++ +     LG ++ L++F   +  +  EWD
Sbjct: 623 EVEDVDLESILATSENKTSSLNAKYETLGLDD-LQKF---NQDSAYEWD 667

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  445 bits (1144), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 251/590 (42%), Positives = 362/590 (61%), Gaps = 47/590 (7%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P F+  G LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT+ F+ +L Y  ++ 
Sbjct: 135 ESPGFV-DGRLRPYQVQGVNWLVSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIEKKR 193

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP LV+ P ST+  WQ    +W PD++     G+++ R  + +                F
Sbjct: 194 GPFLVIAPKSTLNNWQREINRWTPDVDAFILQGDKEERARLCQERLLA---------CNF 244

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           +V + +YE I++++A    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 245 DVAIASYEIIIREKASFKKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPL 304

Query: 527 QNNIKELAALVNFLMPGRFT----IDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F+     D+    E  D +++  ++ LH+ LQPF+LRR+K D
Sbjct: 305 QNNLHELWALLNFLLPDIFSDSAAFDEWFSSEASDDDKDKIVKQLHTILQPFLLRRIKSD 364

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKKAS 640
           VE SL  K E  L V +S +Q  +YK IL K+  A+  S GSK +   LLNIM +L+K  
Sbjct: 365 VETSLLPKKELNLYVGMSSMQRKWYKQILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCC 424

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLFD AE       G    + E+    L+ +S K+ +LD+LL +LK+DG RVLIFSQ
Sbjct: 425 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKLKEDGSRVLIFSQ 474

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +G  Y R+DG+     R  +ID +NAPDS  F+FLL+TRAGGLGIN
Sbjct: 475 MSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGIN 534

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L
Sbjct: 535 LTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRL 594

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQR------------- 867
           +  +I  G T   +I++ + +  +   L  +++ GA +MF++TD                
Sbjct: 595 DQLVIQQGRT---SISKKENAKDAKDALLSMIQHGAVDMFRSTDTSNASSAKGTPQPETG 651

Query: 868 -KLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWD 916
            K ++++L+ +LN +E+   + +   + LG    L Q +  +  +  EWD
Sbjct: 652 DKDDEVDLESLLNKSENKTKSLNEKYAALG----LDQLQKFNQDSAYEWD 697

>Kwal_14.1600
          Length = 1102

 Score =  440 bits (1131), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/520 (44%), Positives = 330/520 (63%), Gaps = 28/520 (5%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P FI G  LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT++F+ +L Y  ++ 
Sbjct: 127 ESPPFINGC-LRPYQVQGVNWLVSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKP 185

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP +V+ P ST+  W     +W PD+      G+++ R  +   +              F
Sbjct: 186 GPFVVIAPKSTLNNWLREINRWTPDVRAFILQGDKEERAKLVANKLMA---------CDF 236

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           ++++ +YE I+K++A    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 237 DIVVASYEIIIKEKASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPL 296

Query: 527 QNNIKELAALVNFLMPGRFTIDQEID--FENQDAEQET--YIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F+  Q  D  F ++ +E +    ++ LH+ LQPF+LRRLK +
Sbjct: 297 QNNLHELWALLNFLLPDVFSDSQAFDDWFSSESSEDDKGKIVKQLHTVLQPFLLRRLKNE 356

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSA--GSKGAHFSLLNIMNELKKAS 640
           VE SL  K E  L + +S +Q  +YK IL K+  A++   G+K +   LLN+M +L+K  
Sbjct: 357 VETSLLPKKELNLYIGMSSMQKRWYKQILEKDIDAVNGANGNKESKTRLLNVMMQLRKCC 416

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLFD AE       G    + E+    L+ +S K+ +LD+LL + K++G RVLIFSQ
Sbjct: 417 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLRKFKEEGSRVLIFSQ 466

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +   Y R+DG+     R  +ID +NAPDS  FVFLL+TRAGGLGIN
Sbjct: 467 MSRVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGLGIN 526

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L
Sbjct: 527 LTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQKLRL 586

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMF 860
           +  +I     +G N  + KK D     LS +++ GA ++F
Sbjct: 587 DQLVIQQS-RNGVNQKEVKKGDSKDALLS-MIQHGAADVF 624

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  440 bits (1131), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 245/562 (43%), Positives = 344/562 (61%), Gaps = 48/562 (8%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E + +QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q+++ IS+L   
Sbjct: 499  ETVDKQPSILVGGTLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLISYLYEI 558

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
            + +  P LV+VPLST+  W   FEKWAP L  I + GN   R A++           T K
Sbjct: 559  KNERQPFLVIVPLSTITNWTIEFEKWAPSLRTIVYKGNPNQRKALQH----------TIK 608

Query: 463  HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANRLLI 521
               F+V+LTTYEYI+KDR  L    W  + +DE HR+KNA+S L Y   + +K  NRL++
Sbjct: 609  MGNFDVVLTTYEYIIKDRPLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHYYKTKNRLIL 668

Query: 522  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN-------QDAEQETY--IRD 566
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N       +  E+ET   IR 
Sbjct: 669  TGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFANTGTQEKLEMTEEETLLVIRR 728

Query: 567  LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
            LH  L+PF+LRRLKK+VEK LP K E++++ +LS +Q   Y+ +L  N   + AG++GA 
Sbjct: 729  LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSSLQQQLYEQMLKHNAFFIGAGTEGAT 788

Query: 627  FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682
             +    L N + +L+K  NHP++FD  E+ +         +REN    L   SGK  LLD
Sbjct: 789  KAGIKGLNNKVMQLRKICNHPFVFDEVENVI-------NPTRENS-SILYRVSGKFELLD 840

Query: 683  QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
            ++L + K  GHRVL+F QM +++DI+ D+L ++ + Y RLDG   +  R   +  FNAPD
Sbjct: 841  RVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPD 900

Query: 743  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
            S  F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 901  SEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 960

Query: 803  KDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEIL-KFGAGNMFK 861
             D+VEE +LERA +K+ ++  +I  G  D  +         +A E  E L +   G+  K
Sbjct: 961  TDSVEEVILERAMQKLDIDGKVIQAGKFDNKS---------TAEEQEEFLRRLLEGDTNK 1011

Query: 862  ATDNQRKLEDLNLDDVLNHAED 883
              +   +L+D  L+++L   ED
Sbjct: 1012 DDEYSGELDDEELNEILARTED 1033

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  435 bits (1119), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/519 (43%), Positives = 328/519 (63%), Gaps = 38/519 (7%)

Query: 343 EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
           EK+ +QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 443 EKVEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 502

Query: 403 RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
           ++ +GP LV+VPLST+  W   FEKWAP L  + + G    R +++        Q +   
Sbjct: 503 KKDSGPFLVIVPLSTITNWTLEFEKWAPSLTTVIYKGTPNQRRSLQH-------QVRI-- 553

Query: 463 HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANRLLI 521
              F+VLLTTYEYI+KDR+ L   +W  + +DE HR+KNA+S L Y   + +K  +RL++
Sbjct: 554 -GDFDVLLTTYEYIIKDRSLLAKHEWSHMIIDEGHRMKNAQSKLSYTLTHYYKTRHRLIL 612

Query: 522 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDAEQET---------YIRD 566
           TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++           IR 
Sbjct: 613 TGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFSNTGGQEKLELTEEEALLVIRR 672

Query: 567 LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
           LH  L+PF+LRRLKK+VEK LP K E++++ +LS +Q   Y+ +L  N   + AG++GA 
Sbjct: 673 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFVGAGTEGAT 732

Query: 627 FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682
                 L N + +L+K  NHP++FD  E  V     +  +        L   SGK  LLD
Sbjct: 733 KGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPTRTNSSL--------LYRVSGKFELLD 784

Query: 683 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
           ++L + K  GHRVL+F QM +++DI+ D+L +K + Y RLDG   + +R   ++ FNAPD
Sbjct: 785 RVLPKFKATGHRVLMFFQMTQVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPD 844

Query: 743 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
           S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 845 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 904

Query: 803 KDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
            D+VEE +LERA +K+ ++  +I  G  D  +  + +++
Sbjct: 905 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEA 943

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  429 bits (1104), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 251/602 (41%), Positives = 367/602 (60%), Gaps = 51/602 (8%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P+++  G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT+AF+ +L Y  ++N
Sbjct: 132 ESPAYV-NGQLRPYQIQGLNWLVALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIEKKN 190

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP LV+ P ST+  W     +W P+++     G+++ R  +   +              F
Sbjct: 191 GPFLVIAPKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLA---------CDF 241

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           ++ + +YE I++++A    I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 242 DICVASYEIIIREKASFKKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPL 301

Query: 527 QNNIKELAALVNFLMPGRF----TIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F    T D+    E+ + ++E  ++ LH+ L PF+LRR+K D
Sbjct: 302 QNNLHELWALLNFLLPDIFADSATFDEWFSSESSEEDKEKVVKQLHTVLSPFLLRRIKND 361

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKKAS 640
           VE SL  K E  + V +S +Q  +YK IL K+  A+  S G K +   LLNI+ +L+K  
Sbjct: 362 VEGSLLPKKELNVYVGMSSMQKKWYKQILEKDIDAVNGSNGQKESKTRLLNIVMQLRKCC 421

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLFD AE       G    + E+    L+ +S K+ +LD+LL + K+ G RVLIFSQ
Sbjct: 422 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKFKEQGSRVLIFSQ 471

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +   Y R+DG+     R  +ID +NAPDS  F+FLL+TRAGGLGIN
Sbjct: 472 MSRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGIN 531

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+RFV+ ++VEE++LERA +K+ L
Sbjct: 532 LTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKL 591

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDN--------------- 865
           +  +I  G    +N  +  K+D   G LS +++ GA ++FK+ D+               
Sbjct: 592 DQLVIQQGRV--TNKKKENKNDSKEGLLS-MIQHGAVDVFKSNDSSAMTSQTGTPHPDDG 648

Query: 866 QRKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLR-------QFEVTDYKADVEWDDI 918
           + K ED++LD +L  +ED   + +   + LG +E  R       +++  ++K  VE D I
Sbjct: 649 KDKDEDVDLDALLAQSEDKTRSLNAKYATLGLDELQRFNQDSAYEWDGQNFKKKVEKDII 708

Query: 919 IP 920
            P
Sbjct: 709 NP 710

>Scas_662.7
          Length = 1342

 Score =  433 bits (1114), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/519 (43%), Positives = 326/519 (62%), Gaps = 38/519 (7%)

Query: 343 EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
           EK+ +QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 447 EKIDKQPSMLVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLFEE 506

Query: 403 RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
           ++  GP+LV+VPLST+  W   FEKWAP LN + + G    R  ++      N       
Sbjct: 507 KKDPGPYLVIVPLSTITNWTLEFEKWAPSLNTVIYKGTPNQRRNLQHQVRIGN------- 559

Query: 463 HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANRLLI 521
              F+VLLTTYEYI+KDRA L   +W  + +DE HR+KNA+S L Y   + +K  +RL++
Sbjct: 560 ---FDVLLTTYEYIIKDRALLAKHEWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRLIL 616

Query: 522 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDAEQET---------YIRD 566
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N    ++           IR 
Sbjct: 617 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTGEKLELTEEETLLVIRR 676

Query: 567 LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
           LH  L+PF+LRRLKK+VEK LP K E++++ +LS +Q   Y+ +L  N   L  G++GA 
Sbjct: 677 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYEQMLKHNALFLGEGTEGAT 736

Query: 627 FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682
            S    L N + +L+K  NHP++FD  E  +     +  +        L   SGK  LL+
Sbjct: 737 KSGIKGLNNKIMQLRKICNHPFVFDEVEGVINPTRANSNL--------LYRVSGKFELLN 788

Query: 683 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
           ++L + K  GHRVL+F QM +++DI+ D+L +K + Y RLDG+  +  R   ++ FNAPD
Sbjct: 789 RVLPKFKAAGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPD 848

Query: 743 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
           S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 849 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 908

Query: 803 KDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
            D+VEE +LERA +K+ ++  +I  G  D  +  + +++
Sbjct: 909 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEA 947

>Kwal_23.4777
          Length = 1301

 Score =  430 bits (1106), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/561 (41%), Positives = 337/561 (60%), Gaps = 46/561 (8%)

Query: 343 EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
           EK+ +QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 442 EKIEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLRET 501

Query: 403 RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
           + + GP LV+VPLST+  W   FEKWAP L  I + G    R +++      N       
Sbjct: 502 KNEPGPFLVIVPLSTITNWTLEFEKWAPSLATIVYKGTPNQRKSMQHQIRIGN------- 554

Query: 463 HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSF-KVANRLLI 521
              F VLLTTYEYI+KDR+ L    W  + +DE HR+KNA+S L  +L  + +  NRL++
Sbjct: 555 ---FEVLLTTYEYIIKDRSLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLIL 611

Query: 522 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDAEQET---------YIRD 566
           TGTPLQNN+ EL AL+NF++P  F   +  D      F N   +++           IR 
Sbjct: 612 TGTPLQNNLPELWALLNFVLPKIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRR 671

Query: 567 LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
           LH  L+PF+LRRLKK+VEK LP K E++++ +LS +Q   Y+ +L  N     AG++GA 
Sbjct: 672 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFFGAGTEGAT 731

Query: 627 FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682
                 L N + +L+K  NHP++FD  E  +     +  +        L   +GK  LLD
Sbjct: 732 KGGIKGLNNKIMQLRKICNHPFVFDEVEGIINPSRANSPL--------LYRVAGKFELLD 783

Query: 683 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
           ++L + K  GHRVL+F QM +++DI+ D+L ++G+ Y RLDG   +  R   +  FNAP+
Sbjct: 784 RILLKFKVTGHRVLMFFQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPN 843

Query: 743 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
           S  F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 844 SEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 903

Query: 803 KDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKA 862
            D+VEE +LERA +K+ ++  +I  G  D  +  + +++         + +       K 
Sbjct: 904 TDSVEEVILERALQKLDIDGKVIQAGKFDNKSTAEEQEAF--------LRRLLENENAKD 955

Query: 863 TDNQRKLEDLNLDDVLNHAED 883
            D++ +L D  L+D+L   ED
Sbjct: 956 EDDEAELNDEELNDILARGED 976

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  425 bits (1092), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 235/522 (45%), Positives = 336/522 (64%), Gaps = 29/522 (5%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P+++  G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y  +  
Sbjct: 187 ESPAYV-NGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIP 245

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP LV+ P ST+  W     +W PD+N     G+++ R  + + +              F
Sbjct: 246 GPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLLG---------CDF 296

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           +V++ +YE I+++++ L  I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPL
Sbjct: 297 DVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPL 356

Query: 527 QNNIKELAALVNFLMPGRFTIDQEID----FENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F+  Q+ D     E+ + +Q+  ++ LH+ LQPF+LRR+K D
Sbjct: 357 QNNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSD 416

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSAL--SAGSKGAHFSLLNIMNELKKAS 640
           VE SL  K E  L V +S +Q  +YK IL K+  A+  S GSK +   LLNIM +L+K  
Sbjct: 417 VETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCC 476

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLFD AE       G    + E+    L+ ++ K+ +LD+LL +LK++G RVLIFSQ
Sbjct: 477 NHPYLFDGAEP------GPPYTTDEH----LVYNAAKLQVLDKLLKKLKEEGSRVLIFSQ 526

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +   Y R+DG+     R  +ID +NAPDS  FVFLL+TRAGGLGIN
Sbjct: 527 MSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGIN 586

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L
Sbjct: 587 LTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRL 646

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKA 862
           +  +I    T  S   +  K+D     LS +++ GA ++FK+
Sbjct: 647 DQLVIQQNRT--SLKKKENKADSKDALLS-MIQHGAADVFKS 685

>Scas_597.8
          Length = 1065

 Score =  421 bits (1081), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 245/599 (40%), Positives = 364/599 (60%), Gaps = 47/599 (7%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           E P FI  G LR++Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y  +  
Sbjct: 123 ESPGFI-NGTLRNYQIQGLNWLVSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVEKIP 181

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKF 466
           GP LV+ P ST+  W     KW P++N     G+++ R  + + +              F
Sbjct: 182 GPFLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERAQLVKDKLLA---------CDF 232

Query: 467 NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 526
           ++++ +YE I+++++    I WQ++ +DEAHR+KN ES L + L  F  +NRLLITGTPL
Sbjct: 233 DIVVASYEIIIREKSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPL 292

Query: 527 QNNIKELAALVNFLMPGRFTIDQEID----FENQDAEQETYIRDLHSRLQPFILRRLKKD 582
           QNN+ EL AL+NFL+P  F+  Q+ D     E  + +QE  ++ LH+ LQPF+LRRLK D
Sbjct: 293 QNNLHELWALLNFLLPDIFSDSQDFDDWFSSETTEEDQEKVVKQLHTVLQPFLLRRLKND 352

Query: 583 VEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGS--KGAHFSLLNIMNELKKAS 640
           VE SL  K E  L V +S++Q  +YK IL K+  A++  +  K +   LLNI+ +L+K  
Sbjct: 353 VETSLLPKQELNLYVGMSNMQKKWYKQILEKDIDAVNGSNVNKESKTRLLNIVMQLRKCC 412

Query: 641 NHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQ 700
           NHPYLFD AE       G    + E+    L+ +S K+ +LD+LL ++K++G RVLIFSQ
Sbjct: 413 NHPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKMKEEGSRVLIFSQ 462

Query: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
           M R+LDIL DY   +G  Y R+DG+     R  +ID +N P S  F+FLL+TRAGGLGIN
Sbjct: 463 MSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAGGLGIN 522

Query: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
           L +A+ V++FDSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L
Sbjct: 523 LTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERATQKLRL 582

Query: 821 EYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRK------------ 868
           +  +I    +      ++KK +  A  L  +++ GA ++F++ D+  +            
Sbjct: 583 DQLVIQQNRSTLKKKKENKKDNKEA--LLSMIQHGAADVFQSIDSSAENSNRNTPQPGDA 640

Query: 869 LEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLR-------QFEVTDYKADVEWDDIIP 920
            +D++LD +L  +ED   + +     LG ++  R       ++   D+K  V+ D I P
Sbjct: 641 TDDIDLDSILALSEDKTKSLNAKYESLGLDDLQRFNQDSAYEWNGQDFKKKVQKDIISP 699

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  426 bits (1095), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 225/519 (43%), Positives = 329/519 (63%), Gaps = 38/519 (7%)

Query: 343 EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
           EK+ +QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 456 EKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 515

Query: 403 RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
           ++  GP LV+VPLST+  W   FEKWAP LN I + G    R +++      N       
Sbjct: 516 KKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGN------- 568

Query: 463 HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSF-KVANRLLI 521
              F+VLLTTYEYI+KD++ L    W  + +DE HR+KNA+S L  +++ + +  NRL++
Sbjct: 569 ---FDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLIL 625

Query: 522 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDAEQET---------YIRD 566
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++           IR 
Sbjct: 626 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRR 685

Query: 567 LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
           LH  L+PF+LRRLKK+VEK LP K E++++ +LS +Q   Y+ +L  N   + AG++GA 
Sbjct: 686 LHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGAT 745

Query: 627 FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682
                 L N + +L+K  NHP++FD  E  V    G+  +        L   +GK  LLD
Sbjct: 746 KGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDL--------LFRVAGKFELLD 797

Query: 683 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
           ++L + K  GHRVL+F QM +++DI+ D+L +K + Y RLDG+  + +R   ++ FNAPD
Sbjct: 798 RVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPD 857

Query: 743 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
           S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 858 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 917

Query: 803 KDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
            D+VEE +LERA +K+ ++  +I  G  D  +  + +++
Sbjct: 918 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEA 956

>Kwal_26.9164
          Length = 1454

 Score =  423 bits (1087), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/522 (42%), Positives = 331/522 (63%), Gaps = 45/522 (8%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E++ +QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 588  EEIKQQPSILVGGTLKEYQLKGLQWMVSLYNNHLNGILADEMGLGKTIQTISLLTYLYEV 647

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDA----IREGEFFTNPQA 458
            +   GP LV+VPLST+  W   F+KWAP +  + + G+   R +    IR G+F      
Sbjct: 648  KNVRGPSLVIVPLSTLTNWDSEFDKWAPVIRKVAYKGSPNERKSKQGIIRSGQF------ 701

Query: 459  KTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN- 517
                    +V+LTT+EYI+K+RA L  IKW  + +DE HR+KNA+S L  +LN++   + 
Sbjct: 702  --------DVVLTTFEYIIKERALLSKIKWVHMIIDEGHRMKNAQSKLSLTLNNYYHTDY 753

Query: 518  RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---QD----AEQETY- 563
            RL++TGTPLQNN+ EL AL+NF++P  F   +  D      F N   QD    +E+ET  
Sbjct: 754  RLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLL 813

Query: 564  -IRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKN---YSALS 619
             IR LH  L+PF+LRRLKKDVEK LP K E++L+ ++S +Q   Y+ +L         L+
Sbjct: 814  VIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSALQQKLYEQMLKHRRLFIGDLN 873

Query: 620  AGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMV 679
            +          N + +LKK  NHP++F+  ED++       R +  NI R     +GK  
Sbjct: 874  SNKNVGMRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNANIWR----VAGKFE 925

Query: 680  LLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFN 739
            LL+++L + K  GHR+LIF QM +++DI+ D+L +  + Y RLDG   S  R + ++ FN
Sbjct: 926  LLERILPKFKATGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFN 985

Query: 740  APDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR 799
            AP+S  F FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R
Sbjct: 986  APNSEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILR 1045

Query: 800  FVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
             +++++VEE +L+RA KK+ ++  +I  G  D  + ++ +++
Sbjct: 1046 LITENSVEEVILDRAHKKLDIDGKVIQAGKFDNKSTSEEQEA 1087

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  426 bits (1094), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 233/520 (44%), Positives = 330/520 (63%), Gaps = 41/520 (7%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E + +QPS + GG L+D+Q+ G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 753  EDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 812

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
            +   GP+LV+VPLST+  W   F KWAP L  I F G+   R A          QAK + 
Sbjct: 813  KNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKA---------KQAKIRA 863

Query: 463  HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 521
              +F+V+LTT+EYI+K+RA L  +KW  + +DE HR+KNA+S L  +LN+   A+ RL++
Sbjct: 864  -GEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLIL 922

Query: 522  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---QD----AEQETY--IRD 566
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N   QD    +E+ET   IR 
Sbjct: 923  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRR 982

Query: 567  LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
            LH  L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   Y  L  G +   
Sbjct: 983  LHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQML--KYRRLFIGDQNNK 1040

Query: 627  -----FSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLL 681
                     N + +LKK  NHP++F+  ED++       R + ++I R     +GK  LL
Sbjct: 1041 KMVGLRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNDDIWR----VAGKFELL 1092

Query: 682  DQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAP 741
            D++L +LK  GHRVLIF QM +++DI+ D+L    I Y RLDG   S +R   +  FNAP
Sbjct: 1093 DRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAP 1152

Query: 742  DSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFV 801
            DS    F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R +
Sbjct: 1153 DSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLI 1212

Query: 802  SKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
            + ++VEE +LERA KK+ ++  +I  G  D  + ++ +++
Sbjct: 1213 TTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEA 1252

>Scas_594.7
          Length = 1703

 Score =  426 bits (1094), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/521 (43%), Positives = 330/521 (63%), Gaps = 43/521 (8%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E++ +QP+ + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 799  EEIRQQPAMLVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYET 858

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGN---QKSRDAIREGEFFTNPQAK 459
            +  +GP+LV+VPLST+  W   F KWAP + CI + G+   +KS+ AI            
Sbjct: 859  KHIHGPYLVIVPLSTLSNWSNEFAKWAPTMRCISYKGSPNERKSKHAI------------ 906

Query: 460  TKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-R 518
              K  +F+V+LTT+EYI+K+RA L  +KW  + +DE HR+KNA+S L  +LN++  ++ R
Sbjct: 907  -IKSGEFDVVLTTFEYIIKERALLSKVKWIHMIIDEGHRMKNAQSKLSLTLNTYYHSDYR 965

Query: 519  LLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---QD----AEQETY-- 563
            L++TGTPLQNN+ EL AL+NF +P  F   +  D      F N   QD    +E+ET   
Sbjct: 966  LILTGTPLQNNLPELWALLNFALPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLV 1025

Query: 564  IRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSK 623
            IR LH  L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L      +   + 
Sbjct: 1026 IRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQQIMYQQMLKYRRLFIGDHTN 1085

Query: 624  GAHFSLLNIMNEL---KKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVL 680
                 L    N+L   KK  NHP++F+  ED++       R +  NI R     +GK  L
Sbjct: 1086 KKMVGLRGFNNQLMQLKKICNHPFVFEEVEDQI----NPTRETNANIWR----VAGKFEL 1137

Query: 681  LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNA 740
            L+++L +LK  GHRVLIF QM +++DI+ D+L    I Y RLDG   S  R   +  FNA
Sbjct: 1138 LEKVLPKLKATGHRVLIFFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNA 1197

Query: 741  PDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRF 800
            PDS    F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R 
Sbjct: 1198 PDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRL 1257

Query: 801  VSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
            +++ +VEE +LERA KK+ ++  +I  G  D  + ++ +++
Sbjct: 1258 ITEHSVEEAILERAHKKLDIDGKVIQAGKFDNKSTSEEQEA 1298

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  422 bits (1086), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/519 (43%), Positives = 329/519 (63%), Gaps = 38/519 (7%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E++ +QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L  A
Sbjct: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
            +  +GP LV+VPLST+  W   F+KWAP L  I F G    R           P+    K
Sbjct: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779

Query: 463  HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 521
            + +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ RL++
Sbjct: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839

Query: 522  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---QD----AEQETY--IRD 566
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N   QD    +E+ET   IR 
Sbjct: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899

Query: 567  LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
            LH  L+PF+LRRLKKDVEK LP K E++L+ ++S +Q   Y+ +L      +   S    
Sbjct: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959

Query: 627  FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682
            FS      N + +L+K  NHP++F+  ED++       R + + I R    S+GK  LL+
Sbjct: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011

Query: 683  QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
            ++L + K  GHRVLIF QM +++DI+ D+L    + Y RLDG   S  R   ++ FNAP+
Sbjct: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071

Query: 743  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
            S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131

Query: 803  KDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
             ++VEE +L++A  K+ ++  +I  G  D  +  + +++
Sbjct: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTAEEQEA 1170

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  418 bits (1074), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 324/518 (62%), Gaps = 38/518 (7%)

Query: 343 EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
           EK+ +QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q+++ I++L   
Sbjct: 439 EKIEKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 498

Query: 403 RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
           +++ GP+LV+VPLST+  W   FEKWAP L  I + G    R A+         Q K + 
Sbjct: 499 KQEPGPYLVIVPLSTITNWTLEFEKWAPSLTTIIYKGTPNQRHAL---------QHKIRS 549

Query: 463 HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSF-KVANRLLI 521
              F+VLLTTYEYI+KD+A L   +W  + +DE HR+KNA S L  ++  + +  NRL++
Sbjct: 550 -GNFDVLLTTYEYIIKDKALLSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLIL 608

Query: 522 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDAEQET---------YIRD 566
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N   +++           IR 
Sbjct: 609 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRR 668

Query: 567 LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
           LH  L+PF+LRRLKK+VEK LP K E++++ +LS +Q   Y+ +L  N   + AG++GA 
Sbjct: 669 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYQQMLKHNALFVGAGTEGAT 728

Query: 627 FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682
                 L N + +L+K  NHP++FD  E  V    G+  +        L   +GK  LLD
Sbjct: 729 KGGIKGLNNKIMQLRKICNHPFVFDEVEAVVNPSRGNSDL--------LYRVAGKFELLD 780

Query: 683 QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
           ++L + K  GHRVLIF QM +++DI+ D+L ++ + Y RLDG+  +  R   +  FN  +
Sbjct: 781 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVEN 840

Query: 743 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
           S  F FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 841 SEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 900

Query: 803 KDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKK 840
            D+VEE +LERA +K+ ++  +I  G  D  +  + ++
Sbjct: 901 TDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQE 938

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  416 bits (1070), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 226/518 (43%), Positives = 321/518 (61%), Gaps = 46/518 (8%)

Query: 348  QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNG 407
            QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   +  +G
Sbjct: 552  QPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEFKGIHG 611

Query: 408  PHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFN 467
            P LV+VPLST+  W   F+KWAP L  + F G    R A+          +   K   F+
Sbjct: 612  PFLVIVPLSTLTNWNAEFDKWAPTLRKLAFKGPPSERKAL----------SGIIKSGNFD 661

Query: 468  VLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLITGTPL 526
            V+LTT+EYI+K+R  L  +KW  + +DE HR+KNA+S L  +LN +   + RL++TGTPL
Sbjct: 662  VVLTTFEYIIKERPLLSKVKWVHMIIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPL 721

Query: 527  QNNIKELAALVNFLMPGRFTIDQEID------FEN---QD----AEQETY--IRDLHSRL 571
            QNN+ EL AL+NF++P  F   +  D      F N   QD    +E+ET   IR LH  L
Sbjct: 722  QNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVL 781

Query: 572  QPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKN--------YSALSAGSK 623
            +PF+LRRLKKDVEK LP K E++L+  +S +Q   Y+ +L            S    G +
Sbjct: 782  RPFLLRRLKKDVEKELPDKVEKVLKCRMSALQQKLYEQMLKHRRLFVVDDPSSKKMVGLR 841

Query: 624  GAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQ 683
            G +    N + +LKK  NHP++F+  ED++       R +  NI R     +GK  LL++
Sbjct: 842  GFN----NQIMQLKKICNHPFVFEEVEDQI----NPNRETNANIWR----VAGKFELLEK 889

Query: 684  LLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDS 743
            +L + K  GHRVLIF QM +++DI+ D+L    + Y RLDG   S  R   ++ FNAP S
Sbjct: 890  ILPKFKASGHRVLIFFQMTQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGS 949

Query: 744  NDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSK 803
            + F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++ 
Sbjct: 950  DYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITD 1009

Query: 804  DTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
            ++VEE +LERA +K+ ++  +I  G  D  +  + +++
Sbjct: 1010 NSVEEVILERAHRKLDIDGKVIQAGKFDNKSTAEEQEA 1047

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  417 bits (1072), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 325/518 (62%), Gaps = 37/518 (7%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E++ +QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+QT++ +++L   
Sbjct: 788  EEVRQQPSILVGGTLKEYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 847

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
            +   GP L++VPLST+P W   F KWAP L  I + G+   R  +++ +          K
Sbjct: 848  KNIKGPFLIIVPLSTLPNWSSEFAKWAPKLRTISYKGSPNER-KMKQAQI---------K 897

Query: 463  HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 521
              +F+ ++TT+EYI+K+RA L  +KW  + +DE HR+KNA+S L  +LN+F  ++ RL++
Sbjct: 898  SGEFDAVITTFEYIIKERAILSKVKWVHMIIDEGHRMKNAQSKLSLTLNTFYHSDYRLIL 957

Query: 522  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---QD----AEQETY--IRD 566
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N   QD    +E+ET   IR 
Sbjct: 958  TGTPLQNNLPELWALLNFVLPKIFNSAKSFDEWFNTPFANTGGQDKIELSEEETLLIIRR 1017

Query: 567  LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626
            LH  L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L      +    K   
Sbjct: 1018 LHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQHAMYQQMLKHKQLFIGDQKKNKL 1077

Query: 627  FSLLNIMNEL---KKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQ 683
              L    N+L   KK  NHP++F+  ED +       R +  NI R     +GK  LL++
Sbjct: 1078 VGLRGFNNQLMQLKKICNHPFVFEEVEDHI----NPTRDTNMNIWR----VAGKFELLER 1129

Query: 684  LLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDS 743
            +L +LK   HRVLIF QM +++DI+ D+L    I Y RLDG   S +R   +  FN P+S
Sbjct: 1130 ILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNS 1189

Query: 744  NDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSK 803
              F F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++ 
Sbjct: 1190 EYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITT 1249

Query: 804  DTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKS 841
            ++VEE +LERA KK+ ++  +I  G  D  +  + +++
Sbjct: 1250 NSVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEEQEA 1287

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  340 bits (873), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 225/630 (35%), Positives = 330/630 (52%), Gaps = 119/630 (18%)

Query: 348 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNG 407
           QPSF+K  +L+ +Q  G+NW+  L+    NGILADEMGLGKT+Q++A +++ IY     G
Sbjct: 188 QPSFLKNCQLKPYQKEGLNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDTKG 246

Query: 408 PHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGN--QKSRDAIREGEFFTNPQAKTKKHAK 465
           P L+  PLST+  W   F ++APD+  + +  +  Q +R A+  G+FF N + +      
Sbjct: 247 PFLIAAPLSTVENWMNEFARFAPDIPVLKYYNSEGQAARHAMM-GKFFKNNKGE------ 299

Query: 466 FNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 525
             V++T+YE I++D   + + +W+FL VDE HRLKN    L   L     +NRLL+TGTP
Sbjct: 300 -GVIITSYEIIIRDIELILSYQWKFLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGTP 358

Query: 526 LQNNIKELAALVNFLMPGRFTIDQEI-----DFENQDAE--------------QETYIRD 566
           LQNN+ EL +L+NF++P  F+ D EI     DF + + E              ++  I +
Sbjct: 359 LQNNLGELWSLLNFILPNIFS-DFEIFNKWFDFSDLNLESSSEKLTKIINDELEKNLISN 417

Query: 567 LHSRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTDYYKNIL------------TK 613
           LH+ L+PF+LRRLKK+V   SLP K E I+   ++ +Q  YYK  L             K
Sbjct: 418 LHTILKPFLLRRLKKNVLAGSLPPKREYIITCPVTPLQKKYYKQALKGNLKQTIQKQAIK 477

Query: 614 NYSALSAGSKGA-------------------------------------HFSLL-----N 631
           ++  L+A   G                                      H  LL     N
Sbjct: 478 DFFTLNAEYIGTVSNKSIRDFIEWKLSADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQN 537

Query: 632 IMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKD 691
           +M +L++  N  YLF               ++ EN+L+    +SGK+ +L +L+  L K 
Sbjct: 538 MMIQLRQIVNSTYLF------YFPLLEPTDLTLENLLK----TSGKLQVLQKLVPELIKK 587

Query: 692 GHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLS 751
            H+VLIFSQ V MLD++ D+  +      R+DG++ +  R+  I+ F+   S   +FLLS
Sbjct: 588 KHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQNNSRKEQIEEFSKKGSKANLFLLS 647

Query: 752 TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVL 811
           TRA GLGINL  AD+VIIFDSDWNPQ DLQAM RAHRIGQ   V+VYR    +T+E  ++
Sbjct: 648 TRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRAHRIGQTKPVIVYRLYCDNTIENVIM 707

Query: 812 ERARKKMILEYAIISLG----------------VTDGSNITQSKKSDPS---AGELSEIL 852
            RA  K  LE  +I +G                  +GS++  + K   +     ELS++L
Sbjct: 708 TRAVNKRKLEKLVIQMGKFNTLKKLAFNEQTFLKMNGSSLATTTKQSANKELVKELSQLL 767

Query: 853 KFGAGNMFKATDNQRKLEDLNLDDVLNHAE 882
                N  +A  +  K+E  N DD+L  +E
Sbjct: 768 ISNETNQGQA--DTSKIE--NSDDILEESE 793

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  340 bits (871), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 227/629 (36%), Positives = 323/629 (51%), Gaps = 100/629 (15%)

Query: 337 SERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFI 396
           +E  R  K  EQPS++K   L+ +Q+ G+NW+  L+    NGILADEMGLGKT+Q++A +
Sbjct: 201 TEEERIAK--EQPSYLKNCVLKPYQMEGLNWLITLYENGLNGILADEMGLGKTIQSIALL 258

Query: 397 SWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIRE--GEFFT 454
           S+ IY     GP L+  PLST+  W   F K+AP++  + +   Q  +DA ++   +FF 
Sbjct: 259 SF-IYEMDTKGPFLIAAPLSTVDNWMNEFAKFAPEIPILKYYS-QNGQDARQKLLKKFFK 316

Query: 455 NPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFK 514
           N       + +  V++T+YE I++D   +   +W+FL VDE HRLKN    L + L    
Sbjct: 317 N-------NNREGVIVTSYEMIIRDANIIMGEQWKFLIVDEGHRLKNINCRLIQELKRIN 369

Query: 515 VANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI-----DFENQDAE---------- 559
            +NRLL+TGTPLQNN+ EL +L+NF++P  F  D EI     DF++ D +          
Sbjct: 370 TSNRLLLTGTPLQNNLSELWSLLNFILPDIFA-DFEIFNKWFDFKDLDLQSNSAKLNKLI 428

Query: 560 ----QETYIRDLHSRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTDYYKNILT-- 612
               ++  I +LH+ L+PF+LRRLK  V K  LP K E I+   LS +QT +Y+  L+  
Sbjct: 429 NDELEKNLISNLHTILKPFLLRRLKSVVLKDVLPPKREYIVNCPLSPIQTKFYRMALSGK 488

Query: 613 ----------KNYSALSAGSKGA---------------------------------HFSL 629
                     K +  L+    G                                  +   
Sbjct: 489 LKVTVFKELVKAFFTLNQEYIGTVSNKSIRDFIDYKLSEEPDEDKVTAVIKQMDDIYMEH 548

Query: 630 LNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLK 689
           LN   + ++  N         D  L  F       +  L  L+ SSGK+ +L +L   L 
Sbjct: 549 LNTFTKNQRLQNMMMQLRQVVDSTLLFFFPYMEPEDITLDYLLASSGKLQMLQKLAIPLI 608

Query: 690 KDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFL 749
           K GH++LIFSQ V MLD+L D+  +      R+DG V +  R+  ID FN    +  +FL
Sbjct: 609 KKGHKILIFSQFVGMLDLLEDWSELNSFNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFL 668

Query: 750 LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE 809
           LSTRA GLGINL+ ADTVIIFDSDWNPQ DLQAM R HRIGQ   V+VYRF   +T+E  
Sbjct: 669 LSTRAAGLGINLVAADTVIIFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHV 728

Query: 810 VLERARKKMILEYAIISLG---------VTDGSNITQSKKSDPS-------AGELSEILK 853
           +L RA  K  LE  +I +G         + + S + QS   +P+         ELS++L 
Sbjct: 729 ILTRAVNKRKLERMVIQMGKFSNLKKLALNERSFLQQSTGMNPNKTSNKELVQELSQLLM 788

Query: 854 FGAGNMFKATDNQRKLEDLNLDDVLNHAE 882
               ++   T  + K      DD+L  AE
Sbjct: 789 SKESSIGFETSKKPK-----QDDILTEAE 812

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  335 bits (859), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 213/558 (38%), Positives = 301/558 (53%), Gaps = 88/558 (15%)

Query: 346 VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 405
           ++QP  +K   L+ +QL G+NW+  L+    NGILADEMGLGKTVQ++A +++ IY    
Sbjct: 211 IKQPRLLKNCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAF-IYEMDT 269

Query: 406 NGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQ--KSRDAIREGEFFTNPQAKTKKH 463
            GP LV  PLST+  W   F K+APDL  + + G    K R A +   FF       K+H
Sbjct: 270 KGPFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSA-KLKNFF-------KQH 321

Query: 464 AKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITG 523
               +++T+YE IL+D   + +  W+FL VDE HRLKN    L + L     +NRLL+TG
Sbjct: 322 GGTGIVITSYEIILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTG 381

Query: 524 TPLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN----------------QDAEQET 562
           TPLQNN+ EL +L+NF+MP  F  D EI     DF++                 D  Q+ 
Sbjct: 382 TPLQNNLAELWSLLNFIMPDIFA-DFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKN 440

Query: 563 YIRDLHSRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTDYYK------------N 609
            I +LH+ L+PF+LRRLKK V  + LP K E I+   ++  Q  +YK             
Sbjct: 441 LISNLHTILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYKAGLNGKLKKTMFK 500

Query: 610 ILTKNYSALSAGSKGAHFSLLNIM---------NELKKASN--HPYLFDMAEDRVLAKFG 658
            L K++  L+    G H S  +I          NE     N  +P L  M  D++  K  
Sbjct: 501 ELIKDFFTLNDEYIG-HVSNRSIRDFINYKLSGNETSNTDNKINPTLLQM--DKLYKKNL 557

Query: 659 DGRMSRENI------LRGLIMS----------------------SGKMVLLDQLLTRLKK 690
              +S + +      LR +I S                      SGK+ +L +L+  L  
Sbjct: 558 QMEISNKKLQNMMMQLRQIIDSTFLFYFPYLHPEDLTLETLLKTSGKLQILQKLIPPLIS 617

Query: 691 DGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLL 750
           +GH+VLI+SQ V MLD++ D+ ++      R+DG+V +  R+  ++ FN+      +FLL
Sbjct: 618 EGHKVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVNNETRKDQLEKFNSSKDKHNIFLL 677

Query: 751 STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 810
           STRA GLGINL+ ADTV++FDSDWNPQ DLQAM R HRIGQ++ V+VYR    +T+E  +
Sbjct: 678 STRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQESPVIVYRLCCDNTIEHVI 737

Query: 811 LERARKKMILEYAIISLG 828
           L RA  K  LE  +I +G
Sbjct: 738 LTRAANKRNLERMVIQMG 755

>Kwal_47.18077
          Length = 809

 Score =  333 bits (853), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 218/588 (37%), Positives = 310/588 (52%), Gaps = 91/588 (15%)

Query: 345 LVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARR 404
           L +QPS +K  +L+ +QL G+NW+  L+    NGILADEMGLGKT+Q++A +++ I    
Sbjct: 168 LHQQPSLLKNCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKTLQSIALLAF-ITEMD 226

Query: 405 QNGPHLVVVPLSTMPAWQETFEKWAPDLNCI--YFVGNQKSRDAIREGEFFTNPQAKTKK 462
             GP L+  PLST+  W   F ++APD+  +  Y    Q  R ++ + +FF + + +   
Sbjct: 227 TGGPFLIAAPLSTLDTWVNEFSRFAPDIQVLKYYSTQGQSYRQSLLK-KFFKSTKGQ--- 282

Query: 463 HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLIT 522
                V++T+YE I++D   + + +W+FL VDE HR+KN    L   L      NRLLIT
Sbjct: 283 ----GVVITSYEIIIRDIELILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNRLLIT 338

Query: 523 GTPLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDAEQETY 563
           GT LQNN+ EL +L+NF+MP  F  D EI     DF +               D  ++  
Sbjct: 339 GTALQNNLSELWSLLNFIMPDIFA-DFEIFHKWFDFSDLELKSSSQGLNRLINDELEKNL 397

Query: 564 IRDLHSRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTDYYKNILT---------- 612
           I +LH+ L+PF+LRRLKK V   SLP K E I+   L+ VQ   YK+ L           
Sbjct: 398 ISNLHAILKPFLLRRLKKVVLAGSLPPKREYIVNCPLTSVQKKLYKSALNGKLKQAIFKQ 457

Query: 613 --KNYSALSAGSKGA---------------------HFSLLNIMNELKKASNHPYLFD-- 647
             K++  L++   G                         +L  M++L K   H  L +  
Sbjct: 458 AIKDFFVLNSDQIGQVSNKSIRDFMEWKLNANDEDPDTEILQQMDKLYKQHIHRALLNKR 517

Query: 648 ---------MAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIF 698
                       D  L  F       +  L  L+ SSGK+ +L QL+  L K GH+VLIF
Sbjct: 518 LQNPMVQLRQVVDSTLLFFFPFINPEKLTLDFLLQSSGKLQILQQLVPPLIKKGHKVLIF 577

Query: 699 SQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLG 758
           +Q V MLD++ D+  +  +   R+DG++ +  R+  I+ FN PD +   FL+STRAGGLG
Sbjct: 578 TQFVGMLDLIEDWCELNDVRVCRIDGSMGNETRQEHIERFNDPDDSFDAFLISTRAGGLG 637

Query: 759 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 818
           INL  AD+VI+FDSDWNPQ DLQA  R HRIGQ   V+VYR    +T+E  +L RA  K 
Sbjct: 638 INLTAADSVILFDSDWNPQVDLQATDRTHRIGQTKPVIVYRLCCDNTIEHVILTRAASKR 697

Query: 819 ILEYAIISLGV---------TDGSNITQSKKSDPSAG-----ELSEIL 852
            LE  +I LG           D S I+Q   S+P++      ELS++L
Sbjct: 698 KLEKMVIQLGKFGTLQRLAGNDSSFISQG-HSNPNSNKELMHELSQLL 744

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  293 bits (750), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 193/565 (34%), Positives = 290/565 (51%), Gaps = 109/565 (19%)

Query: 346 VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 405
           ++QP+ ++   L+ +Q+ G+NW+  L+    NGILADEMGLGKT+Q++A +++ IY    
Sbjct: 176 IQQPTLVRNCTLKPYQVEGVNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDT 234

Query: 406 NGPHLVVVPLSTMPAWQETFEKWAPDLNCI--YFVGNQKSRDAIREGEFFTNPQAKTKKH 463
            GP LV  PLS +  W   FEK+AP +  +  Y       R AI + EFF       +K+
Sbjct: 235 RGPFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRHAILK-EFF-------RKN 286

Query: 464 AKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITG 523
           +   V++T+YE +++D   + + +W+FL VDE HRLKN    L   L      NRLL+TG
Sbjct: 287 SGEGVVVTSYEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTFNRLLLTG 346

Query: 524 TPLQNNIKELAALVNFLMPGRFTIDQEI-----DFENQDAE--------------QETYI 564
           TPLQNN+ EL +L+NF++P  F  D EI     DF + D +              ++  +
Sbjct: 347 TPLQNNLAELWSLLNFILPDVFA-DFEIFSKWFDFSDLDLKTSSQRWDKIIGEELEKNLV 405

Query: 565 RDLHSRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTDYYKNILT----------- 612
            +LH+ L+PF+LRRLK+ V   +LP K E I+   L+ +QT +YK  L            
Sbjct: 406 TNLHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYKMALAGKLKRTVFTQA 465

Query: 613 -KNYSALSAGSKGA------------------------------------HFSLLN---- 631
            K +  L+    G+                                    H  L N    
Sbjct: 466 IKEFFTLNREHIGSVSNKTIREFIDYKTSDEEIQASKVITDMEKLYEQHIHKELRNKRLQ 525

Query: 632 -IMNELKKASNHPYLFDM----AEDR---VLAKFGDGRMSRENILRGLIMSSGKMVLLDQ 683
            +M +L++  +  +LF      AED    VL +        + +L  L+ +  K+++  Q
Sbjct: 526 NLMMQLRQIVDSTFLFYFPYLKAEDLQLPVLLQTSGKLQILQQLLPRLLAAKHKVLIFSQ 585

Query: 684 LLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDS 743
            ++                 MLD++ D+  +   +  R+DG++ +  RR  I+ F+   S
Sbjct: 586 FVS-----------------MLDLIEDWCELNNYSACRIDGSMDNETRREQINSFSEKGS 628

Query: 744 NDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSK 803
              +FLLSTRAGGLGINL  AD+VI+FD+DWNPQ DLQAM R+HRIGQ++ V+VYR    
Sbjct: 629 PHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRSHRIGQQHPVIVYRLYCD 688

Query: 804 DTVEEEVLERARKKMILEYAIISLG 828
            TVE  +L RA  K  LE  +I +G
Sbjct: 689 KTVESVILARATNKRKLEQLVIQMG 713

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  274 bits (700), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 183/530 (34%), Positives = 276/530 (52%), Gaps = 71/530 (13%)

Query: 356  ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPL 415
            EL+D+Q TGINW+  L+  + + ILADEMGLGKT Q ++F+++L      NGPHLVVVP 
Sbjct: 501  ELKDYQQTGINWLHLLYQNDLSCILADEMGLGKTCQVISFLAYL-KQTHHNGPHLVVVPS 559

Query: 416  STMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEY 475
            ST+  W   F K+ P L    + G+Q+ R  +R+           +   +++V++TTY  
Sbjct: 560  STLENWLREFNKFCPHLKVEPYYGSQQERAELRD--------ILEENEGQYDVIVTTYNL 611

Query: 476  ILKDRAELGAIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKE 532
                + ++  ++   +  +  DE H LKN+ S  +  L       RLL+TGTPLQNN+KE
Sbjct: 612  AAGTKYDVSFLRNRNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKE 671

Query: 533  LAALVNFLMPGRFTI---DQEIDFENQ----DAEQ-------ETYIRDLHSRLQPFILRR 578
            L +L+ F+MP  F     D    F+ +    DA++       E  I    + ++PFILRR
Sbjct: 672  LMSLLEFIMPNLFVSKKDDLATVFKQKTRTSDADKGYNPLLAEHAIERAKTMMKPFILRR 731

Query: 579  LKKDVEKSLPSKTERILRVELSDVQTDYYKNILTK---NYSALSAG---SKGAHFSLLNI 632
             K  V K LP K   IL  E++++Q   Y+  + +   +   +  G    K +     N+
Sbjct: 732  KKDQVLKHLPRKHNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNL 791

Query: 633  MNELKKASNHPYLF-DMAEDRVLAKF-------------GDGRMSRENI-------LRGL 671
            +  L+KAS HP LF  +  D++++K              G+    +E++       L  L
Sbjct: 792  IMALRKASIHPLLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKL 851

Query: 672  I----------------MSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDILGDYLNI 714
                             M+SGK+  L  +L ++    H +VL+FS   ++LDIL   L+ 
Sbjct: 852  CCKFPSLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLST 911

Query: 715  KGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDW 774
              I + RLDG      R+  ID F   D+   VFLLST+AGG GINL+ A+ VIIFD  +
Sbjct: 912  LNIKFLRLDGQTQVNDRQSLIDRFYEDDTIP-VFLLSTKAGGFGINLVCANNVIIFDQSF 970

Query: 775  NPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
            NP  D QA  RAHR+GQ   V V   +S+DT+EE++L  A+ K+ L+  I
Sbjct: 971  NPHDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHI 1020

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  272 bits (696), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 189/540 (35%), Positives = 280/540 (51%), Gaps = 86/540 (15%)

Query: 356 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN--GPHLVVV 413
           EL+D+Q TG+NW+  L+  N + ILADEMGLGKT Q ++F+++L   + QN  GPHLVVV
Sbjct: 470 ELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVISFLAYL---KEQNHTGPHLVVV 526

Query: 414 PLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTY 473
           P ST+  W   F+K+ P L    + G+Q+ R  +R+           +   +++ ++TTY
Sbjct: 527 PSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRD--------ILEENDGQYDAIVTTY 578

Query: 474 EYILKDRAELGAIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 530
                ++A++  +K   +  +  DE H LKN+ S  +  L       RLL+TGTPLQNN+
Sbjct: 579 NLASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNL 638

Query: 531 KELAALVNFLMPGRF----------------TIDQEIDFENQDAEQETYIRDLHSRLQPF 574
           +EL +L+ F+MP  F                T D   D+ N    QE   R   + ++PF
Sbjct: 639 RELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSNKDY-NPLLAQEAIDR-AKTIMKPF 696

Query: 575 ILRRLKKDVEKSLPSKTERILRVELSDVQTDYY----------KNILTKNYSALSAGSKG 624
           ILRR K  V K LP+K   I   +++  Q   Y          + ++        AG + 
Sbjct: 697 ILRRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERA 756

Query: 625 --AHFSLLNIMNELKKASNHPYLF----------DMAEDRVLAK-----FGDGRMSRENI 667
             A  +  N++  L+KA+ HP LF          +M+E R+LA+      G+    RE++
Sbjct: 757 LVAQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSE-RILAEPEYADSGNRDYIREDM 815

Query: 668 -------LRGLI----------------MSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRM 704
                  L  L                 M+SGK+  L  LL        + L+FS   ++
Sbjct: 816 SYMCDLELHRLCCRFPSLASFQLSEPTWMASGKVHRLQPLLRAAIARREKTLVFSLFTQV 875

Query: 705 LDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTA 764
           LDIL   L+  GI + RLDG+ P   R+  ID F+  D++  VFLLST+AGG GINL+ A
Sbjct: 876 LDILELVLSSLGIAFLRLDGSTPVNDRQALIDRFHT-DTDVPVFLLSTKAGGFGINLVCA 934

Query: 765 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
           + VIIFD  +NP  D QA  RAHR+GQ   V V   VS+ TVEE++L+ AR K+ L+ ++
Sbjct: 935 NHVIIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALDSSV 994

>Kwal_26.7123
          Length = 1081

 Score =  269 bits (687), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 188/546 (34%), Positives = 278/546 (50%), Gaps = 94/546 (17%)

Query: 357  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN---GPHLVVV 413
            L+D+Q TGINW+  L+  N + ILADEMGLGKT Q +AF+S+L    +QN   GPHLVVV
Sbjct: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579

Query: 414  PLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTY 473
            P ST+  W   F K+ PDL    + G+Q+ R  +R+               +++V++TTY
Sbjct: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRD--------ILEDNDGQYDVIVTTY 631

Query: 474  EYILKDRAELGAIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 530
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN+
Sbjct: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691

Query: 531  KELAALVNFLMPGRF----------------TIDQEIDFENQDAEQETYIRDLHSRLQPF 574
            KEL +L+ F+MP  F                T D   D+ N    QE   R   + ++PF
Sbjct: 692  KELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDY-NPLLAQEAIAR-AKTMMKPF 749

Query: 575  ILRRLKKDVEKSLPSKTERILRVELSDVQTDYY----------KNILTKNYSAL------ 618
            ILRR K  V K LP K  +I   E+SDVQ   Y          K +L +           
Sbjct: 750  ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEGSAEEPR 809

Query: 619  -SAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVL--------------AKFGDGRMS 663
             +  + GA  S  N++  L+KA+ HP LF    D V+              A+ G+    
Sbjct: 810  PTKKNGGAQIS-KNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYI 868

Query: 664  RENI-------LRGLI-----------------MSSGKMVLLDQLLTR-LKKDGHRVLIF 698
            +E++       L  L                  M+SGK+  L ++L   ++    +VL+F
Sbjct: 869  QEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVF 928

Query: 699  SQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLG 758
            S   +MLDIL   L    I + RLDG+     R+  ID F+  D+   VF+LST+AGG G
Sbjct: 929  SLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFG 987

Query: 759  INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 818
            INL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +   ++++++EE++L+ A+ K+
Sbjct: 988  INLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKL 1047

Query: 819  ILEYAI 824
             L+  I
Sbjct: 1048 ALDTYI 1053

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  268 bits (685), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 177/527 (33%), Positives = 266/527 (50%), Gaps = 80/527 (15%)

Query: 357 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q ++F++ L ++   +GP L+V P +
Sbjct: 285 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIISFLASLHHSGMLDGPILIVCPAT 344

Query: 417 TMPAWQETFEKWAPDLNCIYF--VGN------QKSRDAIREGEFFTNPQ----------- 457
            M  W   F  W P    +    +G+      + S D + E    +NP+           
Sbjct: 345 VMKQWCNEFHTWWPPFRAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSK 404

Query: 458 -AKTKKHAKFN-------------VLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAE 503
             K+   +K N             VL+TTY  +     EL  +KW +  +DE H+++N +
Sbjct: 405 KTKSTMESKLNLTKLVDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPD 464

Query: 504 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 552
           S +  +    K +NR++++GTP+QNN+ EL +L +F+ PGR        Q+         
Sbjct: 465 SDISLTCKQLKTSNRVILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGG 524

Query: 553 FENQDAEQ-------ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTD 605
           + N    Q          +RDL   + P++LRR+K DV K LP K E +L  +L+  Q +
Sbjct: 525 YANATNIQVQTGYKCAVALRDL---ISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRN 581

Query: 606 YYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRE 665
            Y   L  N   L     G    L  I + L+K  NHP +             D R S E
Sbjct: 582 KYLQFL--NSGDLVKIKNGKRQVLYGI-DILRKICNHPDIL----------VRDMRHSEE 628

Query: 666 NILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLN-----IKGITYQ 720
           +   G    SGKM ++ QLL   K+ GH+ L+F+Q  +MLDIL  +++     +  +TY 
Sbjct: 629 SY--GDPKRSGKMQVVKQLLKLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYL 686

Query: 721 RLDGTVPSAQRRISIDHFNAPDSNDF--VFLLSTRAGGLGINLMTADTVIIFDSDWNPQA 778
           R+DGT   A R+  +D FN    N+   VFLL+TR GGLG+NL  A+ +IIFD DWNP  
Sbjct: 687 RMDGTTNIAARQHLVDKFN----NELYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPST 742

Query: 779 DLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 825
           DLQA  RA RIGQK  V +YR +   ++EE++  R   K  L   I+
Sbjct: 743 DLQARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLTNKIL 789

>Scas_549.4
          Length = 1079

 Score =  268 bits (684), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 166/523 (31%), Positives = 269/523 (51%), Gaps = 70/523 (13%)

Query: 357 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q +AF++ L ++   NGP L+V P +
Sbjct: 304 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIIAFLASLHHSGLLNGPVLIVCPAT 363

Query: 417 TMPAWQETFEKWAPDLNCIYF------VGNQK--SRDAIREGEFFTNP----------QA 458
            M  W      W P L  I        +  +K  S + + +     NP          ++
Sbjct: 364 VMKQWCNELHHWWPPLRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRS 423

Query: 459 KTKK--HAKFNV-------------LLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAE 503
           KTK    + FN+             ++TTY  +     +L  + W +  +DE H+++N +
Sbjct: 424 KTKASLESTFNIQSLIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPD 483

Query: 504 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 552
           S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+        Q+         
Sbjct: 484 SDISLTCKKIKTPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGG 543

Query: 553 FEN-QDAEQETYIR---DLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYK 608
           + N  + + +T ++    L + + P++LRR+K DV K LP K E +L  +L+  Q + Y 
Sbjct: 544 YANATNIQVQTGVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYL 603

Query: 609 NILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENIL 668
             L  N        +G    +L  ++ L+K  NHP L +  E +    +G+ +       
Sbjct: 604 EFLNSNELT---QIRGGRRHVLYGIDILRKICNHPDLLEREERQYETDYGNPK------- 653

Query: 669 RGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKG-----ITYQRLD 723
                 SGKM ++ QLL    K+GH+ L+F+Q  +MLDIL  ++  K      + Y R+D
Sbjct: 654 -----RSGKMQVVKQLLLLWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMD 708

Query: 724 GTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAM 783
           GT   ++R+  +D FN  D +  VFLL+TR GGLG+NL  A+ +II+D DWNP  D+QA 
Sbjct: 709 GTSNISKRQGLVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQAR 766

Query: 784 ARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
            RA RIGQK  V +YR +   ++EE++  R   K  L   I++
Sbjct: 767 ERAWRIGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKILT 809

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  265 bits (676), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 169/523 (32%), Positives = 262/523 (50%), Gaps = 70/523 (13%)

Query: 357 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
           L ++Q TG+ W+  L+ +   GI+ DEMGLGKT+Q  AF++ L ++   +GP L+V P +
Sbjct: 297 LFNYQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTAFLAALHHSNLLSGPVLIVCPAT 356

Query: 417 TMPAWQETFEKWAPDLNCIYF--VG---NQKSR---DAIR--------EGEFFTNPQAKT 460
            M  W     +W P    +    +G   N KS    D I         E   F + +  +
Sbjct: 357 VMKQWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENAS 416

Query: 461 KKHAKF-----------------NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAE 503
           K  +K                  ++++TTY  +     +L  + W +  +DE H+++N +
Sbjct: 417 KLKSKVETGMHMQNLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPD 476

Query: 504 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF--------TIDQEIDFEN 555
           S +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR            Q I+   
Sbjct: 477 SEISLTCKKLKCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGG 536

Query: 556 QDAEQETYIRD-------LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYK 608
                 T ++        L   + P++LRR+K DV K LP K E +L  +L++ Q   Y 
Sbjct: 537 YANATNTQVQTGYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYL 596

Query: 609 NILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENIL 668
             L+   S   +  KG    +L  ++ L+K  NHP L D    +  + +GD +       
Sbjct: 597 EFLS---SDELSQIKGGKRHVLYGIDILRKICNHPDLLDRDYIKNTSGYGDPK------- 646

Query: 669 RGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIK-----GITYQRLD 723
                 SGKM ++ QLL   K +GH+ L+F+Q  +MLDIL +++  K      I Y R+D
Sbjct: 647 -----RSGKMQVVKQLLKLWKSEGHKTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMD 701

Query: 724 GTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAM 783
           GT     R+  +D FN    +  VFLL+TR GGLG+NL  A+ +II+D DWNP  DLQA 
Sbjct: 702 GTTSIQVRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQAR 759

Query: 784 ARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
            RA RIGQK  V +YR +   T+EE++  R   K  L   ++S
Sbjct: 760 ERAWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLS 802

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  264 bits (675), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 169/530 (31%), Positives = 264/530 (49%), Gaps = 82/530 (15%)

Query: 357 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q +AFI+ L ++    GP L+V P +
Sbjct: 297 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPAT 356

Query: 417 TMPAWQETFEKWAPDLNCIYF-----------------------VGNQKSRDAIREGEFF 453
            M  W   F+ W P L  +                         + N K  D   E ++ 
Sbjct: 357 VMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYE-DWK 415

Query: 454 TNPQAKTKKHAKFN-------------VLLTTYEYILKDRAELGAIKWQFLAVDEAHRLK 500
            + + K    + ++             +L+TTY  +     +L  +KWQ+  +DE H+++
Sbjct: 416 NSTRTKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIR 475

Query: 501 NAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR----------FTIDQE 550
           N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+          F I   
Sbjct: 476 NPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPIN 535

Query: 551 ID-FENQDAEQ-------ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDV 602
           I  + N    Q          +RDL   + P++LRR+K DV K LP K E +L  +L+  
Sbjct: 536 IGGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKADVAKDLPQKKEMVLFCKLTKY 592

Query: 603 QTDYYKNIL-TKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGR 661
           Q   Y   L + + + +  G +   F +    + L+K  NHP L D    R    +GD +
Sbjct: 593 QRSKYLEFLHSSDLNQIQNGKRNVLFGI----DILRKICNHPDLLDRDTKRHNPDYGDPK 648

Query: 662 MSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKG----- 716
                        SGKM ++ QLL    K G++ L+F+Q  +MLDIL ++++ K      
Sbjct: 649 ------------RSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSH 696

Query: 717 ITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNP 776
           + Y R+DGT     R+  +D FN    +  VFLL+TR GGLG+NL  A+ +IIFD DWNP
Sbjct: 697 LNYLRMDGTTNIKGRQSLVDRFNNESFD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNP 754

Query: 777 QADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
             D+QA  RA RIGQK  V +YR +   ++EE++  R   K  L   I++
Sbjct: 755 STDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILT 804

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  268 bits (684), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 184/543 (33%), Positives = 276/543 (50%), Gaps = 73/543 (13%)

Query: 340  PRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 399
            P   K  + P  IK   LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+  
Sbjct: 1297 PSKAKPFKLPVAIKAT-LRKYQQDGINWLAFLNKYHLHGILCDDMGLGKTLQTICIIASD 1355

Query: 400  IYARRQNG-----------PHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIR 448
             Y R++             P L+V P S    W+  FE+++P L  + + G    R  +R
Sbjct: 1356 QYLRQEEYKLSGNIECRPLPSLIVCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVRQPLR 1415

Query: 449  EGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYE 508
                        K+ +  ++++T+Y+    D   + +  + +  +DE H +KNA+S L +
Sbjct: 1416 ------------KQLSSADIIITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKLAK 1463

Query: 509  SLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQ 556
            ++   K  +RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +  
Sbjct: 1464 AVKLIKANHRLILTGTPIQNNVVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNSKTS 1523

Query: 557  DAEQET---YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY------ 607
              EQE     +  LH ++ PF+LRRLK+DV   LP K  +    ELSD+Q   Y      
Sbjct: 1524 SKEQEAGALALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYEDFAKK 1583

Query: 608  -KNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAK---------- 656
             KN++ K+    +      H  +   +  ++K  NHP L  ++ D    K          
Sbjct: 1584 QKNVVEKDIQNTADVDSKQH--IFQALQYMRKLCNHPALV-LSNDHPQLKQIQNYLKQTG 1640

Query: 657  --FGDGRMS-RENILRGLIMSSG-------KMVLLDQLLTRLKKDGHRVLIFSQMVRMLD 706
                D R + +   LR L+   G       K V  +QLLT      HR LIF Q+  MLD
Sbjct: 1641 CDLHDIRNAPKLTALRTLLFECGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLD 1700

Query: 707  ILGDYL---NIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMT 763
            ++ + L    +  ++Y RLDG+V    R+  +  FN   S D   LL+T+ GGLG+NL  
Sbjct: 1701 MIENDLFKRYMPSVSYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTG 1759

Query: 764  ADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYA 823
            ADTVI  + DWNP  DLQAM RAHR+GQK  V VYR V+K T+EE+++   + KM +   
Sbjct: 1760 ADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIAST 1819

Query: 824  IIS 826
            +++
Sbjct: 1820 VVN 1822

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  263 bits (673), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 186/555 (33%), Positives = 279/555 (50%), Gaps = 82/555 (14%)

Query: 357  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F+++L     Q  PHL+VVP S
Sbjct: 572  LKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYLKQIG-QPSPHLIVVPSS 630

Query: 417  TMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYI 476
            T+  W   F+K+ P L    + G Q+ R  +RE           +   K++V++TTY   
Sbjct: 631  TLENWLREFQKFCPSLKIEPYYGTQQERADLRE--------ILERNDGKYDVIVTTYNLA 682

Query: 477  LKDRAELGAIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKEL 533
              ++ ++  +K   +  +  DE H LKN+ S  +  L       RLL+TGTPLQNN+KEL
Sbjct: 683  AGNKYDVSFLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKEL 742

Query: 534  AALVNFLMPGRFTIDQEI---------------DFENQDAEQETYIRDLHSRLQPFILRR 578
             +L+ F+MP  F   +E                   N    Q+   R   + ++PFILRR
Sbjct: 743  MSLLEFIMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITR-AKTMMKPFILRR 801

Query: 579  LKKDVEKSLPSKTERILRVELSDVQTDYYK---NILTKNYSALSAG---------SKGAH 626
             K  V K LP+K  R     ++D Q + Y     ++ ++   +  G         SK  +
Sbjct: 802  RKDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKIEN 861

Query: 627  FSLLNIMNELKKASNHPYLF---------DMAEDRVL-----AKFGDGRMSRENI----- 667
             S  N++  L+KAS HP LF         D   D +L     A+ G+    RE++     
Sbjct: 862  NSSKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDMSFMTD 921

Query: 668  --LRGLI-----------------MSSGKMVLLDQLLTR-LKKDGHRVLIFSQMVRMLDI 707
              L  L                  M+SGK+  L +LL   + K   +VLIF+   ++LDI
Sbjct: 922  FELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVLDI 981

Query: 708  LGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTV 767
            L   L+     + RLDG+     R+  ID F   D+   +F+LSTRAGG GINL+ A+ V
Sbjct: 982  LEKVLSTLNYKFLRLDGSTQVNDRQTMIDKF-YDDNTIPIFMLSTRAGGFGINLVCANHV 1040

Query: 768  IIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISL 827
            IIFD  +NP  D QA  RAHR+GQ   V V   ++KD++EE++ + A+ K+ L+  + S 
Sbjct: 1041 IIFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDSQVSS- 1099

Query: 828  GVTDGSNITQSKKSD 842
               D S++  +K SD
Sbjct: 1100 -SEDQSDLIDNKVSD 1113

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  260 bits (665), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 179/537 (33%), Positives = 272/537 (50%), Gaps = 80/537 (14%)

Query: 357  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F ++L     + GPHLVVVP S
Sbjct: 572  LKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLKQIN-EPGPHLVVVPSS 630

Query: 417  TMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYI 476
            T+  W   F+K+AP L    + G+ + R+ +R+           +   K++V++TTY   
Sbjct: 631  TLENWLREFQKFAPALKIEPYYGSLQEREELRD--------ILERNAGKYDVIVTTYNLA 682

Query: 477  LKDRAELGAIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKEL 533
              ++ ++  +K   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN+KEL
Sbjct: 683  AGNKYDVSFLKNRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKEL 742

Query: 534  AALVNFLMPGRFTIDQEI-------------DFENQDA--EQETYIRDLHSRLQPFILRR 578
             +L+ F+MP  F   +E              D +N +    QE   R   + ++PFILRR
Sbjct: 743  MSLLEFIMPNLFISKKESFDAIFKQRAKTTDDNKNHNPLLAQEAITR-AKTMMKPFILRR 801

Query: 579  LKKDVEKSLPSKTERILRVELSDVQTDYYK---NILTKNYSALSAG---------SKGAH 626
             K  V K LP K   I   EL+ +Q   Y     I+ ++   +  G         SK   
Sbjct: 802  RKDQVLKHLPPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQS 861

Query: 627  FSLLNIMNELKKASNHPYLF-DMAEDRVLAKFGDG------------------------- 660
             S  N++  L+KAS HP LF ++  D+++ K  D                          
Sbjct: 862  SSSKNLIMALRKASLHPLLFRNIYNDKIITKMSDAILDEPAYAENGNKEYIKEDMSYMTD 921

Query: 661  ------------RMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDI 707
                         +S+  +     M SGK+  L +LL  +  D   +VLIFS   ++LDI
Sbjct: 922  FELHKLCCNFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDI 981

Query: 708  LGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTV 767
            L   L+     + RLDG+     R++ ID F   D +  +F+LST+AGG GINL+ A+ V
Sbjct: 982  LEMVLSTLDYKFLRLDGSTQVNDRQLLIDKF-YEDKDIPIFILSTKAGGFGINLVCANNV 1040

Query: 768  IIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
            IIFD  +NP  D QA  RAHR+GQ   V +   ++KD++EE++ + A+ K+ L+  I
Sbjct: 1041 IIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKLALDSYI 1097

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  262 bits (670), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 182/533 (34%), Positives = 275/533 (51%), Gaps = 72/533 (13%)

Query: 349  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNG- 407
            P  IK   LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+   Y R+++  
Sbjct: 1272 PVAIKA-TLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASDQYLRQEDYK 1330

Query: 408  ----------PHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQ 457
                      P L+V P S    W++ FE++AP L  + + G   +R  +R         
Sbjct: 1331 TTKSVETRPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTRYPLR--------- 1381

Query: 458  AKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 517
                K    ++++T+Y+    D   +    + +  +DE H +KN++S L +++ S +  +
Sbjct: 1382 ---GKLGDADIVVTSYDVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANH 1438

Query: 518  RLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDAEQET--- 562
            RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +    EQE    
Sbjct: 1439 RLILTGTPIQNNVVELWSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGAL 1498

Query: 563  YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYK-------NILTKNY 615
             +  LH ++ PF+LRRLK+DV   LP K  +    ELSD+Q   YK       NI+ ++ 
Sbjct: 1499 ALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDI 1558

Query: 616  -SALSAGSKGAHFSLLNIMNELKKASNHPYL--------FDMAEDRVLAKFGD----GRM 662
             + +   SK   F  L  M   +K  NHP L        ++  +D +     D       
Sbjct: 1559 ENTMELESKNHIFQALQYM---RKLCNHPSLVLSKDHPQYNQVQDYLSQTGMDIHDIAHA 1615

Query: 663  SRENILRGLIMSSGKMVL-LDQLLTRLKKD-----GHRVLIFSQMVRMLDILGDYL---N 713
             +   LR L++  G  V  +DQ    L         HR LIF Q+  MLD++ + L    
Sbjct: 1616 PKLGALRNLLLECGIGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKY 1675

Query: 714  IKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSD 773
            +  +TY RLDG+V S  R+  +  FN   S D   LL+T+ GGLG+NL  ADTVI  + D
Sbjct: 1676 LPSVTYMRLDGSVESRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHD 1734

Query: 774  WNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
            WNP  DLQAM RAHR+GQK  V VYR ++K ++EE+++   + KM +   +++
Sbjct: 1735 WNPMNDLQAMDRAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTVVN 1787

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  258 bits (660), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 167/522 (31%), Positives = 255/522 (48%), Gaps = 72/522 (13%)

Query: 360 FQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMP 419
           +Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF++ L ++R+ NGP LVV P + M 
Sbjct: 268 YQKTCVQWLCELYQQGCGGIIGDEMGLGKTIQIIAFLATLHHSRKLNGPVLVVCPATVMK 327

Query: 420 AWQETFEKWAPDLNCIYF--------VGNQKSRDAIRE-------GEFFTNPQAKTKKH- 463
            W   F  W P    +           G Q   + + +       G F  N   K +K  
Sbjct: 328 QWCNEFHTWWPPFRAVILHSIGAGMNKGTQIPEEELEKMLMTSNYGTFTYNDYEKKEKTR 387

Query: 464 -----------------AKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSL 506
                               ++++TTY  +      L  ++W +  +DE H+++N +S +
Sbjct: 388 TSLESRKSVKKLLEKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIRNPDSDI 447

Query: 507 YESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------DFEN 555
             +    K  NR++++GTP+QNN+ EL +L +F+ PG+        Q+         + N
Sbjct: 448 SLTCKQLKTQNRIILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPINMGGYAN 507

Query: 556 QDAEQ-------ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYK 608
               Q          +RDL   + P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 508 ASNIQVKTGYKCAVALRDL---ISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQYQKSKYL 564

Query: 609 NILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENIL 668
             L  +   L    KG    L  I + L+K  NHP L D+   ++           E+  
Sbjct: 565 EFLHSD--ELMKIRKGKRQVLYGI-DILRKICNHPDLLDLKRKKM--------NDYEDAD 613

Query: 669 RGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKG-----ITYQRLD 723
            G    SGKM ++ QLL      GH+ L+F+Q  +MLDIL ++++ K      + + R+D
Sbjct: 614 YGNPARSGKMQVVKQLLLLWHSQGHKTLLFTQSRQMLDILQEFISYKDPELSDLKFLRMD 673

Query: 724 GTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAM 783
           GT     R+  +D FN    +  VFLL+TR GGLGINL  A+ +IIFD DWNP  D+QA 
Sbjct: 674 GTTNIGSRQSLVDKFNNEPYD--VFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDMQAR 731

Query: 784 ARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 825
            RA RIGQK  V +YR +   ++EE++  R   K  L   I+
Sbjct: 732 ERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLSNKIL 773

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  258 bits (659), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 175/561 (31%), Positives = 276/561 (49%), Gaps = 91/561 (16%)

Query: 356 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPL 415
           +L  +Q T + W+  L  +N  GI+ DEMGLGKT+Q V+F++ L ++ +  GP LVV P 
Sbjct: 262 KLFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVCPA 321

Query: 416 STMPAWQETFEKWAPDLNCIYF--VG-NQKSRDAIREGEF-----------FTNPQ---- 457
           + M  W   F+ W P    +    +G    +R  + E +            F+  Q    
Sbjct: 322 TVMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANL 381

Query: 458 AKTKKHAKF---------------NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNA 502
            +TKK  +                ++L+TTY  +      L  + W +  +DE H+++N 
Sbjct: 382 GRTKKQLEARRGIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNP 441

Query: 503 ESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAE--- 559
           ++ +  +    +  +R++++GTP+QNN+ EL +L +F+ PG+  +     F+ Q A    
Sbjct: 442 DAGISLTCKRLRTPHRIILSGTPIQNNLTELWSLFDFIFPGK--LGTLPVFQQQFANPIN 499

Query: 560 ------------QETY-----IRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDV 602
                       Q  Y     +RDL   + P++LRR+K DV K LP K E +L  +++  
Sbjct: 500 AGGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQF 556

Query: 603 QTDYYKNIL-TKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGR 661
           Q + Y   L +++   +  G +     +L  ++ L+K  NHP L +    +    FGD R
Sbjct: 557 QKEKYLQFLNSEDMIKIKNGRR----QVLYGIDILRKICNHPDLLERDFRKHEPSFGDPR 612

Query: 662 MSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIK-----G 716
                        SGKM ++ QLL   KK GH+ L+F+Q  +MLDIL  Y++ K     G
Sbjct: 613 ------------RSGKMTVIKQLLLTWKKQGHKALLFTQSRQMLDILEAYISHKDPELAG 660

Query: 717 ITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNP 776
           + Y R+DGT   A R+  +D FN  +    +FLL+TR GGLG+NL  A+ +IIFD DWNP
Sbjct: 661 LQYLRMDGTTNIAHRQALVDRFN--NGPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNP 718

Query: 777 QADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNIT 836
             DLQA  RA RIGQK  V +Y  +   ++EE++  R   K  L   ++S          
Sbjct: 719 STDLQARERAWRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLS---------D 769

Query: 837 QSKKSDPSAGELSEILKFGAG 857
             +K      EL ++  FG G
Sbjct: 770 PKQKRFFKMNELHDLFSFGPG 790

>Scas_664.9
          Length = 1859

 Score =  256 bits (654), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 177/543 (32%), Positives = 269/543 (49%), Gaps = 72/543 (13%)

Query: 340  PRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 399
            P   K  + P  IK   LR +Q  G+NW+AFL     +GIL D+MGLGKT+QT+  I+  
Sbjct: 1251 PSKAKPFKLPVAIKA-TLRKYQQDGVNWLAFLNKYRLHGILCDDMGLGKTLQTICIIASD 1309

Query: 400  IYARRQNG-----------PHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIR 448
             Y R ++            P L+V P S    W+  FE++AP L  I + G    R  +R
Sbjct: 1310 QYLRAEDYKKTNSVETRKLPSLIVCPPSLTGHWENEFEQYAPFLKIIVYAGGPSMRIPLR 1369

Query: 449  EGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYE 508
            +            +    ++++T+Y+    D + +    + +  +DE H +KNA+S L +
Sbjct: 1370 D------------ELGSADIVITSYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAK 1417

Query: 509  SLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI------------DFENQ 556
            ++      +RL++TGTP+QNN+ EL +L +FLMPG    ++              + +  
Sbjct: 1418 AVKQISANHRLILTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTS 1477

Query: 557  DAEQET---YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY------ 607
              EQE     +  LH ++ PF+LRRLK+DV   LP K  +    ELSD+Q   Y      
Sbjct: 1478 SKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKK 1537

Query: 608  -KNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDG------ 660
             KN++ K+    +      H  +   +  ++K  NHP L        LA+  D       
Sbjct: 1538 QKNVVEKDIENTTDTDNSQH--IFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGI 1595

Query: 661  ------RMSRENILRGLIMSSG-------KMVLLDQLLT-RLKKDGHRVLIFSQMVRMLD 706
                     + N LR L+   G       +    +Q LT +     HR LIF Q+  MLD
Sbjct: 1596 DLHDVINAPKLNALRTLLFECGIGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLD 1655

Query: 707  ILGDYL---NIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMT 763
            ++ + L    +  +TY RLDG+V    R+  +  FN   S D   LL+T+ GGLG+NL  
Sbjct: 1656 MVENDLFKRYMPSVTYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTG 1714

Query: 764  ADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYA 823
            ADTVI  + DWNP  DLQAM RAHR+GQK  V VYR ++K T+EE+++   + KM +   
Sbjct: 1715 ADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIAST 1774

Query: 824  IIS 826
            +++
Sbjct: 1775 VVN 1777

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  256 bits (653), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 177/546 (32%), Positives = 279/546 (51%), Gaps = 80/546 (14%)

Query: 340  PRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 399
            P   K  + P  IK   LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+  
Sbjct: 1271 PSKAKPFKLPVAIKAT-LRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASD 1329

Query: 400  IYARRQNG-----------PHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIR 448
             Y R ++            P L++ P S    W++ F++++P LN + + G    R  + 
Sbjct: 1330 QYLRSEDYKKTQSEKTRPLPSLIICPPSLTGHWEQEFQQYSPTLNVLVYAGGPSVRYPL- 1388

Query: 449  EGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYE 508
            +G+    P A        ++++T+Y+    D   L    + +  +DE H +KN++S L +
Sbjct: 1389 QGQV---PTA--------DIVVTSYDVARNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAK 1437

Query: 509  SLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQ 556
            ++      +RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +  
Sbjct: 1438 AVKLINSNHRLVLTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQERFAKPIASSRNSKTS 1497

Query: 557  DAEQET---YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY------ 607
              EQE     +  LH ++ PF+LRRLK++V   LP K  +    ELSD+Q   Y      
Sbjct: 1498 SKEQEAGALALEALHKQVLPFMLRRLKEEVLSDLPPKIIQDYYCELSDLQKQLYNDFVKK 1557

Query: 608  -KNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYL--------FDMAEDRVLAKFG 658
             KN++ K+    +      H  +   +  ++K  NHP L        F   +  +     
Sbjct: 1558 QKNVVEKDIENTAEVENKQH--IFQALQYMRKLCNHPSLVLNSSHPQFQQVQSYLSQTGM 1615

Query: 659  D----GRMSRENILRGLIMSSG-----------KMVLLDQLLTRLKKDGHRVLIFSQMVR 703
            D    G   +   L+ L++  G           K   +D ++++     HRVLIF Q+  
Sbjct: 1616 DLHDIGHAPKLEALKTLLLECGIGIQDVEKKSNKNPSIDNVISQ-----HRVLIFCQLKD 1670

Query: 704  MLDILGDYL---NIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760
            MLD++ + L   ++  +T+ RLDG+V S  R+  +  FN   S D   LL+T+ GGLG+N
Sbjct: 1671 MLDMVENDLLKKHLPSVTFMRLDGSVDSRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLN 1729

Query: 761  LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820
            L  ADTVI  + DWNP  DLQAM RAHR+GQK  V VYR ++K T+EE+++   + KM +
Sbjct: 1730 LTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNI 1789

Query: 821  EYAIIS 826
               I++
Sbjct: 1790 ASTIVN 1795

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  255 bits (652), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 175/543 (32%), Positives = 272/543 (50%), Gaps = 72/543 (13%)

Query: 340  PRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWL 399
            P   K  + P  IK   LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+  
Sbjct: 1256 PSKAKPFKLPIAIKA-TLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASD 1314

Query: 400  IYARRQNG-----------PHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIR 448
             Y R+++            P L++ P S    W+  F+++AP L  + + G    R  +R
Sbjct: 1315 QYLRKEDYEKTRSVESRALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVRLTLR 1374

Query: 449  EGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYE 508
                   PQ      +  ++++T+Y+    D A L   ++ +  +DE H +KN++S L +
Sbjct: 1375 -------PQL-----SDADIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAK 1422

Query: 509  SLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQ 556
            ++      +RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +  
Sbjct: 1423 AVKEITANHRLILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTS 1482

Query: 557  DAEQET---YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY------ 607
              EQE     +  LH ++ PF+LRRLK+DV   LP K  +    EL D+Q   Y      
Sbjct: 1483 SKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKK 1542

Query: 608  -KNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGD----GRM 662
             KN++ K+           H  +   +  ++K  NHP L        LA+  D      +
Sbjct: 1543 QKNVVEKDIENSEIADGKQH--IFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGL 1600

Query: 663  SRENILRGLIMSSGKMVLLDQLLTRLKKDG----------------HRVLIFSQMVRMLD 706
               +I+    +S+ + +L +  +     D                 HR LIF Q+  MLD
Sbjct: 1601 DLHDIINAPKLSALRTLLFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLD 1660

Query: 707  ILGDYL---NIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMT 763
            ++ + L    +  +TY RLDG++    R+  +  FN   S D   LL+T+ GGLG+NL  
Sbjct: 1661 MVENDLFKKYMPSVTYMRLDGSIDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTG 1719

Query: 764  ADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYA 823
            ADTVI  + DWNP  DLQAM RAHRIGQK  V VYR ++K T+EE+++   + KM +   
Sbjct: 1720 ADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIAST 1779

Query: 824  IIS 826
            +++
Sbjct: 1780 VVN 1782

>Scas_548.4
          Length = 1054

 Score =  249 bits (635), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 174/536 (32%), Positives = 267/536 (49%), Gaps = 78/536 (14%)

Query: 357  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q ++F ++L     + GPHLVVVP S
Sbjct: 496  LKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISFFAYLKQIN-EPGPHLVVVPSS 554

Query: 417  TMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYI 476
            T+  W   F+K+ P L    + G+Q  R  +RE           +   +++V++TTY   
Sbjct: 555  TLENWLREFQKFCPTLKIEPYYGSQNERADLRE--------ILERTAGQYDVIVTTYNLA 606

Query: 477  LKDRAELGAIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKEL 533
              ++ ++  ++   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN++EL
Sbjct: 607  AGNKYDVSFLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLREL 666

Query: 534  AALVNFLMPGRFTIDQE--IDFENQDAEQ------------ETYIRDLHSRLQPFILRRL 579
             +L+ F+MP  F   +E       Q A+             +  I    + ++PFILRR 
Sbjct: 667  MSLLEFIMPALFISKKESLASVFKQRAKTTDDNKGHNPLLVQEAIERAKTMMKPFILRRR 726

Query: 580  KKDVEKSLPSKTERILRVELSDVQTDYY----KNILTKNYSALSAG--------SKGAHF 627
            K  V K LP+K  +I    + D+Q   Y    K ++      L           +K    
Sbjct: 727  KDQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQSS 786

Query: 628  SLLNIMNELKKASNHPYLF-DMAEDRVLAKFG-----------DGR-------------- 661
            S  N++  L+KA+ HP LF  +  D ++AK             DG               
Sbjct: 787  SSSNLIMTLRKAALHPLLFRTIYNDALIAKMSKAIINEPQYKVDGNIEFIKEDMSVMTDF 846

Query: 662  ------------MSRENILRGLIMSSGKMVLLDQLLTRLK-KDGHRVLIFSQMVRMLDIL 708
                        +SR  +     M+SGK+  L +LL  +  +   +VLIFS   ++LDIL
Sbjct: 847  ELHRLCLNFPNTLSRYQLKNKEWMNSGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDIL 906

Query: 709  GDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVI 768
               L+     + RLDG+     R+  ID F   D+   +F+LST+AGG GINL+ A+ VI
Sbjct: 907  ELVLSELNYKFLRLDGSTQVNDRQSLIDKFYEDDTIP-IFILSTKAGGFGINLVCANNVI 965

Query: 769  IFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
            IFD  +NP  D QA  RAHR+GQ   V +   ++KD++EE++ + A+ K+ L+  I
Sbjct: 966  IFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQLAKNKLALDSHI 1021

>Kwal_34.16082
          Length = 726

 Score =  229 bits (585), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 241/480 (50%), Gaps = 72/480 (15%)

Query: 357 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLS 416
           L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q +AF++ L ++ + +GP L+V P +
Sbjct: 263 LFNYQKTCVQWLYELFQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLDGPVLIVCPAT 322

Query: 417 TMPAWQETFEKWAPDLNCIYF--VG-NQKSRDAIREG---EFF--TNPQ----------- 457
            +  W + F  W P    +    +G     +D I E    E F  +NP+           
Sbjct: 323 VLRQWCKEFHTWWPPFRTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSK 382

Query: 458 ----------AKTKKHAKF----NVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAE 503
                     A++K   K     ++L+TTY  +      L  ++W +  +DE H+++N +
Sbjct: 383 RTKSTLESGMARSKLINKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPD 442

Query: 504 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR------FTIDQEIDFENQD 557
           + +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR      F     I      
Sbjct: 443 ADISLTCKKLKTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGG 502

Query: 558 AEQETYIR---------DLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYK 608
               T I+          L + + P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 503 YANATNIQVQTGYKCAIALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYL 562

Query: 609 NIL-TKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENI 667
             L +++ + +  G +   F +    + L+K  NHP L +  +    + +GD +      
Sbjct: 563 QFLNSEDLTKIKNGKRQVLFGI----DILRKICNHPDLLEKDKRENESSYGDPK------ 612

Query: 668 LRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKG-----ITYQRL 722
                  SGKM ++ QLL      GH+ L+F+Q  +MLDIL  +++ K      +TY R+
Sbjct: 613 ------RSGKMQVVKQLLRLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRM 666

Query: 723 DGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQA 782
           DGT     R+  +D FN    +  VFLL+TR GGLG+NL  A+ +IIFD DWNP  D+QA
Sbjct: 667 DGTTNIGSRQALVDSFNNGLYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>Scas_668.18
          Length = 875

 Score =  229 bits (583), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 158/511 (30%), Positives = 258/511 (50%), Gaps = 42/511 (8%)

Query: 352 IKGGELRDF-QLTGINWMAFLWSKNDNG----ILADEMGLGKTVQTVAFISWLIYARRQN 406
           + G  ++DF     +N       +N+ G    I+ADEMGLGKT+Q +A + W +  +   
Sbjct: 277 VTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALM-WTLLRQGPQ 335

Query: 407 GPHLV-----VVPLSTMPAWQETFEKW-APDLNCIYFVGNQKSRDAIRE---GEFFTNPQ 457
           G  L+     V P S +  W     KW  P       V  +KS  A       E   +  
Sbjct: 336 GKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWA 395

Query: 458 AKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 517
             T ++    VL+ +YE + ++  +L       +  DE HRLKN +S  + +L+S     
Sbjct: 396 QATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPR 455

Query: 518 RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI--DFE-----NQDAEQ--------ET 562
           R++++GTP+QN++ E  AL+NF  PG      E   +FE     ++DA+         E 
Sbjct: 456 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEE 515

Query: 563 YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNIL-TKNYSALSAG 621
            ++ L + +  FI+RR    + K LP K E ++ V L   Q D Y  +L +++ + +  G
Sbjct: 516 QLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKG 575

Query: 622 SKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRG------LIMSS 675
             G     L  +  LKK  NHP L ++ E+  +  F D  +  E  ++G          S
Sbjct: 576 VGGTQ--PLKAIGVLKKLCNHPNLINLDEE--IDDFDDLEIPDEYNMQGSKSRDVQPQFS 631

Query: 676 GKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRIS 734
           GK  +L++ L ++K +   ++++ S   + LD++      K  +  RLDGT+   +R+  
Sbjct: 632 GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKL 691

Query: 735 IDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNH 794
           +D FN P+  +F+FLLS++AGG GINL+ A+ +I+ D DWNP AD QA+AR  R GQK  
Sbjct: 692 VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 751

Query: 795 VMVYRFVSKDTVEEEVLERARKKMILEYAII 825
             +YRF+S  ++EE++ +R   KM L   ++
Sbjct: 752 CFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  231 bits (589), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 127/343 (37%), Positives = 199/343 (58%), Gaps = 35/343 (10%)

Query: 346 VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 405
           V  PS ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +S+L   +  
Sbjct: 618 VPTPSLLRGT-LRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHN 676

Query: 406 NGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAK 465
            GPHL+VVP S +  W+  F+++AP    + + GN + R   R+G  +  P A       
Sbjct: 677 WGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGNPQQRKEKRKG--WNKPDA------- 727

Query: 466 FNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 525
           F+V + +Y+ I++D+      KWQ++ +DEAH +KN  S+ +++L +F    R+L+TGTP
Sbjct: 728 FHVCIVSYQLIVQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTP 787

Query: 526 LQNNIKELAALVNFLMPGRFTIDQEID-FENQDAEQE--------------TYIRD---- 566
           LQNNI EL +L+ FLMP      Q++  F + DA Q+              TY +D    
Sbjct: 788 LQNNIAELWSLLYFLMPQTVIDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETK 847

Query: 567 -----LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAG 621
                LH  L+P++LRRLK DVEK +P K E I+  +LS  Q   Y + +++  +  +  
Sbjct: 848 RTVEKLHQVLRPYLLRRLKADVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLA 907

Query: 622 SKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSR 664
           S G   S++N + +L+K  NHP LF++   +    FG+  ++R
Sbjct: 908 S-GNFMSIVNCLMQLRKVCNHPDLFEVRPIKTSFLFGESVIAR 949

 Score =  153 bits (387), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 99/154 (64%), Gaps = 1/154 (0%)

Query: 675  SGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRIS 734
             GK+  L  LL +LK  GHR LIF+QM ++LDIL  +LN  G  Y RLDG      R+I 
Sbjct: 1177 CGKLQKLAILLQQLKDGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1236

Query: 735  IDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNH 794
             + FN+ D    VF+LS+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   
Sbjct: 1237 TERFNS-DPKITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1295

Query: 795  VMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 828
            V +YRFVS+ T+E  +L++A +K  L+  II  G
Sbjct: 1296 VHIYRFVSEHTIESNILKKANQKRQLDDVIIQKG 1329

>Kwal_14.1537
          Length = 842

 Score =  226 bits (575), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 146/475 (30%), Positives = 231/475 (48%), Gaps = 28/475 (5%)

Query: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HLVVVPLSTMPAWQETFEKW--APDL 432
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW     L
Sbjct: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419

Query: 433 NCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLA 492
             +   G + S +     +          +     VL+ +YE + ++   L   +   L 
Sbjct: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479

Query: 493 VDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI- 551
            DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG      E  
Sbjct: 480 ADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFR 539

Query: 552 -DFEN-------------QDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRV 597
            +FEN             + A+    ++ L + +  FI+RR    + K LP K E +L V
Sbjct: 540 RNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFV 599

Query: 598 ELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDM------AED 651
            L   Q   Y+ +L      L+          L  +  LKK  NHP L  +      +ED
Sbjct: 600 NLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSED 659

Query: 652 RVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDILGD 710
            +   + +  +S+          SGK  +L++ L ++K +   +++I S   + LD++  
Sbjct: 660 VIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIER 719

Query: 711 YLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIF 770
                     RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+ A+ +I+ 
Sbjct: 720 MCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILM 779

Query: 771 DSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 825
           D DWNP AD QA+AR  R GQK    +YRF+   T+EE++ +R   KM L   ++
Sbjct: 780 DPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLSSCVV 834

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score =  225 bits (574), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 154/491 (31%), Positives = 241/491 (49%), Gaps = 58/491 (11%)

Query: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HLVVVPLSTMPAWQETFEKW-APD-L 432
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW  PD L
Sbjct: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386

Query: 433 NCIYFVGNQKSRD-----------AIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRA 481
           + +   G + S             AI +G     P           VL+ +YE + ++  
Sbjct: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP-----------VLIISYETLRRNVE 435

Query: 482 ELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLM 541
            L   K   +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  
Sbjct: 436 NLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSN 495

Query: 542 PG------RFTIDQEIDF---------ENQDAEQETYIRDLHSRLQPFILRRLKKDVEKS 586
           PG      +F  + EI           + + A  E  + +L   +  FI+RR    + K 
Sbjct: 496 PGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKY 555

Query: 587 LPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLF 646
           LP K E IL V LS +Q   Y++ +      ++   KG     L  +  LKK  NHP L 
Sbjct: 556 LPCKYEHILFVNLSPMQKAIYEHFVRSR--EVAKLMKGTGSQPLKAIGLLKKLCNHPDLL 613

Query: 647 DMAE-----------DRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH-R 694
           D+ +           D   A   + R  R ++      SS K  +L++ L ++K + + +
Sbjct: 614 DLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSS-KFAILERFLFKIKHESNDK 672

Query: 695 VLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRA 754
           +++ S   + LD++            RLDGT+   +R+  +D FN P   +F+FLLS++A
Sbjct: 673 IVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKA 732

Query: 755 GGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERA 814
           GG GINL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YRF++  ++EE++ +R 
Sbjct: 733 GGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRP 792

Query: 815 RKKMILEYAII 825
             KM L   ++
Sbjct: 793 SMKMSLSSCVV 803

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score =  225 bits (574), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 147/478 (30%), Positives = 246/478 (51%), Gaps = 34/478 (7%)

Query: 379 ILADEMGLGKTVQTVAFISWLIY-----ARRQNGPHLVVVPLSTMPAWQETFEKW-AP-D 431
           I+ADEMGLGKT+Q +A + W +       RR     ++V P S +  W    +KW  P  
Sbjct: 329 IMADEMGLGKTLQCLALM-WTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGS 387

Query: 432 LNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFL 491
           L+ +   G + S +     +  ++  +   ++    VL+ +Y+ + ++  +L   +   +
Sbjct: 388 LSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLM 447

Query: 492 AVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG-------- 543
             DE HRLKNA+S  + +L+S +   R++++GTP+QN++ E  AL+NF  PG        
Sbjct: 448 LADEGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDF 507

Query: 544 ----RFTIDQEIDFENQDAE---QETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILR 596
                  I Q  D    D E    +  +R L + +  FI+RR    + K LP K E ++ 
Sbjct: 508 RKNFELPILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIF 567

Query: 597 VELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAED----- 651
           + L+  Q   Y++ +     A+    KG     L  +  LKK  NHP L +++ED     
Sbjct: 568 INLTPFQQSLYQHFIESR--AVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGSE 625

Query: 652 -RVLAKFGDGRMSRENILRGLIMS--SGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDI 707
             +   +     SR +  R +I +  S K  +L + L ++K + + ++++ S   + LD+
Sbjct: 626 ELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDL 685

Query: 708 LGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTV 767
           +            RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A+ +
Sbjct: 686 IEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRL 745

Query: 768 IIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 825
           I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L   ++
Sbjct: 746 ILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 803

>Scas_646.3*
          Length = 1456

 Score =  228 bits (582), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/354 (36%), Positives = 206/354 (58%), Gaps = 43/354 (12%)

Query: 326 KILPQYSSHYGSER--PRFEKL----VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGI 379
           ++LP  +    SE+  P  ++L    V  PS ++G  LR +Q  G+NW+A L++ N NGI
Sbjct: 608 ELLPNEAGAENSEQVVPNEQQLSVVDVPVPSLLRGT-LRTYQKQGLNWLASLFNNNTNGI 666

Query: 380 LADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVG 439
           LADEMGLGKT+QT++ +++L   ++  GPHL+VVP S +  W+  F+++ P L  + + G
Sbjct: 667 LADEMGLGKTIQTISLLAYLACEKQNWGPHLIVVPTSVLLNWEMEFKRFCPGLKVLTYYG 726

Query: 440 NQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRL 499
           + + R   R+G  +  P A       F+V + +Y+ +++D+      KWQ++ +DEAH +
Sbjct: 727 SPQQRKEKRKG--WNKPDA-------FHVCIVSYQLVVQDQHSFKRKKWQYMVLDEAHNI 777

Query: 500 KNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMP----------------- 542
           KN  S+ +++L +F    RLL+TGTPLQNN+ EL +L+ FLMP                 
Sbjct: 778 KNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDA 837

Query: 543 -----GRFTIDQEIDF---ENQDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERI 594
                GR  +D+ I+      QDAE +  +  LH  L+P++LRRLK DVEK +P+K E I
Sbjct: 838 FQQWFGR-PVDKLIETGAGYQQDAETKKTVSKLHQVLRPYLLRRLKADVEKQMPAKYEHI 896

Query: 595 LRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDM 648
           +   LS  Q   Y + ++++ +  +  S G   S++N + +L+K  NHP LF+M
Sbjct: 897 VYCRLSKRQRFLYDDFMSRSQTKATLAS-GNFMSIVNCLMQLRKVCNHPDLFEM 949

 Score =  153 bits (387), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 99/154 (64%), Gaps = 1/154 (0%)

Query: 675  SGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRIS 734
             GK+  L +LL  LK +GHR LIF+QM ++LD+L  +LN  G  Y RLDG      R+I 
Sbjct: 1188 CGKLQKLAKLLQDLKDNGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQIL 1247

Query: 735  IDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNH 794
             + FN  D    VF+LS+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   
Sbjct: 1248 TERFNN-DPRVTVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1306

Query: 795  VMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 828
            V +YRFVS+ T+E  +L++A +K  L+  +I  G
Sbjct: 1307 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQRG 1340

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score =  221 bits (564), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 153/480 (31%), Positives = 248/480 (51%), Gaps = 39/480 (8%)

Query: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFEKW-APDL 432
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434

Query: 433 NCIYFVGNQKSR---DAIREGEFFTN-PQAKTKKHAKFNVLLTTYEYILKDRAELGAIKW 488
                V  +KS     A    E   N  QA+ +   K  VL+ +Y+ + ++  +L   + 
Sbjct: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK-PVLIISYDTLRRNVKQLQNTEV 493

Query: 489 QFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTID 548
             L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG     
Sbjct: 494 GLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 553

Query: 549 QEI--DFE-----NQDAEQ--------ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTER 593
            E   +FE     ++DA+         E  ++ L + +  FI+RR    + K LP K E 
Sbjct: 554 NEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEH 613

Query: 594 ILRVELSDVQTDYYKNIL-TKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDR 652
           ++ V L+  Q   Y  ++ +++   +  G  G+    L  +  LKK  NHP L  + E+ 
Sbjct: 614 VIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQ--PLKAIGVLKKLCNHPDLIKLDEE- 670

Query: 653 VLAKFGDGRMSRE-NILRG-----LIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRML 705
            L  + D  +  + +I  G         SGK  +L++ L ++K +   ++++ S   + L
Sbjct: 671 -LDNYNDLDIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTL 729

Query: 706 DILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTAD 765
           D++      +     RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A+
Sbjct: 730 DLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGAN 789

Query: 766 TVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 825
            +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L   ++
Sbjct: 790 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
            complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  223 bits (568), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 208/377 (55%), Gaps = 42/377 (11%)

Query: 338  ERPRFEKL----VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 393
            E    EKL    V  P  ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT+
Sbjct: 649  ESTNLEKLSVVDVPVPPLLRGT-LRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTI 707

Query: 394  AFISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFF 453
            A +++L   +   GPHL++VP S +  W+  F+++AP    + + G+ + R   R G   
Sbjct: 708  ALLAYLACEKENWGPHLIIVPTSVLLNWEMEFKRFAPGFKVLSYYGSPQQRKEKRRG--- 764

Query: 454  TNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSF 513
                    K   F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN +S+ +++L +F
Sbjct: 765  ------WNKLDAFHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFKSTRWQALLNF 818

Query: 514  KVANRLLITGTPLQNNIKELAALVNFLMP------GRFT---------------IDQEID 552
                RLL+TGTPLQNNI EL +L+ FLMP      G+ +               +D+ I 
Sbjct: 819  NTRRRLLLTGTPLQNNIAELWSLLYFLMPQTALENGKISGFADLDAFQQWFGKPVDKIIA 878

Query: 553  FENQDAEQET--YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNI 610
              + + + ET   +  LH  L+P++LRRLK DVEK +P+K E IL   LS  Q   Y + 
Sbjct: 879  ANDSEHDDETRRTVSKLHQVLRPYLLRRLKADVEKQMPAKYEHILYCRLSKRQRFLYDDF 938

Query: 611  LTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGR--MSRENIL 668
            +++  +  +  S G   S++N + +L+K  NHP LF++    +L  F   R  MS    L
Sbjct: 939  MSRAQTKATLAS-GNFMSIINCLMQLRKVCNHPDLFEVRP--ILTSFCMDRSVMSNYAHL 995

Query: 669  RGLIMSSGKMVLLDQLL 685
              L++ +     LD ++
Sbjct: 996  NQLVLKNLNKHALDTVV 1012

 Score =  154 bits (390), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 99/154 (64%), Gaps = 1/154 (0%)

Query: 675  SGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRIS 734
             GK+  L  LL RLK++GHR LIF+QM ++LDIL  +LN  G  Y RLDG      R+I 
Sbjct: 1216 CGKLQSLAVLLRRLKEEGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1275

Query: 735  IDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNH 794
             + FN  D    VF+LS+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   
Sbjct: 1276 TERFNT-DPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 795  VMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 828
            V +YRF S+ T+E  +L++A +K  L+  +I  G
Sbjct: 1335 VHIYRFASEHTIESNILKKANQKRQLDNIVIQKG 1368

>Kwal_55.20143
          Length = 1494

 Score =  221 bits (564), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 188/327 (57%), Gaps = 35/327 (10%)

Query: 346 VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 405
           V  PS ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +++L   +  
Sbjct: 661 VPTPSLLRGT-LRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKHN 719

Query: 406 NGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAK 465
            GPHL++VP S +  W+  F+++AP    + + G+ + R   R+G  +  P A       
Sbjct: 720 WGPHLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKG--WNRPDA------- 770

Query: 466 FNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 525
           F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTP
Sbjct: 771 FHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTP 830

Query: 526 LQNNIKELAALVNFLMP----------------------GRFT--IDQEIDFENQDAEQE 561
           LQNN+ EL +L+ FLMP                      GR    I Q  +   QD E  
Sbjct: 831 LQNNLAELWSLLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETR 890

Query: 562 TYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAG 621
             +  LH  L+P++LRRLK DVEK +P+K E ++   LS  Q   Y + +++  +  +  
Sbjct: 891 KTVTKLHQVLRPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETLS 950

Query: 622 SKGAHFSLLNIMNELKKASNHPYLFDM 648
           S G   S++N + +L+K  NHP LF++
Sbjct: 951 S-GNFMSIINCLMQLRKVCNHPDLFEV 976

 Score =  157 bits (396), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 120/212 (56%), Gaps = 9/212 (4%)

Query: 675  SGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRIS 734
             GK+  L  LL  LK  GHR LIF+QM ++LD+L  +LN  G  Y RLDG     +R+I 
Sbjct: 1216 CGKLQKLATLLRDLKNGGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQIL 1275

Query: 735  IDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNH 794
             + FN  D+    F+LS+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   
Sbjct: 1276 TERFNT-DNRITAFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 795  VMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKF 854
            V +YRFVS+ T+E  +L++A +K  L+  +I  G      +T+    D    EL +I   
Sbjct: 1335 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQRGDFTTDYLTKLSVKDLVGAELPDIAAS 1394

Query: 855  GAGNMFK---ATDNQRKLEDLNLDDVLNHAED 883
                + +   AT + RKLE L     L  AED
Sbjct: 1395 DKPLLMEEDAATKDPRKLEKL-----LAQAED 1421

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  221 bits (563), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 192/328 (58%), Gaps = 37/328 (11%)

Query: 346  VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 405
            V  PS ++G  LR +Q  G+NW+A L++ + NGILADEMGLGKT+QT++ +++L   +  
Sbjct: 686  VPVPSLLRGN-LRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKEN 744

Query: 406  NGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAK 465
             GPHL+VVP S +  W+  F+++AP    + + G+ + R   R+G  +  P A       
Sbjct: 745  WGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKG--WNKPDA------- 795

Query: 466  FNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 525
            F+V + +Y+ +++D+      +WQ++ +DEAH +KN  S+ +++L +F    RLL+TGTP
Sbjct: 796  FHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTP 855

Query: 526  LQNNIKELAALVNFLMP----------------------GRFTIDQEIDFEN---QDAEQ 560
            LQNN+ EL +L+ FLMP                      GR  +D+ I+      QD E 
Sbjct: 856  LQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKIIETGQNFGQDKET 914

Query: 561  ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSA 620
            +  +  LH  L+P++LRRLK DVEK +P+K E I+  +LS  Q   Y + +++  +  + 
Sbjct: 915  KKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATL 974

Query: 621  GSKGAHFSLLNIMNELKKASNHPYLFDM 648
             S G   S++N + +L+K  NHP LF++
Sbjct: 975  AS-GNFMSIVNCLMQLRKVCNHPNLFEV 1001

 Score =  155 bits (392), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 100/154 (64%), Gaps = 1/154 (0%)

Query: 675  SGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRIS 734
             GK+  L  LL +LK +GHR LIF+QM ++LD+L  +LN  G  Y RLDG      R+I 
Sbjct: 1245 CGKLQKLAILLQQLKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQIL 1304

Query: 735  IDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNH 794
             + FN  DS   VF+LS+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   
Sbjct: 1305 TERFNT-DSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1363

Query: 795  VMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 828
            V +YRFVS+ T+E  +L++A +K  L+  +I  G
Sbjct: 1364 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQEG 1397

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  220 bits (561), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 120/327 (36%), Positives = 190/327 (58%), Gaps = 35/327 (10%)

Query: 346  VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 405
            V  PS ++G  LR +Q  G+NW+A L++   NGILADEMGLGKT+QT++ +++L   +  
Sbjct: 755  VPVPSLLRGT-LRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKEN 813

Query: 406  NGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAK 465
             GPHL+VVP S +  W+  F+++AP    + + G+ + R   R+G  +  P A       
Sbjct: 814  WGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRREKRKG--WNKPDA------- 864

Query: 466  FNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 525
            F+V +T+Y+ ++ D+      KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTP
Sbjct: 865  FHVCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTP 924

Query: 526  LQNNIKELAALVNFLMP------GRFTIDQEIDF----------------EN--QDAEQE 561
            LQNN+ EL +L+ FLMP      G+ +   ++D                 EN  QD E +
Sbjct: 925  LQNNLAELWSLLYFLMPQTALENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETK 984

Query: 562  TYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAG 621
              +  LH  L+P++LRRLK DVEK +P K E I+   LS  Q   Y + +++  +  +  
Sbjct: 985  KTVSKLHQVLRPYLLRRLKADVEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLA 1044

Query: 622  SKGAHFSLLNIMNELKKASNHPYLFDM 648
            S G   S++N + +L+K  NHP LF++
Sbjct: 1045 S-GNFMSIINCLMQLRKVCNHPDLFEV 1070

 Score =  159 bits (401), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 100/158 (63%), Gaps = 1/158 (0%)

Query: 671  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
            L    GK+  L QLL  LK +GHR LIF+QM ++LDIL  +LN  G  Y RLDG      
Sbjct: 1305 LQYDCGKLQKLAQLLQNLKDNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIED 1364

Query: 731  RRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIG 790
            R+I  + FN+ D    VF+LS+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIG
Sbjct: 1365 RQILTERFNS-DPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIG 1423

Query: 791  QKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 828
            Q   V +YRFVS  T+E  +L++A +K  L+  +I  G
Sbjct: 1424 QTRDVHIYRFVSDHTIESNILKKANQKRHLDNVVIQTG 1461

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score =  216 bits (551), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 148/481 (30%), Positives = 239/481 (49%), Gaps = 41/481 (8%)

Query: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFEKW-APDL 432
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390

Query: 433 NCIYFVGNQKSR----DAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKW 488
                V  +KS     +           QA+ +   K  VL+ +YE + ++  +L     
Sbjct: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLRRNVDQLKNCNV 449

Query: 489 QFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTID 548
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509

Query: 549 QEI--DFEN-----QDAEQ--------ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTER 593
            E   +FEN     +DA+         E  ++ L + +  FI+RR    + K LP K E 
Sbjct: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569

Query: 594 ILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRV 653
           ++ V L  +Q + Y N L K+               L  +  LKK  NHP L +  ++  
Sbjct: 570 VIFVNLKPLQNELY-NKLIKSREVKKVVKGVGGSQPLRAIGILKKLCNHPNLLNFEDEFD 628

Query: 654 LAKFGD--------GRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRM 704
                +        G  +R+   +     S K  +L++ L ++K +   ++++ S   + 
Sbjct: 629 DEDDLELPDDYNMPGSKARDVQTK----YSAKFSILERFLHKIKTESDDKIVLISNYTQT 684

Query: 705 LDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTA 764
           LD++      K  +  RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 685 LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744

Query: 765 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
           + +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L   +
Sbjct: 745 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804

Query: 825 I 825
           +
Sbjct: 805 V 805

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  212 bits (539), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 143/476 (30%), Positives = 236/476 (49%), Gaps = 57/476 (11%)

Query: 379 ILADEMGLGKTVQTVAFISWLI--YARRQNGPH--------------LVVVPLSTMPAWQ 422
           +LADEMGLGKT  T+A I  L+  + R  + P               LVV P++ +  W+
Sbjct: 295 LLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNWK 354

Query: 423 ETFEKWAPDLNCIYFVG----NQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILK 478
           + F KW P +N I  +     N   +D      F        +    + VL+  YE +L 
Sbjct: 355 KEFIKWLP-MNRIGILTLSSKNTPEKDKNDVRNFL-------RVQRTYQVLILGYEKLLN 406

Query: 479 DRAEL--GAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 536
             +EL     K   L  DE HRLKN+ S + + L   ++  ++++TGTP+QN++ E   +
Sbjct: 407 VFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTI 466

Query: 537 VNFLMPGRF------------TIDQEIDFENQDAEQ-----ETYIRDLHSRLQPFILRRL 579
           +NF+ PG               I +  D  N+  +Q     E+  +DL    + FILRR 
Sbjct: 467 INFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRT 526

Query: 580 KKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKA 639
              +   LP +T+ ++  + +  Q D +  +L          S  +   L+ +    KK 
Sbjct: 527 SSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQNMSFNSSLGLITL---FKKI 583

Query: 640 SNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRL--KKDGHRVLI 697
            N P L  ++ D       +G      I +    +SGK+ +L  LL ++  + D  +V++
Sbjct: 584 CNSPSL--VSSDSYFQSKVNGGTPALRIAQS--TTSGKLKVLMSLLHQIAHRSDNEKVVV 639

Query: 698 FSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGL 757
            S   + LDI+G+ ++   ++Y RLDG+ P+ +R   ++ FN   +  F FLLS ++GG+
Sbjct: 640 ISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQT-IFGFLLSAKSGGV 698

Query: 758 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 813
           G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YR V+   ++E++ +R
Sbjct: 699 GLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQR 754

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  214 bits (545), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 198/334 (59%), Gaps = 31/334 (9%)

Query: 343 EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
           E  +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L  A
Sbjct: 642 EITIEQPKIL-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--A 698

Query: 403 RRQN--GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKT 460
            R N  GP +VV P ST+  W    +K+ PD   + + GN   R  +R   F+     + 
Sbjct: 699 ERYNIWGPFIVVTPASTLHNWVNEIQKFVPDFKILPYWGNGNDRKILRR--FWDRKHLRY 756

Query: 461 KKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLL 520
            K A F+V++T+Y+ I+ D A L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL
Sbjct: 757 SKDAPFHVMITSYQMIVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLL 816

Query: 521 ITGTPLQNNIKELAALVNFLMPGRFTIDQEI-DFENQDAE---------QETYIRDLHSR 570
           +TGTP+QN+++EL AL++F+MP  F    E  D+ ++D E          +  +R LH  
Sbjct: 817 LTGTPIQNSMQELWALLHFIMPSLFDSHDEFNDWFSKDIESHAQSNTQLNQQQLRRLHMI 876

Query: 571 LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY---KNILTKNYSAL------SAG 621
           L+PF+LRR+KK+V+  L  K E  +  +L+  Q   Y   K+ ++ +Y A+      S+G
Sbjct: 877 LKPFMLRRIKKNVQSELGDKIEIDVMCDLTHRQAKLYQVLKSQVSASYDAIENAASNSSG 936

Query: 622 SKGAHFSL-----LNIMNELKKASNHPYLFDMAE 650
               + SL     +N + E +K  NHP LF+ A+
Sbjct: 937 DDSGNMSLSDSKIMNTVMEFRKVCNHPDLFERAD 970

 Score =  152 bits (385), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 108/165 (65%), Gaps = 2/165 (1%)

Query: 671  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
             I  S K+  LD+LL RLK   HRVLI+ QM RM+D++ +YL  +   + RLDG+     
Sbjct: 1235 FITESAKLKKLDELLVRLKAGEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLED 1294

Query: 731  RRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIG 790
            RR  + H     S+ F+FLLSTRAGGLGINL +ADTVI +DSDWNP  D QAM RAHR+G
Sbjct: 1295 RR-DLVHDWQTKSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLG 1353

Query: 791  QKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNI 835
            Q   V VYR + K T+EE + +RA++K  ++  ++  G T  +N+
Sbjct: 1354 QTKQVTVYRLLIKGTIEERMRDRAKQKEHVQQVVME-GKTKENNV 1397

>Scas_669.20
          Length = 1397

 Score =  213 bits (543), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 192/332 (57%), Gaps = 23/332 (6%)

Query: 346 VEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQ 405
           +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L      
Sbjct: 635 IEQPKML-ACTLKEYQLKGLNWLASLYDQGINGILADEMGLGKTVQSISVLAHLAEKHNI 693

Query: 406 NGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAK 465
            GP+LVV P ST+  W     K+ P    + + GN   R  +R+  F+     +  K + 
Sbjct: 694 WGPYLVVTPASTLHNWVNEITKFVPQFKILPYWGNAADRKVLRK--FWDRKNLRYTKDSP 751

Query: 466 FNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 525
           F+V++T+Y+ ++ D   L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP
Sbjct: 752 FHVMITSYQMVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTP 811

Query: 526 LQNNIKELAALVNFLMPGRFTIDQEI------DFENQDAEQET-----YIRDLHSRLQPF 574
           +QNN++EL AL++F+MP  F    E       D E+  AE  T      +R LH  L+PF
Sbjct: 812 IQNNMQELWALLHFIMPSLFDSHDEFSEWFAKDIESH-AEANTQLNHQQLRRLHMILKPF 870

Query: 575 ILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNI-LTKNYSALSAGSKGAHFS----L 629
           +LRR+KK+V+  L  K E  +  +L+  Q   Y+ +  T NY A+   +    FS    L
Sbjct: 871 MLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSDEFSSDQNL 930

Query: 630 LNIMNELKKASNHPYLFDMAEDR---VLAKFG 658
           +N + + +K  NHP LF+ A+        KFG
Sbjct: 931 VNTVMQFRKVCNHPDLFERADINSPFAFTKFG 962

 Score =  152 bits (384), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 114/176 (64%), Gaps = 4/176 (2%)

Query: 671  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
             I  S K+  LD+LL +LK++GHRVLI+ QM +M+D++ +YL  +   + RLDG+     
Sbjct: 1215 FITESAKLKKLDELLVQLKREGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLED 1274

Query: 731  RR-ISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRI 789
            RR +  D    P+   FVFLLSTRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+
Sbjct: 1275 RRDLVHDWQTKPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRL 1332

Query: 790  GQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSA 845
            GQ   V VYR + + T+EE + +RA++K  ++  ++  G T  +N+   + S+ + 
Sbjct: 1333 GQTRQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVME-GKTQENNVKTIEASNSTT 1387

>Kwal_27.11388
          Length = 1334

 Score =  213 bits (541), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 207/355 (58%), Gaps = 28/355 (7%)

Query: 343 EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
           E  ++QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L   
Sbjct: 581 EITIDQPKLLTCT-LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEN 639

Query: 403 RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
               GP +VV P ST+  W     K+ PD   + + GN   R  +R   F+   Q +  K
Sbjct: 640 YNIWGPFIVVTPASTLHNWVNEISKFLPDFKILPYWGNGNDRKILRR--FWDRKQFRYGK 697

Query: 463 HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLIT 522
            A F+V++T+Y+ ++ D A L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+T
Sbjct: 698 DAPFHVMVTSYQMVVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLT 757

Query: 523 GTPLQNNIKELAALVNFLMPGRF-TIDQEIDFENQDAE---------QETYIRDLHSRLQ 572
           GTP+QNN++EL AL++F+MP  F + D+  D+ ++D E          +  +R LH  L+
Sbjct: 758 GTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAQSNTKLNQQQLRRLHMILK 817

Query: 573 PFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY---KNILTKNYSAL--SAGSKGAHF 627
           PF+LRR+KK+V+  L  K E  +  +L+  Q   Y   K+ ++  Y A+  +AGS  A  
Sbjct: 818 PFMLRRIKKNVQSELGEKIEIDVMCDLTRRQHKLYQVLKSQMSAAYDAIENAAGSDEASS 877

Query: 628 --SLLNIMNELKKASNHPYLFDMAEDRVLAKFGD-GRMSRENILRGLIMSSGKMV 679
             +++N + + +K  NHP LF+  + R    F D GR        G I+  G M+
Sbjct: 878 DQNIVNTVMQFRKVCNHPDLFEREDVRSPFAFTDFGR-------SGSILREGGMI 925

 Score =  149 bits (375), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 109/168 (64%), Gaps = 4/168 (2%)

Query: 671  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
             I  S K+  LD+LL  LKK+ HRVLI+ QM +M+D++ +YL+ +   + RLDG+     
Sbjct: 1165 FITESTKLKKLDELLVNLKKNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLED 1224

Query: 731  RR-ISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRI 789
            RR +  D    P+   F+FLLSTRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+
Sbjct: 1225 RRDLVHDWQTKPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRL 1282

Query: 790  GQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQ 837
            GQ   V VYR + + T+EE + +RA++K  ++  ++  G T   +I Q
Sbjct: 1283 GQTRQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVME-GKTQEKDIQQ 1329

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  213 bits (541), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 192/330 (58%), Gaps = 25/330 (7%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E  +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L   
Sbjct: 709  EITIEQPKML-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEH 767

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
                GP LVV P ST+  W     K+ P    + + G+   R  +R+  F+     +  +
Sbjct: 768  HNIWGPFLVVTPASTLHNWVNEISKFVPQFKILPYWGSANDRKVLRK--FWDRKNLRYSE 825

Query: 463  HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLIT 522
             + F+V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+T
Sbjct: 826  KSPFHVMITSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLT 885

Query: 523  GTPLQNNIKELAALVNFLMPGR----------FTIDQEIDFENQDAEQETYIRDLHSRLQ 572
            GTP+QNN++EL AL++F+MP            F+ D E   E   +  +  +R LH  L+
Sbjct: 886  GTPIQNNMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEGNSSLNQQQLRRLHMILK 945

Query: 573  PFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY---KNILTKNYSALS---------A 620
            PF+LRR+KK+V+  L  K E  +  +L+  QT  Y   K+ ++ NY A+          A
Sbjct: 946  PFMLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLYQVLKSQMSSNYDAIENAAAEGSDIA 1005

Query: 621  GSKGAHFSLLNIMNELKKASNHPYLFDMAE 650
            G   +  S++N + + +K  NHP LF+ A+
Sbjct: 1006 GGGNSDQSIINAVMQFRKVCNHPDLFERAD 1035

 Score =  153 bits (387), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 114/179 (63%), Gaps = 3/179 (1%)

Query: 671  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
             I  S K+  LD+LL  LKK+ HRVLI+ QM +M+D++ +YL  +   + RLDG+     
Sbjct: 1290 FITESAKLKKLDELLVELKKNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLED 1349

Query: 731  RRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIG 790
            RR  + H    +   F+FLLSTRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+G
Sbjct: 1350 RR-DLVHDWQTNPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLG 1408

Query: 791  QKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELS 849
            Q   V VYR + + T+EE + +RA++K  ++  ++  G T  +NI Q+  + P   +L+
Sbjct: 1409 QTKQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVME-GKTKDTNI-QTTHTRPEHEQLT 1465

>Scas_718.40
          Length = 926

 Score =  208 bits (530), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 155/496 (31%), Positives = 245/496 (49%), Gaps = 58/496 (11%)

Query: 379 ILADEMGLGKTVQTVAFISWLI--------YARRQNG--------PHLVVVPLSTMPAWQ 422
           +LADEMGLGKT+ T+  I  L+         A  Q+G          LVV P++ +  W+
Sbjct: 305 LLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWK 364

Query: 423 ETFEKWAPDLNCIYFVG----NQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILK 478
             F KW  +LN I  +     N    D      F        +    F VL+  YE +L 
Sbjct: 365 REFAKWL-NLNRIGILTLSSRNTPEMDKTAVKNFL-------RVQRTFQVLVIGYEKLLS 416

Query: 479 DRAELGAIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 536
              EL   +     L  DE HRLKN  S +   L + ++  ++L++GTP+QN++ E   +
Sbjct: 417 VSEELHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTI 476

Query: 537 VNFLMPG----------RFT--IDQEIDFENQDAEQ-----ETYIRDLHSRLQPFILRRL 579
           ++FL PG          RF   I +  D EN+  E      E   +++    + F LRR 
Sbjct: 477 IDFLNPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLRRT 536

Query: 580 KKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKA 639
              + K LP KT+ IL  + +  Q   + +IL+++    +  S  +   L+ +    KK 
Sbjct: 537 NAILSKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFANLSFNSSLGLITL---FKKI 593

Query: 640 SNHPYLFDMAEDRVL-AKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLK--KDGHRVL 696
            N P L  + +D    +K     + +E   R L  +SGK+ +L  LL ++K   +  +V+
Sbjct: 594 CNSPTL--IGDDSYYQSKIRPDGVIQERYDRSL--NSGKLKILMTLLEKIKGNTNNEKVV 649

Query: 697 IFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGG 756
           I S   + LDI+ + +N   +   RLDG+ P+ QR   ++ FN  + + F FLLS ++GG
Sbjct: 650 IVSNYTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNR-NPSIFAFLLSAKSGG 708

Query: 757 LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARK 816
           +G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK H  +YR ++   ++E++L+R   
Sbjct: 709 VGLNLIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQLM 768

Query: 817 KMILEYAIISLGVTDG 832
           K  L    +    T G
Sbjct: 769 KHSLSKKFLDSSYTTG 784

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  211 bits (536), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 122/333 (36%), Positives = 194/333 (58%), Gaps = 29/333 (8%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E  +EQP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L   
Sbjct: 693  EITIEQPKIL-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEN 751

Query: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462
                GP LVV P ST+  W     K+ P    + + GN   R  +R+  F+     +  K
Sbjct: 752  HNIWGPFLVVTPASTLHNWVNEISKFLPQFKILPYWGNANDRKVLRK--FWDRKNLRYNK 809

Query: 463  HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLIT 522
            +A F+V++T+Y+ ++ D   L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+T
Sbjct: 810  NAPFHVMVTSYQMVVTDANYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLT 869

Query: 523  GTPLQNNIKELAALVNFLMPGRFTIDQEI------DFENQDAEQET-----YIRDLHSRL 571
            GTP+QN+++EL AL++F+MP  F    E       D E+  AE  T      +R LH  L
Sbjct: 870  GTPIQNSMQELWALLHFIMPSLFDSHDEFNEWFSKDIESH-AEANTKLNQQQLRRLHMIL 928

Query: 572  QPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY---KNILTKNYSAL---------- 618
            +PF+LRR+KK+V+  L  K E  +  +L+  Q   Y   K+ ++ NY A+          
Sbjct: 929  KPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTS 988

Query: 619  -SAGSKGAHFSLLNIMNELKKASNHPYLFDMAE 650
             SA + G+  +L+N + + +K  NHP LF+ A+
Sbjct: 989  NSASNSGSDQNLINAVMQFRKVCNHPDLFERAD 1021

 Score =  153 bits (386), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 79/165 (47%), Positives = 107/165 (64%), Gaps = 2/165 (1%)

Query: 671  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
             I  S K+  LD+LL +LK +GHRVLI+ QM +M+D++ +YL  +   + RLDG+     
Sbjct: 1294 FITESAKLRKLDELLVKLKSEGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLED 1353

Query: 731  RRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIG 790
            RR  + H    +   FVFLLSTRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+G
Sbjct: 1354 RR-DLVHDWQTNPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLG 1412

Query: 791  QKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGSNI 835
            Q   V VYR + + T+EE + +RA++K  ++  ++  G T   NI
Sbjct: 1413 QTRQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVME-GKTQEKNI 1456

>Scas_520.5
          Length = 863

 Score =  205 bits (522), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 113/283 (39%), Positives = 166/283 (58%), Gaps = 30/283 (10%)

Query: 347 EQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN 406
           EQPS +K   L+ +QL G+NW+  L+    NGILAD+MGLGKT+Q++A +++ IY     
Sbjct: 261 EQPSMLKNCVLKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAF-IYEMDTK 319

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPDLNCI--YFVGNQKSRDAIREGEFFTNPQAKTKKHA 464
           GP L+  PLST+  W   FEK+APDL  +  Y  G +  R+ +    F        KK  
Sbjct: 320 GPFLIAAPLSTVDNWMNEFEKFAPDLPVLKYYHPGGKNERNKLMRNFF--------KKTN 371

Query: 465 KFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 524
              +++T+YE I++D   + + +W+FL VDE HRLKN    L + L     +NRLL+TGT
Sbjct: 372 GTGIVVTSYEIIIRDADYIMSKQWKFLIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGT 431

Query: 525 PLQNNIKELAALVNFLMPGRFT----IDQEIDFENQDAE--------------QETYIRD 566
           PLQNN+ EL +L+NF+MP  FT     ++  DF++ + E              Q+  I +
Sbjct: 432 PLQNNLAELWSLLNFIMPDIFTDFEIFNKWFDFKDLEMESNSSKLNKVINEELQKNLISN 491

Query: 567 LHSRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTDYYK 608
           LH+ L+PF+LRRLKK V  + LP K E ++   L+ +Q  +YK
Sbjct: 492 LHTILKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQKKFYK 534

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/197 (45%), Positives = 123/197 (62%), Gaps = 12/197 (6%)

Query: 668 LRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVP 727
           L+ L+ SSGK+  L +L+  L   GH++LIFSQ V MLD+L D+ ++  +   R+DGT+ 
Sbjct: 643 LQELLESSGKLKTLQRLVIPLIAKGHKILIFSQFVNMLDLLEDWCDLNSLAAFRIDGTID 702

Query: 728 SAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 787
           +  R+  +  FN   +   VFLLSTRA GLG+NL+ ADTV++FDSDWNPQ DLQAM R H
Sbjct: 703 NESRKEQLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDLQAMDRCH 762

Query: 788 RIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLG---------VTDGSNITQS 838
           RIGQ   V+VYRF   +T+E  +L RA  K  LE  +I +G         + +GS + QS
Sbjct: 763 RIGQTKPVIVYRFCCDNTLEHVILTRAANKRKLERLVIQMGKFNTLKKLALNEGSFLMQS 822

Query: 839 K---KSDPSAGELSEIL 852
           K    + PS  EL + L
Sbjct: 823 KGDHNTKPSNKELVQEL 839

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  206 bits (524), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 147/485 (30%), Positives = 247/485 (50%), Gaps = 65/485 (13%)

Query: 379 ILADEMGLGKTVQTVAFISWLIYAR-------RQNGPHL--------VVVPLSTMPAWQE 423
           +LADEMGLGKT+ T+  I W +  +        Q G  L        +V P++ +  W++
Sbjct: 317 LLADEMGLGKTLMTITLI-WTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWKK 375

Query: 424 TFEKWAPDLNCIYFVG----NQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKD 479
            F+KW P +N I  +     N  + D  +   F   P+        + VL+  YE +L  
Sbjct: 376 EFKKWLP-MNRIGVLTLHSRNSPTEDKAQVRSFLKVPRT-------YQVLIVGYEKLLSI 427

Query: 480 RAELGAIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALV 537
           + EL   K     +  DE HRLKN +S + + L S  +  +++++GTP+QN+++E   ++
Sbjct: 428 KDELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLEEFYTII 487

Query: 538 NFLMPG------RFT------IDQEIDF---ENQDAEQETYIRD--LHSRLQPFILRRLK 580
           +F+ PG      RF       I +  D    +NQ   ++  +R   L    + FILRR  
Sbjct: 488 DFINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRFILRRTN 547

Query: 581 KDVEKSLPSKTERILRVELSDVQTDYYKNILTK---NYSALSAGSKGAHFSLLN-IMNEL 636
           + +++ LP +T+ I+  + +  Q + +  ILT+   N+S ++  S     +L   I N  
Sbjct: 548 EILQQYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLNFSNMTFNSSLGLITLFKKICNST 607

Query: 637 KKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLK-KDGHRV 695
           +     PY ++    +V      G+ +           SGK+ +L  LL  LK K   +V
Sbjct: 608 RLIKTDPY-YEERLSQVQTSSTSGKFT-----------SGKLRILLSLLHELKTKTDEKV 655

Query: 696 LIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAG 755
           ++ S   + LDI+  + + +G T  RLDG+  +  R   +  FN  D + FVFLLS ++G
Sbjct: 656 VVISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFNN-DPSIFVFLLSAKSG 714

Query: 756 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 815
           G+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQ+    +YR V+   ++E++L+R  
Sbjct: 715 GVGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCIDEKILQRQL 774

Query: 816 KKMIL 820
            K+ L
Sbjct: 775 MKIAL 779

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  205 bits (521), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 152/478 (31%), Positives = 241/478 (50%), Gaps = 62/478 (12%)

Query: 379 ILADEMGLGKTVQTVAFISWLI----YARRQNGPH------------LVVVPLSTMPAWQ 422
           +LAD+MGLGKT+ ++  I  LI    +A + +               LVV P++ +  W+
Sbjct: 309 LLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWK 368

Query: 423 ETFEKWAPDLNCIYFVG----NQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILK 478
             F KW  +L+ I  +     N    D +    F        K    + VL+  YE +L 
Sbjct: 369 REFGKWL-NLSRIGVLTLSSRNSPDMDKMAVRNFL-------KVQRTYQVLIIGYEKLLS 420

Query: 479 DRAELGAIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 536
              EL   K     L  DE HRLKN  S +  +L S  +  +LL+TGTP+QN++ E   +
Sbjct: 421 VSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTI 480

Query: 537 VNFLMPG----------RFTI--DQEIDFENQDAEQ-----ETYIRDLHSRLQPFILRRL 579
           ++F+ PG          RF I   +  D  N+  E+     E   +++    + FILRR 
Sbjct: 481 IDFINPGILGSFASFKRRFIIPITRARDTANRYNEELLEKGEERSKEMIEITKRFILRRT 540

Query: 580 KKDVEKSLPSKTERILRVELSDVQTDYYKNILTK---NYSALSAGSKGAHFSLLNIMNEL 636
              +EK LP KT+ IL  +    Q   +K+IL     ++  L+  S       L ++  L
Sbjct: 541 NAILEKYLPPKTDIILFCKPYSQQILAFKDILQGARLDFGQLTFSSS------LGLITLL 594

Query: 637 KKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDG-HRV 695
           KK  N P L  +  D           S+++  R L  +SGK+ +L  LL  ++K    +V
Sbjct: 595 KKVCNSPGL--VGSDPYYKSHIKDTQSQDSYSRSL--NSGKLKVLMTLLEGIRKGTKEKV 650

Query: 696 LIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAG 755
           ++ S   + LDI+ + +N+ G+++ RLDG++P+ QR   +  FN  +   F FLLS ++G
Sbjct: 651 VVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNR-NPAIFGFLLSAKSG 709

Query: 756 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 813
           G+G+NL+    +I+FD+DWNP  DLQAM+R HR GQK    +YR V+   ++E++L+R
Sbjct: 710 GVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQR 767

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  207 bits (526), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 119/335 (35%), Positives = 200/335 (59%), Gaps = 26/335 (7%)

Query: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402
            E  ++QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ+++ ++ L  A
Sbjct: 733  EITIDQPKML-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--A 789

Query: 403  RRQN--GPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKT 460
             R N  GP +VV P ST+  W     ++ P    + + GN   R  +R+  F+     + 
Sbjct: 790  DRYNIWGPFIVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLRK--FWDRKHLRY 847

Query: 461  KKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLL 520
             + A F+V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL
Sbjct: 848  GRDAPFHVMVTSYQMVVSDASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLL 907

Query: 521  ITGTPLQNNIKELAALVNFLMPGRF-TIDQEIDFENQDAE---------QETYIRDLHSR 570
            +TGTP+QNN++EL AL++F+MP  F + D+  D+ ++D E          +  +R LH  
Sbjct: 908  LTGTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAESNTELNQEQLRRLHMV 967

Query: 571  LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYY---KNILTKNYSALSAGSKGAHF 627
            L+PF+LRR+KK+V+  L  K E  +  +L+  Q   Y   K+ ++  Y A+   +     
Sbjct: 968  LKPFMLRRIKKNVQSELGDKIEIDVLCDLTFRQAKLYQVLKSQVSGGYDAIENAAGNDDV 1027

Query: 628  S----LLNIMNELKKASNHPYLFDMAEDRVLAKFG 658
            +    L+N++ E +K  NHP LF+ A+  V++ F 
Sbjct: 1028 TSDQKLVNLVMEFRKVCNHPDLFERAD--VMSPFS 1060

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 105/156 (67%), Gaps = 3/156 (1%)

Query: 671  LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
             I  S K+  LD+LL +LK++ HRVLI+ QM +M+D++ +YL  +  T+ RLDG+     
Sbjct: 1314 FITESAKLKKLDELLVKLKEEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDD 1373

Query: 731  RR-ISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRI 789
            RR +  D    PD   F+FLLSTRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+
Sbjct: 1374 RRDLVHDWQTKPDI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRL 1431

Query: 790  GQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 825
            GQ   V VYR + + T+EE + +RA++K  ++  ++
Sbjct: 1432 GQTRQVTVYRLLIRGTIEERMRDRAKQKEHVQQVVM 1467

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  196 bits (499), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 152/501 (30%), Positives = 239/501 (47%), Gaps = 72/501 (14%)

Query: 379 ILADEMGLGKTVQTVAFISWLI----YARRQNGPHL------------VVVPLSTMPAWQ 422
           ILAD+MGLGKT+ T+  I  L+    +A +     L            +V P++ +  W+
Sbjct: 311 ILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWK 370

Query: 423 ETFEKWAPDLNCIYFVG----NQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILK 478
             F+KW   LN I  +     N    D I    F        K +  + VL+  YE +L 
Sbjct: 371 REFKKWL-GLNRIGILTLNPKNNVDMDKISVRNFI-------KVNRTYQVLILGYEKVLT 422

Query: 479 DRAEL--GAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 536
            + EL     K   L  DE HRLKN  S + + L S  +  ++++TGTP+QN++ E   +
Sbjct: 423 VQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFFTI 482

Query: 537 VNFLMPGRF------------TIDQEIDFEN--------QDAEQETYIRDLHSRLQPFIL 576
           ++F+ PG               I +  D  N        Q  E+   + +   R   FIL
Sbjct: 483 IDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKR---FIL 539

Query: 577 RRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNEL 636
           RR    + K LP KT+ IL    +  Q   +++I+      ++  +      L+N+M   
Sbjct: 540 RRSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVDMNNITFNTSLGLINLM--- 596

Query: 637 KKASNHPYLFDMAEDRVLAKFGDGRM----SRENILRGLIMSSGKMVLLDQLLTRLKKDG 692
           KK  N P L  +  D       D  +    ++ N       SSGK+ +L +LL  +K   
Sbjct: 597 KKVCNSPSL--LCNDPYYQSNVDSNIFTVSNKSN-------SSGKLTVLLELLLEIKATS 647

Query: 693 --HRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLL 750
              +V+I S   + LDI+   +N   ++  RLDG  P+ QR + ++ FN  + N F FLL
Sbjct: 648 PMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNN-NPNIFGFLL 706

Query: 751 STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 810
           S +AGG+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQK    +YR ++   ++E++
Sbjct: 707 SAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKI 766

Query: 811 LERARKKMILEYAIISLGVTD 831
           L+R   K  L    +S   +D
Sbjct: 767 LQRQLMKHNLTRKFLSSNTSD 787

>Kwal_27.10513
          Length = 900

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 142/487 (29%), Positives = 236/487 (48%), Gaps = 67/487 (13%)

Query: 379 ILADEMGLGKTVQTVAFISWLIYAR---------RQNGPHL--------VVVPLSTMPAW 421
           +LADEMGLGKT+ T+  + W +  +          QNG  L        VV P++ +  W
Sbjct: 295 LLADEMGLGKTLMTITLV-WTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVTLIGNW 353

Query: 422 QETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRA 481
           +  F KW  ++N I  +      +A ++     N     +    + VL+  YE +L    
Sbjct: 354 KREFSKWL-NVNRIGILTLSSKSNAEKDKLTVRN---FLRVQRTYQVLVIGYEKLLSVTE 409

Query: 482 EL--GAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNF 539
           EL     K   +  DE HRLKN +S   ++++S +V  ++++TGTP+QN++ E   + +F
Sbjct: 410 ELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAEFFTIADF 469

Query: 540 LMPGRFTIDQEIDFENQDAEQETYIRDLHSR-------------------LQPFILRRLK 580
           L  G   +     F+       T  RDL+++                    + F LRR  
Sbjct: 470 LNDG--ILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFTLRRTA 527

Query: 581 KDVEKSLPSKTERILRVELSDVQTDYYKNILTK---NYSALSAGSKGAHFSLLNIMNELK 637
           + + K LPSKT+ +L  + +  Q D ++  L+    ++S L+  S       L ++   K
Sbjct: 528 ETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRLTFNSS------LGLITLFK 581

Query: 638 KASNHPYLF--DMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKK--DGH 693
           K  N P L   D      +    + ++S  +        SGK+ +L  LL  L+K     
Sbjct: 582 KICNSPSLISQDSYYLETIKPNSEVKISAPD--------SGKLRVLMALLDNLRKLSPQE 633

Query: 694 RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTR 753
           +V+I S   + LDI+ + +    +++ RLDG+  +  R   ++ FN   S  F FLLS +
Sbjct: 634 KVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPS-IFAFLLSAK 692

Query: 754 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 813
           +GG+G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YR ++   ++E++ +R
Sbjct: 693 SGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEKIFQR 752

Query: 814 ARKKMIL 820
              K  L
Sbjct: 753 QLAKTSL 759

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  161 bits (407), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 109/162 (67%), Gaps = 5/162 (3%)

Query: 671 LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQ 730
           L+ +SGK+ +L QL+ +L  +GH+VLIFSQ V MLD++ D+  +      R+DG++ +  
Sbjct: 29  LLQTSGKLQILQQLVPKLINEGHKVLIFSQFVNMLDLIEDWCELNDFQACRIDGSMDNEV 88

Query: 731 RRISIDHFNA----PDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARA 786
           R+  I  FN+      +ND VFLLSTRAGGLGINL  AD+V+IFDSDWNPQ DLQAM R 
Sbjct: 89  RQEQIGKFNSKTTDSHAND-VFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAMDRT 147

Query: 787 HRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 828
           HRIGQ   V+VYR    +TVE  +L RA  K  LE  +I +G
Sbjct: 148 HRIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVIQMG 189

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 106/205 (51%), Gaps = 41/205 (20%)

Query: 357 LRDFQLTGINWMAFLWSKND---NGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVV 413
           L  FQL G++WMA L   N+    G+LADEMG+GKTVQ    IS L++A +  GP LVV 
Sbjct: 142 LLPFQLEGLHWMA-LQENNERYRGGVLADEMGMGKTVQ---MISLLLHANK--GPTLVVA 195

Query: 414 PLSTMPAWQETFEKWAPD-LNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTT 472
           P   +  W+   +K+    L  + F G  +S              A +++ A  +V+LTT
Sbjct: 196 PTVALIQWKNEIDKYTGGALRSLVFHGPGRS--------------AVSEELAAADVVLTT 241

Query: 473 YEY-----------------ILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKV 515
           Y                   ++++++ L A+ +  + +DEAH +K+  S    S+N+ + 
Sbjct: 242 YAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYRVVLDEAHNIKDRSSGTARSVNALRA 301

Query: 516 ANRLLITGTPLQNNIKELAALVNFL 540
             R  +TGTPLQN I E+ +L+ FL
Sbjct: 302 VRRWCLTGTPLQNRIGEMYSLIRFL 326

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 91/168 (54%), Gaps = 5/168 (2%)

Query: 668 LRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLNIKGITYQRLDGT 725
           L+G   SS K+  L + L  L+     +  ++FSQ   MLD++   L   G    +L G+
Sbjct: 567 LQGNWRSSTKIEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGS 626

Query: 726 VPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMAR 785
           +   QR  +I++F   + +  VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R
Sbjct: 627 MTPTQRAETINYF-MDNVHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDR 685

Query: 786 AHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGS 833
            HRIGQ   V + RF  +D++E  ++E   KK  + +A  +LG  +G+
Sbjct: 686 VHRIGQHRPVKITRFCIEDSIESRIIELQEKKANMIHA--TLGQDEGA 731

>Kwal_23.3660
          Length = 768

 Score = 93.2 bits (230), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 92/167 (55%), Gaps = 4/167 (2%)

Query: 662 MSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLNIKGITY 719
           +SR NI +G   SS K+  L + L  L+ D   +  ++FSQ   MLD++   L   G   
Sbjct: 584 VSRLNI-QGSWRSSTKIEALVEELYNLRSDRRTIKSIVFSQFTSMLDLVEWRLKRAGFQT 642

Query: 720 QRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 779
            +L G++   QR  +I +F   +++  VFL+S +AGG+ +NL  A  V I D  WNP  +
Sbjct: 643 VKLQGSMTPTQRDQTIKYF-MDNTHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVE 701

Query: 780 LQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
            Q+  R HRIGQ   V + RF  +D++E  ++E   KK  + +A I+
Sbjct: 702 WQSGDRVHRIGQYRPVKITRFCIEDSIESRIIELQEKKANMIHATIN 748

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 99/204 (48%), Gaps = 37/204 (18%)

Query: 356 ELRDFQLTGINWM-AFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVP 414
           +L  FQL G++W+ +   S  + G+LADEMG+GKT+QT+A    L+       P LVV P
Sbjct: 161 KLLPFQLEGLHWLISQEHSVYNGGVLADEMGMGKTIQTIA----LLMNDVTKKPSLVVAP 216

Query: 415 LSTMPAWQETFEKW-APDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTY 473
              +  W+   E+     L    F G  ++ +    GEF              +VLLTTY
Sbjct: 217 TVALMQWKNEIEQHTGGKLKTHIFHGANRTSNV---GEF-----------KDVDVLLTTY 262

Query: 474 EY-----------------ILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVA 516
                              + K+ + L  + +  + +DEAH +K+ +S+  +++NS    
Sbjct: 263 AVLESVFRKQNYGFKRKSGVYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTE 322

Query: 517 NRLLITGTPLQNNIKELAALVNFL 540
            +  +TGTPLQN I E+ +L+ FL
Sbjct: 323 KKWCLTGTPLQNRIGEMYSLIRFL 346

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 2/128 (1%)

Query: 694  RVLIFSQMVRMLDILGDYLNIK-GITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLST 752
            +++IFSQ     +ILG ++    G+ + R DG++ S+QR   I+ F   D+N  V L+S 
Sbjct: 1448 KLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESF-YQDNNYRVMLISM 1506

Query: 753  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 812
            +AG  G+ L  A+ VI+ D  WNP  + QAM R HRI Q+  V V+R + K +VE+ ++E
Sbjct: 1507 KAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVEDRIVE 1566

Query: 813  RARKKMIL 820
               KK  L
Sbjct: 1567 LQNKKKTL 1574

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 87/395 (22%), Positives = 165/395 (41%), Gaps = 97/395 (24%)

Query: 336  GSERPRFEKLVEQPSFIKGGELRDFQLT---------GINWMAFLW-SKNDNGILADEMG 385
             S R   E L E  + ++G +L   +LT         G+ W+  +  S    G+LAD+MG
Sbjct: 889  SSLRDLLEGLKEIETEVEGEDLTPNELTVNLLKHQRQGLRWLVSMEKSSKRGGLLADDMG 948

Query: 386  LGKTVQTVAFISWLIYARRQNGPH--------LVVVPLSTMPAWQ-ETFEKWAPDLNC-- 434
            LGKTVQ++A +         N P         LVV P++ +  W+ E   K   D+N   
Sbjct: 949  LGKTVQSLALL-------MANKPEPKSAIKTTLVVAPVAVLRVWKDEVAVKIKKDVNVKV 1001

Query: 435  IYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQ----- 489
            + F G + +    R            K  A+++++L +Y+ +  +  +   + W+     
Sbjct: 1002 VIFGGGENNSSKFRSW----------KDLAEYDIVLVSYQTLASEFKKHWPLSWKNGEHQ 1051

Query: 490  --------------------------------FLAVDEAHRLKNAESSLYESLNSFKVAN 517
                                             + +DEA  +KN ++   ++  +     
Sbjct: 1052 PDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRVILDEAQNIKNKKTQAAKACCTISSTF 1111

Query: 518  RLLITGTPLQNNIKELAALVNFL-MP-----GRF------TIDQEIDFENQDAEQETYIR 565
            R  ++GTP+QNNI EL +L+ FL +P      +F       ++ +  ++  D+E++  ++
Sbjct: 1112 RWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKFHSDIGAVLNTKKPYDYNDSERQRAMK 1171

Query: 566  DLHSRLQPFILRRLKKDVEK-----SLPSKTERILRVELSDVQTDYYKNILTKNYSAL-- 618
             +   L+  +LRR K           LP K  +    +L   + ++Y+ + +K+      
Sbjct: 1172 KVQVLLRAIMLRRTKTSQIDGKPILQLPEKHLKESANKLEGDELEFYQALESKSRDKAKK 1231

Query: 619  ---SAGSKGAHFSLLNIMNELKKASNHPYLFDMAE 650
               S   +GA+ S+L ++  L++A  H  L  + E
Sbjct: 1232 MLESKQKQGAYSSILTLLLRLRQACLHSELVKIGE 1266

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 84/155 (54%), Gaps = 3/155 (1%)

Query: 674 SSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQR 731
           SS K+  L + L  L+ D   +  ++FSQ   MLD++   L   G    +L G++   QR
Sbjct: 627 SSTKIEALVEELYNLRSDKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQR 686

Query: 732 RISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQ 791
             +I +F   + +  VFL+S +AGG+ +NL  A  V I D  WNP  + Q+  R HRIGQ
Sbjct: 687 DQTIKYF-MENIHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQ 745

Query: 792 KNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
              V + RF  +D++E  ++E   KK  + +A I+
Sbjct: 746 FRPVKITRFCIEDSIESRIIELQEKKASMIHATIN 780

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 102/208 (49%), Gaps = 35/208 (16%)

Query: 357 LRDFQLTGINWMAFLWSKNDNG-ILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPL 415
           L  FQL G++W+      + NG +LADEMG+GKT+QT+A    L+ +     P LVV P 
Sbjct: 194 LLPFQLEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIA----LLMSDITRKPSLVVAPT 249

Query: 416 STMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEY 475
             +  W+   E+            N+K    +  G   TN     K     +V+LTTY  
Sbjct: 250 VALMQWKNEIEQHT----------NKKLSVYMYHGANRTNNLGDFKD---VDVILTTYAV 296

Query: 476 I-----------------LKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANR 518
           +                 +K+++ L +I +  + +DEAH +K+  S+  +++NS +   R
Sbjct: 297 LESVYRKQVYGFKRKAGTVKEKSLLHSINFYRVILDEAHNIKDRTSNTAKAVNSLQTKKR 356

Query: 519 LLITGTPLQNNIKELAALVNFLMPGRFT 546
             ++GTPLQN I E+ +L+ FL    FT
Sbjct: 357 WCLSGTPLQNRIGEMYSLIRFLNIEPFT 384

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 90/167 (53%), Gaps = 4/167 (2%)

Query: 662 MSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLNIKGITY 719
           +SR N ++G   SS K+  L + L +L+     V  ++FSQ   MLD++   L   G   
Sbjct: 646 VSRLN-MKGTWRSSTKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQT 704

Query: 720 QRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 779
            +L G++   QR  +I +F   +    VFL+S +AGG+ +NL  A  V I D  WNP  +
Sbjct: 705 VKLQGSMSPTQRDQTIKYF-MDNIECEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVE 763

Query: 780 LQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
            Q+  R HRIGQ   V + RF  +D++E  ++E   KK  + +A I+
Sbjct: 764 WQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQEKKANMIHATIN 810

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 105/223 (47%), Gaps = 43/223 (19%)

Query: 340 PRFE-KLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDN----GILADEMGLGKTVQTVA 394
           P++E     QP+ + G +L  FQL G++WM    S+ D+    G+LADEMG+GKT+QT+A
Sbjct: 208 PKYEPHRAPQPADM-GVKLLPFQLEGLHWM---LSQEDSIYNGGVLADEMGMGKTIQTIA 263

Query: 395 FISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFT 454
               L+   R   P LVV P   +  W+   E+        Y          I + +   
Sbjct: 264 ----LLMNDRSKKPSLVVAPTVALMQWKNEIEQHTNGALSTYIYHGASRTINIHDLK--- 316

Query: 455 NPQAKTKKHAKFNVLLTTYEYI-----------------LKDRAELGAIKWQFLAVDEAH 497
                       +V+LTTY  +                 +K+++ L  I +    +DEAH
Sbjct: 317 ----------DIDVILTTYSVLESVFRKQNYGFRRKNGLVKEKSLLHNIDFYRAILDEAH 366

Query: 498 RLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 540
            +K+  S+   ++N+ K   R  ++GTPLQN I E+ +L+ FL
Sbjct: 367 NIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRIGEMYSLIRFL 409

>Scas_591.10
          Length = 772

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 90/167 (53%), Gaps = 4/167 (2%)

Query: 662 MSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLNIKGITY 719
           +SR N ++G   SS K+  L + L +L+     +  ++FSQ   MLD++   L   G   
Sbjct: 588 VSRLN-MKGTWQSSTKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQT 646

Query: 720 QRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 779
            +L G++   QR  +I +F      + VFL+S +AGG+ +NL  A  V I D  WNP  +
Sbjct: 647 VKLQGSMSPTQRDETIKYFMNNIECE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVE 705

Query: 780 LQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
            Q+  R HRIGQ   V + RF  +D++E  ++E   KK  + +A I+
Sbjct: 706 WQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQEKKANMIHATIN 752

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 101/209 (48%), Gaps = 47/209 (22%)

Query: 356 ELRDFQLTGINWMA------FLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPH 409
           +L  FQL G++W+       F       G+LADEMG+GKT+QT+A +   +  R    P 
Sbjct: 165 KLLPFQLEGLHWLIQQEEGIF-----KGGVLADEMGMGKTIQTIALLMNDLTKR----PS 215

Query: 410 LVVVPLSTMPAWQ-ETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNV 468
           LVV P   +  W+ E  +     L    F G  K+ D               K  ++++V
Sbjct: 216 LVVAPTVALMQWKNEINQHTDGKLKVYMFHGTSKNID--------------IKTLSEYDV 261

Query: 469 LLTTYEY-----------------ILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLN 511
           +LTTY                   ++K+ + L  I++  + +DEAH +K+ +S+   ++N
Sbjct: 262 VLTTYAVLESVFRKQNYGFKRKHGVVKELSVLHNIEFYRVILDEAHNIKDRQSNTARAVN 321

Query: 512 SFKVANRLLITGTPLQNNIKELAALVNFL 540
           + K   R  +TGTPLQN I E+ +L+ FL
Sbjct: 322 NLKTQKRWCLTGTPLQNRIGEMYSLIRFL 350

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 90/167 (53%), Gaps = 4/167 (2%)

Query: 662 MSRENILRGLIMSSGKMVLLDQLLTRLKKDGHRV--LIFSQMVRMLDILGDYLNIKGITY 719
           +SR N + G   SS K+  L + L +L+ +   +  ++FSQ   MLD++   L   G   
Sbjct: 606 VSRLN-MSGKWQSSTKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQT 664

Query: 720 QRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 779
            +L G++   QR  +I +F      + VFL+S +AGG+ +NL  A  V I D  WNP  +
Sbjct: 665 VKLQGSMSPTQRDETIKYFMNNIQCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVE 723

Query: 780 LQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 826
            Q+  R HRIGQ   V + RF  +D++E  ++E   KK  + +A I+
Sbjct: 724 WQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQEKKANMIHATIN 770

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 101/213 (47%), Gaps = 43/213 (20%)

Query: 356 ELRDFQLTGINWMAFLWSKNDN----GILADEMGLGKTVQTVAFISWLIYARRQNGPHLV 411
           +L  FQL G++W   L S+ ++    G+LADEMG+GKT+QT+A    L+       P LV
Sbjct: 183 KLLPFQLEGLHW---LISQEESIYAGGVLADEMGMGKTIQTIA----LLMNDLTKSPSLV 235

Query: 412 VVPLSTMPAWQETFEKWAPDLNCIY-FVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLL 470
           V P   +  W+   E+       IY + G  ++ D               K    ++V+L
Sbjct: 236 VAPTVALMQWKNEIEQHTKGQLKIYIYHGASRTTD--------------IKDLQGYDVVL 281

Query: 471 TTYEYI-----------------LKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSF 513
           TTY  +                  K  + L  I +  + +DEAH +K+ +S+   ++N+ 
Sbjct: 282 TTYAVLESVFRKQNYGFRRKNGLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNL 341

Query: 514 KVANRLLITGTPLQNNIKELAALVNFLMPGRFT 546
           K   R  ++GTPLQN I E+ +L+ FL    FT
Sbjct: 342 KTQKRWCLSGTPLQNRIGEMYSLIRFLNINPFT 374

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 80/133 (60%), Gaps = 3/133 (2%)

Query: 694  RVLIFSQMVRMLDILGDYLN-IKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLST 752
            ++++FSQ     DIL  ++  +  ++Y R DGT+    R   I+ F   + N+ + L+S 
Sbjct: 1420 KLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYR-EKNERLLLISM 1478

Query: 753  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 812
            +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q+  V ++R + K+T+E+ ++E
Sbjct: 1479 KAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVE 1538

Query: 813  -RARKKMILEYAI 824
             + RK+ ++E A+
Sbjct: 1539 LQNRKRTLVENAM 1551

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 76/357 (21%), Positives = 141/357 (39%), Gaps = 73/357 (20%)

Query: 361  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMP 419
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A +     A      +LVV P++ + 
Sbjct: 900  QRQGLYWLLKTESSKFKGGLLADDMGLGKTVQAIALMLANRSADSTCKTNLVVGPVAVLR 959

Query: 420  AWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYI--- 476
             W +              V  Q     +  G F        K    ++V+L +Y+ +   
Sbjct: 960  VWHDEINTK---------VKKQAQFSVMIYGGFGGKKVENFKAMHNYDVVLVSYQTLAVE 1010

Query: 477  ------------------LKDRAELGAIK--------WQ----------FLAVDEAHRLK 500
                              L + A + A+         W            + +DEA  +K
Sbjct: 1011 FKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNIK 1070

Query: 501  NAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI--------- 551
            N ++   ++  +     R  ++GTP+QNNI EL +L+ FL    +  +Q+          
Sbjct: 1071 NKQTQAAKACCTLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNALL 1130

Query: 552  ----DFENQDAEQETYIRDLHSRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDV 602
                DF++ D ++   ++ +   L+  +LRR K           LP+K  R     L   
Sbjct: 1131 SRGGDFDSMDTKRA--LKKVRVLLRAIMLRRAKTSQINGQPILELPAKHIRKKEDILDGQ 1188

Query: 603  QTDYYKNI----LTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLA 655
              ++YK++      +  + L+     +  ++L ++  L++A  H  L  + + + + 
Sbjct: 1189 DLEFYKSLEHETAIQARALLNERKASSSSNILTLLLRLRQACCHQELVKLGKAKAIG 1245

>Kwal_14.1868
          Length = 1357

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 154/346 (44%), Gaps = 54/346 (15%)

Query: 357  LRDFQLTGINWMAFLWSKN-DNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPL 415
            L   Q  G++W+  +   N   G+LAD+MGLGKTVQ +A +            +L+V P+
Sbjct: 675  LMKHQRQGLHWLLTVEKSNRKGGLLADDMGLGKTVQAIALMLANKSGVENCKTNLIVAPV 734

Query: 416  STMPAWQ---ETFEKWAPDLNC-IYFVGN----QKSRDAIREGEFFTNPQ---AKTKKHA 464
            + +  WQ   +T  K    L   IY  GN    +  R  +R      + Q   ++ KKH 
Sbjct: 735  AVLRVWQAEVKTKVKKTSGLKVLIYGGGNGAKVENYRSLLRHDVVLVSYQTLASELKKHW 794

Query: 465  KFNVLLTTYEYILKDRAELGAI------------------KWQFLAVDEAHRLKNAESSL 506
               +   + E  + D  +L A+                  K+  + +DEA  +KN ++  
Sbjct: 795  PARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILDEAQNIKNKKTQS 854

Query: 507  YESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI-------------DF 553
             ++  +     R  ++GTP+QNNI EL +L+ FL    +  +Q+              D+
Sbjct: 855  AKACCTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKFKLDIGNPLGKATNDY 914

Query: 554  ENQDAEQETYIRDLHSRLQPFILRRLK--KDVEKSLPSKTERILRVE---LSDVQTDYYK 608
            ++ D +Q   I+ +   L+  +LRR K  K   K +    E+I+      L   +  +Y 
Sbjct: 915  DSHDRQQA--IKKVQVLLRAIMLRRTKDSKIDGKPILELPEKIITNREDVLQGAELQFYS 972

Query: 609  NILTKNYSA----LSAGSKGAHFSLLNIMNELKKASNHPYLFDMAE 650
            ++  KN       L+  +KG++ S+L ++  L++A  HP L  + E
Sbjct: 973  DLEAKNQKKVEKLLNNRAKGSYSSILTLLLRLRQACCHPELVIIGE 1018

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 2/131 (1%)

Query: 688  LKKDGHRVLIFSQMVRMLDILGDYLNIK-GITYQRLDGTVPSAQRRISIDHFNAPDSNDF 746
            LK    ++++FSQ     D+L  ++    G  Y R DG++ S  R  +I+ F        
Sbjct: 1190 LKSKTEKIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEEFYR-SLERR 1248

Query: 747  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 806
            + L+S +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q   V V+R + K++V
Sbjct: 1249 ILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQVHRLLVKNSV 1308

Query: 807  EEEVLERARKK 817
            E+ +LE  +KK
Sbjct: 1309 EDRILELQKKK 1319

>Scas_721.100
          Length = 1137

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 76/136 (55%), Gaps = 6/136 (4%)

Query: 692  GHRVLIFSQMVRMLDILGDYLNIKGIT----YQRLDGTVPSAQRRISIDHFNAPD-SNDF 746
            G +V+IFSQ    LDIL D L     T      + DG +   +R   +  F   D S   
Sbjct: 980  GEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLKERSTVLQDFQIKDLSRQK 1039

Query: 747  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 806
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V RF+ ++++
Sbjct: 1040 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHRIGQTNNVKVVRFIIENSI 1099

Query: 807  EEEVLE-RARKKMILE 821
            EE++L  + RK+ I E
Sbjct: 1100 EEKMLRIQERKRTIGE 1115

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 133/299 (44%), Gaps = 68/299 (22%)

Query: 378 GILADEMGLGKTVQTVAFISWLIYAR---------------RQNGPHL---------VVV 413
           GIL+DEMGLGKT+ T+A I    Y                 R+  PHL         +VV
Sbjct: 502 GILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIVV 561

Query: 414 PLSTMPAWQETFEKW--APDLNC-IYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLL 470
           P+S +  W   F K   + D+   IY+ GN  S   +            TK H    V++
Sbjct: 562 PMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLKKLL-----------TKTHNPPTVVI 610

Query: 471 TTYEYI----------------LKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFK 514
           TTY  +                ++  + L ++ +  + +DE H ++N  +   +++    
Sbjct: 611 TTYGIVQSEWSKIFKKQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLT 670

Query: 515 VANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDAEQETYIRDLH 568
              + ++TGTP+ N + +L +LV FL        G + +     FEN++ +Q   +  ++
Sbjct: 671 SKCKWVLTGTPIINRLDDLYSLVRFLKLEPWSQIGYWKMFVSTPFENKNFKQAFDV--VN 728

Query: 569 SRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTDYYKNILTKNYSALSAG 621
           + L+P +LRR K  KD++      LP K   + R++LS  Q   YK +L +   ++  G
Sbjct: 729 AILEPVLLRRTKQMKDIDGKPLVELPPKEVIVERLKLSKAQNAVYKYLLDRAEQSVILG 787

>Kwal_47.17771
          Length = 972

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 94/350 (26%), Positives = 153/350 (43%), Gaps = 82/350 (23%)

Query: 378 GILADEMGLGKTVQTVAFISWL----IYARRQ---------------------------N 406
           GILADEMGLGKT+  +A I  +     Y + +                           +
Sbjct: 336 GILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYAS 395

Query: 407 GPHLVVVPLSTMPAWQETFEKWAP--DLNC-IYFVGNQKSRDAIREGEFFTNPQAKTKKH 463
           G  LVVVP+S +  WQ+ FEK +   +  C IY+ GN  S  ++            TK  
Sbjct: 396 GTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKSLL-----------TKTK 444

Query: 464 AKFNVLLTTYEYIL--------------KDRAELGAIKWQFLAVDEAHRLKNAESSLYES 509
           +   VL+TTY  +                D + L ++++  + +DE H ++N  +    S
Sbjct: 445 SPPTVLITTYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRS 504

Query: 510 LNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFT-IDQEIDFENQDAEQETY---IR 565
           L   K     ++TGTP+ N + +L +LV F+    ++ I     F +   E++ Y     
Sbjct: 505 LMDLKSTRSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAFD 564

Query: 566 DLHSRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTDYYKNILTKNYSALS 619
            + S L+P ILRR K  +DV+      LP K   I +V  +  +   YK  L K  S++ 
Sbjct: 565 IVSSILEPVILRRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALYKYFLNKAESSVK 624

Query: 620 AG-SKG----AHFSLLNIMNELKKASNHPYLF--------DMAEDRVLAK 656
            G  +G     + ++L  +  L++   H  L         D+AE+R+LA+
Sbjct: 625 EGLDRGDLLKKYSTILVHILRLRQVCCHADLLGSQDENDEDIAENRLLAE 674

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 10/161 (6%)

Query: 674 SSGKMVLLDQLLTRLKK-----DGHRVLIFSQMVRMLDIL----GDYLNIKGITYQRLDG 724
           +S K   +  L+T LK+      G ++++FSQ    LDI+        +       + DG
Sbjct: 792 NSSKSSKIQSLITSLKRLQDACPGEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDG 851

Query: 725 TVPSAQRRISIDHFNAPDSNDF-VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAM 783
            +   +R   +  F   D     + LLS +AGG+G+NL  A    + D  W+P  + QA+
Sbjct: 852 RLSMKERSKVLQDFAVKDMTRLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAI 911

Query: 784 ARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
            R HRIGQ N+V V RF+ + ++EE++L    +K  L  A+
Sbjct: 912 DRIHRIGQVNNVKVVRFIIEHSIEEKMLRIQERKRTLGEAV 952

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 73/138 (52%), Gaps = 5/138 (3%)

Query: 692  GHRVLIFSQMVRMLDILGDYLN----IKGITYQRLDGTVPSAQRRISIDHFNAPD-SNDF 746
            G +V++FSQ    LDIL   LN       +   + DG +   +R   ++ F   D +   
Sbjct: 993  GEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLKERTAVLEDFKVKDYAVQK 1052

Query: 747  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 806
            V LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V RFV   ++
Sbjct: 1053 VLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNSVKVIRFVIDGSI 1112

Query: 807  EEEVLERARKKMILEYAI 824
            EE++L    +K  L  A+
Sbjct: 1113 EEKMLRIQDRKRTLGEAM 1130

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 130/306 (42%), Gaps = 73/306 (23%)

Query: 376 DNGILADEMGLGKTVQTVAFI-----------SWLIYARRQN------------------ 406
           + GIL+DEMGLGKT+  ++ +             L +    N                  
Sbjct: 507 NGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAY 566

Query: 407 GPHLVVVPLSTMPAWQETFEKWAPD--LNC-IYFVGNQKSRDAIREGEFFTNPQAKTKKH 463
              L++VP+S +  W++ F+K   +  L C +Y+ GN  S  ++             K+ 
Sbjct: 567 KTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLL-----------IKRK 615

Query: 464 AKFNVLLTTYEYILKDRAELG----------------AIKWQFLAVDEAHRLKNAESSLY 507
               V+LTTY  +  +  +L                 +I++  + +DE H ++N  +   
Sbjct: 616 NPPTVVLTTYGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITS 675

Query: 508 ESLNSFKVANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDAEQE 561
           +++       R ++TGTP+ N + +L +LV FL        G +       FE ++ +Q 
Sbjct: 676 KAVLELSSKYRWILTGTPIINRLDDLYSLVKFLKLEPWSQIGYWKQFITNPFEERNFKQA 735

Query: 562 TYIRDLHSRLQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTDYYKNILTKNY 615
             +  +++ ++P +LRR K  KD + +    LP K   I +++LS  Q   Y+  L +  
Sbjct: 736 FDV--VNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFLQRAE 793

Query: 616 SALSAG 621
               +G
Sbjct: 794 KTFRSG 799

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 82/157 (52%), Gaps = 6/157 (3%)

Query: 674  SSGKMVLLDQL-LTRLKKDGHRVLIFSQMVRMLDILGDYLN---IKGIT-YQRLDGTVPS 728
            SS    LL +L L +    G +V+IFSQ    LDIL   L     K +    + DG +  
Sbjct: 993  SSKITALLKELQLLQDSSAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSL 1052

Query: 729  AQRRISIDHFNAPD-SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 787
             +R   +  F   D S   + LLS +AGG+G+NL  A    + D  W+P  + QA+ R H
Sbjct: 1053 KERTSVLADFAVKDYSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLH 1112

Query: 788  RIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
            RIGQ N V V RF+ +D++EE++L    KK  +  A+
Sbjct: 1113 RIGQTNSVKVMRFIIQDSIEEKMLRIQEKKRTIGEAM 1149

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 142/333 (42%), Gaps = 76/333 (22%)

Query: 378 GILADEMGLGKTVQTVAFISWLIY---------------ARRQNGPH------------- 409
           GIL+DEMGLGKTV   + +    +               A   N P              
Sbjct: 528 GILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASKT 587

Query: 410 -LVVVPLSTMPAWQETFEKW--APDL-NCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAK 465
            L+VVP+S +  W   F K   +PD+ + +Y+ GN  S                TK    
Sbjct: 588 TLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVSSLKT-----------LLTKTKTP 636

Query: 466 FNVLLTTYEYILKD----------------RAELGAIKWQFLAVDEAHRLKNAESSLYES 509
             V+LTTY  +  +                 + L ++ +  + +DE H ++N  +   ++
Sbjct: 637 PTVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKA 696

Query: 510 LNSFKVANRLLITGTPLQNNIKELAALVNFLM--PGRFTIDQEIDFENQDAEQETYIRD- 566
           + + +   + ++TGTP+ N + +L +LV FL   P R  I+    F +   E + Y +  
Sbjct: 697 VMALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWR-QINYWKTFVSTPFESKNYKQAF 755

Query: 567 --LHSRLQPFILRRLKKDVEK------SLPSKTERILRVELSDVQTDYYKNILTKNYSAL 618
             +++ L+P +LRR K+  +K       LP K   I R+  S  Q   YK +L K   ++
Sbjct: 756 DVVNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLYKFLLDKAEVSV 815

Query: 619 SAG-SKG----AHFSLLNIMNELKKASNHPYLF 646
            +G ++G     + ++L  +  L++   HP L 
Sbjct: 816 KSGIARGDLLKKYSTILVHILRLRQVCCHPGLI 848

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 85/176 (48%), Gaps = 7/176 (3%)

Query: 649  AEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDG--HRVLIFSQMVRMLD 706
             E R L K  D     E +       S K+V L + L  L+      +V++FSQ    LD
Sbjct: 883  VESRYLLKLEDINGKLEPVPYSNTKKSSKIVALIRHLKHLQDTSANEQVVVFSQFSSYLD 942

Query: 707  ILGDYLNIKGIT----YQRLDGTVPSAQRRISIDHFNAPDSNDF-VFLLSTRAGGLGINL 761
            IL + L     +      + DG +   +R   +  F         V LLS +AGG+G+NL
Sbjct: 943  ILENELRQSFASDICEIYKFDGRLDLKERSNVLAKFTEKSLVKMKVLLLSLKAGGVGLNL 1002

Query: 762  MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 817
              A    I D  W+P  + QAM R HRIGQ N V +YRF+ ++++EE++L    KK
Sbjct: 1003 TCASHAFIMDPWWSPGMEDQAMDRIHRIGQSNTVKIYRFIVENSIEEKMLRIQEKK 1058

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 126/291 (43%), Gaps = 69/291 (23%)

Query: 378 GILADEMGLGKTVQTVAFISW-------LIYARRQNGP--------------------HL 410
           GILADEMGLGKT+  +A I+        L+   ++  P                     L
Sbjct: 456 GILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTTL 515

Query: 411 VVVPLSTMPAWQETFEKW--APDLNC-IYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFN 467
           +VVP+S +P W+  F +      L C +Y+ GN  +   +             K+ +  +
Sbjct: 516 IVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLL-----------VKQKSPPS 564

Query: 468 VLLTTYEYILKDRAEL----------GAIKWQF--LAVDEAHRLKNAESSLYESLNSFKV 515
           V+LTTY  +  + ++L          G    +F  + +DE H ++N  +   +++ +   
Sbjct: 565 VVLTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALTS 624

Query: 516 ANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQ--- 572
             + ++TGTP+ N + +L +L+ F+    F    +ID+  Q        +D  S L+   
Sbjct: 625 RRKWVLTGTPIMNRLDDLFSLIKFM---NFEPWCKIDYWRQFVSDPFEKKDYSSALEVIQ 681

Query: 573 ----PFILRRLK--KDVEKS----LPSKTERILRVELSDVQTDYYKNILTK 613
               P +LRR K  KD + +    LP K   I  +  SD +   YK  L+K
Sbjct: 682 AVMGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSK 732

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 153/355 (43%), Gaps = 72/355 (20%)

Query: 361  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMP 419
            Q  G+ W+     SK   G+LAD+MGLGKTVQ +A +     +      +L+V P+S + 
Sbjct: 737  QRLGLQWLLNAETSKRKGGLLADDMGLGKTVQAIALMLANRSSNESKKTNLIVAPVSVLR 796

Query: 420  AWQ---ETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYI 476
             W+   ET  K + D N   + G    +   R  +  +N          F+V+L +Y+ +
Sbjct: 797  VWKGEIETKIKESSDFNSAIYGGVNGIK--FRSWDKLSN----------FDVILVSYQTL 844

Query: 477  ---------------------LKDRAELGAIK-----WQ----------FLAVDEAHRLK 500
                                 + D   + ++K     W            + +DE   +K
Sbjct: 845  ANELKKHWPERLKTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIK 904

Query: 501  NAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MP-----GRFTIDQEIDF- 553
            N ++   ++  +     R +++GTP+QNN++EL +L+ FL +P      RF  D    F 
Sbjct: 905  NMKTQAAKACCTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIGRPFS 964

Query: 554  ---ENQDAE-QETYIRDLHSRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQT 604
               +N D+E ++  I+ +   L+  +LRR K D         LP K          D + 
Sbjct: 965  NLKQNYDSESRKQAIKKVRVLLRAIMLRRSKTDKIDGVPILELPPKNVNAQETTFKDDEL 1024

Query: 605  DYYKNILTKNYS----ALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLA 655
            ++YK +  KN       L +  +G + S+L ++  L++A  HP L  + E +  A
Sbjct: 1025 EFYKALEHKNKQLAKKLLESKVQGNYSSVLTLLLRLRQACCHPELVILGEKKAEA 1079

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 2/125 (1%)

Query: 689  KKDGHRVLIFSQMVRMLDILGDYLNIK-GITYQRLDGTVPSAQRRISIDHFNAPDSNDFV 747
            K D  +++IFSQ    LD+L   L  +  I+  +  G + +  R   I  F + + +  V
Sbjct: 1247 KSDSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYS-EEDKRV 1305

Query: 748  FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVE 807
             L+S +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V+R   K++VE
Sbjct: 1306 LLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVE 1365

Query: 808  EEVLE 812
            + +LE
Sbjct: 1366 DRILE 1370

>Scas_674.12d
          Length = 1323

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 2/128 (1%)

Query: 691  DGHRVLIFSQMVRMLDILGDYL-NIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFL 749
            D  +++IFSQ     DI   +L  +  + Y +  G + + QR   I  F    +N+ + L
Sbjct: 1164 DTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKF-YRQANERILL 1222

Query: 750  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE 809
            +S +AG  G+ L  A+ VII D  WNP  + QA  R +RI Q   V V+R   KD+VE+ 
Sbjct: 1223 ISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLFIKDSVEDR 1282

Query: 810  VLERARKK 817
            + E   KK
Sbjct: 1283 IAELQEKK 1290

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 147/350 (42%), Gaps = 74/350 (21%)

Query: 361 QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMP 419
           Q  G++W+  +  SK   G+LAD+MGLGKTVQ +A +       +    +L+V P++ + 
Sbjct: 654 QKIGLHWLLNVEASKKKGGLLADDMGLGKTVQGIALMLANRSKDQACKTNLIVAPVAVLR 713

Query: 420 AWQ---ETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYI 476
            W    ET  K   + +   + G  K               A  K+ ++++ ++ +Y  +
Sbjct: 714 VWGGELETKIKKEANFSAFIYGGGDK--------------LATWKELSEYDAIMVSYPTL 759

Query: 477 L------------KDRAELGAI------------------------KWQFLAVDEAHRLK 500
                        KD+ +L AI                         +  + +DE   +K
Sbjct: 760 AIEFKKHWPASLGKDQKQLPAIPQLAAMNSLKKKDEYFSPFFCNESTFYRIILDEGQNIK 819

Query: 501 NAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MPG-----RFTIDQEIDFE 554
           N ++   ++  S     R + +GTP+QN++ EL +L+ FL +P      RF  D    F 
Sbjct: 820 NKKTRAAKACCSLDATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIGRPFL 879

Query: 555 NQ-----DAEQETYIRDLHSRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQT 604
            +     D +++  I+ +   L   +LRR K D+        LP K   I    L   + 
Sbjct: 880 RKNGNYDDFDRKQAIKKVQVLLSAIMLRRSKSDMIDGKPLLELPPKQIEIDSAALEGDEL 939

Query: 605 DYYKNILTKNYS----ALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAE 650
           ++Y ++  KN       L   +KG + S+L ++  L++A  H  L  + E
Sbjct: 940 EFYTDLEAKNRKLAERLLKRKAKGNYSSVLTLLLRLRQACVHSELVLIGE 989

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 131/292 (44%), Gaps = 69/292 (23%)

Query: 378 GILADEMGLGKTVQTVAFISWLI--------------------YARRQNGPH-----LVV 412
           G+LADEMGLGKT+ T+A IS +                     Y  + + P+     L+V
Sbjct: 496 GLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLIV 555

Query: 413 VPLSTMPAWQETFEKWA--PDLNC-IYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVL 469
           VP+S +  WQ+ FEK    P+ +C IY+ G        R G   T     TK      ++
Sbjct: 556 VPMSLLFQWQKEFEKANNNPNAHCEIYYGG--------RAGNLIT---LLTKTKNPPTII 604

Query: 470 LTTYEYI--------------LKDRAELGAIKWQF--LAVDEAHRLKNAESSLYESLNSF 513
           LT+Y  I              ++  A +G    +F  + +DE H ++N  +   +++   
Sbjct: 605 LTSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAVMDL 664

Query: 514 KVANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDAEQETYIRDL 567
             + + ++TGTP+ N + +L +LV F+        G +       FE ++ +Q   +  +
Sbjct: 665 SSSRKWVLTGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYKQAFDV--V 722

Query: 568 HSRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTDYYKNILTK 613
            S L+P +LRR K  KD+      +LP K   I +V+ +  +   YK  L K
Sbjct: 723 SSVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILYKFFLNK 774

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 84/157 (53%), Gaps = 7/157 (4%)

Query: 675  SGKMVLLDQLLTRLKKD--GHRVLIFSQMVRMLDILGDYLNIK----GITYQRLDGTVPS 728
            S K+  L + L +L++   G +V++FSQ    LDIL + L            + DG +  
Sbjct: 951  SSKICSLLKHLKQLQETCPGEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNL 1010

Query: 729  AQRRISIDHF-NAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 787
              R   +D F     S   + LLS +AGG+G+NL  A    + D  W+P  + QA+ R H
Sbjct: 1011 KDRSRVLDTFATKDLSKLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVH 1070

Query: 788  RIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
            RIGQ+++V + RF+ ++++EE++L    +K  L  A+
Sbjct: 1071 RIGQESNVKIIRFIMENSIEEKMLSIQDRKRTLGEAV 1107

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 75/134 (55%), Gaps = 6/134 (4%)

Query: 692  GHRVLIFSQMVRMLDILG----DYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDF- 746
            G ++++FSQ    LDIL      +L    +   + DG +   +R   ++ F+  D +   
Sbjct: 957  GEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDMKERTRILEQFHDKDLSCIK 1016

Query: 747  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 806
            + LLS + GG+G+NL  A    + D  W+P  + QA+ R HRIGQ+  V V RF+  ++V
Sbjct: 1017 LLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIHRIGQQQTVKVVRFIIDNSV 1076

Query: 807  EEEVLE-RARKKMI 819
            EE++L  + RK+M+
Sbjct: 1077 EEKMLRIQERKRML 1090

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 136/305 (44%), Gaps = 70/305 (22%)

Query: 376 DNGILADEMGLGKTVQTVAFISWLIY---------------------------ARRQNGP 408
           + GILADEMGLGKT+  +A I    Y                            R     
Sbjct: 478 NGGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHK 537

Query: 409 H--------LVVVPLSTMPAWQETFEKWAPDLN--C-IYFVGNQKSRDAIREGEFFTNPQ 457
           H        L+VVP+S +  WQ  FEK   DL   C IY+  N K   A     +   P 
Sbjct: 538 HDTYAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGNNIKDLRA-----YVLGPN 592

Query: 458 AKTKKHAKFNVLLTTY-----EYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNS 512
           A +       V++TTY     EY     + L  + +  + +DE H ++N  +   +++ +
Sbjct: 593 APS-------VIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIA 645

Query: 513 FKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQ------EIDFENQDAEQETYIRD 566
            + + + ++TGTP+ N + +L +LV FL    ++          + FE  +  Q   +  
Sbjct: 646 LRSSRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQAFDV-- 703

Query: 567 LHSRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTDYYKNILTKNYSALSA 620
           +++ L+P +LRR K  KDV+     SLP K   + +++LS  +   Y+++L    +++  
Sbjct: 704 INAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLEDAENSVKE 763

Query: 621 G-SKG 624
           G +KG
Sbjct: 764 GLAKG 768

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 74/133 (55%), Gaps = 3/133 (2%)

Query: 694  RVLIFSQMVRMLDILGDYLNIK-GITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLST 752
            +++IFSQ     +IL  +L  K    Y +  G++ +AQRR  + +    D    + L+S 
Sbjct: 1463 KIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSM-NAQRRSDVINEFYRDPEKRILLISM 1521

Query: 753  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 812
            +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V++   KD+VE+ + E
Sbjct: 1522 KAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQVHKLFIKDSVEDRISE 1581

Query: 813  -RARKKMILEYAI 824
             + RKK +++ A+
Sbjct: 1582 LQKRKKEMVDSAM 1594

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 88/367 (23%), Positives = 156/367 (42%), Gaps = 66/367 (17%)

Query: 361  QLTGINWMAFLW-SKNDNGILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMP 419
            Q  G++W+  +  S    G+LAD+MGLGKT+Q +A +        +   +L+V P+S + 
Sbjct: 947  QRLGLHWLLQVENSAKKGGLLADDMGLGKTIQAIALMLANRSEESKCKTNLIVAPVSVLR 1006

Query: 420  AWQ---ETFEKWAPDLNCIYFVGNQKS-----RDAIREGEFFTNPQA---KTKKH----- 463
             W+   ET  K         F G+        RD  R      + Q    + KKH     
Sbjct: 1007 VWKGELETKVKKRAKFTTFIFGGSGNGKVKHWRDLARYDAVLVSYQTLANEFKKHWPKKL 1066

Query: 464  -------------AKFNVLLTTYEY----ILKDRAELGAIKWQFLAVDEAHRLKNAESSL 506
                            N L T+ EY       D        +  + +DE   +KN  +  
Sbjct: 1067 DGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDST------FYRILLDEGQNIKNKNTRA 1120

Query: 507  YESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MP-----GRFTID--------QEID 552
             ++  +     R +++GTP+QN++ EL +L+ FL +P      RF +D        ++  
Sbjct: 1121 SKACCTINGMYRWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQRFKLDIGRFFQRNKQYQ 1180

Query: 553  FENQDAEQETYIRDLHSRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTDYY 607
            ++N+D  ++  +R +   L   +LRR K D         LP K   +    L   +  +Y
Sbjct: 1181 YDNED--RKNALRKVRVLLNAIMLRRSKADKIDGKPLLELPPKIVEVDESRLKGEELKFY 1238

Query: 608  KNILTKNYS----ALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLA-KFGDGRM 662
              + +KN +     L+  ++G++ S+L ++  L++A  H  L  M E +    K  +G+ 
Sbjct: 1239 TALESKNQALAKKLLNNSTRGSYSSVLTLLLRLRQACCHSELVVMGEKKAEGTKVANGKS 1298

Query: 663  SRENILR 669
              ++ LR
Sbjct: 1299 FEDDWLR 1305

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (51%), Gaps = 6/130 (4%)

Query: 691  DGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLL 750
            D  +V+++SQ    L ++G  L +  I  + L     +A    +I++F    S     LL
Sbjct: 1378 DPPQVILYSQKTEYLKVIGKVLKLYHI--EHLACLSNTANVGETINNFKRQPSVT-CLLL 1434

Query: 751  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 810
            + +  G G+NL+ A  + + D   N   +LQAM R +RIGQ     V+ F+ ++TVEE +
Sbjct: 1435 NVKTLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEENI 1494

Query: 811  LERARKKMIL 820
            L   R K IL
Sbjct: 1495 L---RYKCIL 1501

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 109/283 (38%), Gaps = 59/283 (20%)

Query: 378 GILADEMGLGKTVQTVAFISWLIYARRQNGPHLVVV-----------------PLSTMPA 420
           G+LA+EMGLGKT++ ++ I  L+  R+        +                 P + +  
Sbjct: 387 GVLAEEMGLGKTIEILSLI--LLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQ 444

Query: 421 WQETFEKWAPDLNCIYFVG-NQKSRDAIREGEFFT------------NPQAKTKKHAKFN 467
           W E  E  A  L    + G N+  +D     E               N  A    HA+FN
Sbjct: 445 WLEEIELHANSLKWYTYRGYNEIMKDCKTVDEAVQQLCQYDIIVTSYNIIATEVHHAEFN 504

Query: 468 VLLTT-------YEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLL 520
             + +       Y+Y     + L  +++  + +DE   L+++ +   +  +     +   
Sbjct: 505 RSIRSRRLKSPKYDY----SSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIHTWG 560

Query: 521 ITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYIRDLHSRLQPFILRRLK 580
           ++GTP+Q NI     ++++L    F    E+DF          IR L   ++   LR   
Sbjct: 561 VSGTPIQ-NIYNFRMIMSYLKLHPFC--DEVDF----------IRTLQEEIK---LRNEA 604

Query: 581 KDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSK 623
           KD   +      + +R  + D    +Y+  L   +S  +  S+
Sbjct: 605 KDYTSNDFVCQLKGVRFSIKDCMNIFYRYDLCIRHSKANVASQ 647

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 71/139 (51%), Gaps = 11/139 (7%)

Query: 687  RLKKDGHR----VLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742
             L+K+ H+    ++IFS     L IL   L    +T+ R       A+   ++D F   D
Sbjct: 1342 HLEKEPHKKNPQIVIFSSHSAFLSILSTLLTAHNVTHARPLRNTKFAK---AVDTFRK-D 1397

Query: 743  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802
             N    LL+  +   G+ L+ A  +I+ +   +   + QA++R HRIGQK+   V+ F+ 
Sbjct: 1398 PNCTCLLLNVHSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMV 1457

Query: 803  KDTVEEEVLERARKKMILE 821
            ++TVEE ++   + K +LE
Sbjct: 1458 RNTVEESIM---KYKAVLE 1473

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 52/116 (44%), Gaps = 24/116 (20%)

Query: 378 GILADEMGLGKTVQTVAFISWLIY----------------ARRQNGPHLVVVPLSTMPAW 421
           G+LADEMGLGKT++ +  IS  +                   R+   +L+V P S +  W
Sbjct: 353 GVLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESILQQW 412

Query: 422 QETFE----KWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTY 473
            +  +    K   D    ++ G +K+R+         +P    +  ++++V++ +Y
Sbjct: 413 IDEIDLHINKKVSDFKVFHYEGFEKTRNKFNTD----SPAEIVELMSQYDVVICSY 464

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 67/131 (51%), Gaps = 12/131 (9%)

Query: 694  RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNA---PDSNDFVFLL 750
            ++L++SQ    + ++   L++  I        +   Q   ++    A     S+    LL
Sbjct: 1299 QILMYSQSFDFMKVVSQVLSLHNI------NNICCLQNNRNVGDMIARFKKTSDITCLLL 1352

Query: 751  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 810
            + R+ G G+NL+ A  + + D   N   ++QAM+R +RIGQ+    V+ F+ ++TVEE +
Sbjct: 1353 NIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVEESI 1412

Query: 811  LERARKKMILE 821
            +   R K +LE
Sbjct: 1413 M---RYKCVLE 1420

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 53/117 (45%), Gaps = 24/117 (20%)

Query: 378 GILADEMGLGKTVQTVAFISWLIYARR------------------QNGPHLVVVPLSTMP 419
           G+LA+EMGLGKT++ +A I   I  R+                  +    L+V P S + 
Sbjct: 352 GVLAEEMGLGKTLEILALIC--INKRKYKADEPLDFVSESGKVISKCSTTLIVCPGSILK 409

Query: 420 AWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYI 476
            W +  +   P +   ++ G      A+++     N     +K +++++++T+Y  +
Sbjct: 410 QWIDEMQSTHPAIKIYHYGG----FIAVKKEFACDNINTIVQKLSQYDIVITSYNVV 462

>Scas_573.9
          Length = 1502

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 694  RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTR 753
            ++L++SQ    L +LG  L    I +        +  ++I+   F +  SN    LL+ +
Sbjct: 1333 QILLYSQSANFLKVLGKILTKNDIEHLTCLSNSSTIGKKIA--RFKS-QSNITCLLLNVK 1389

Query: 754  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 812
              G G+NL+ A  + + D   N   +LQAM R +RIGQK    V+  +  ++VEE + +
Sbjct: 1390 TLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVEENIFK 1448

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 56/116 (48%), Gaps = 24/116 (20%)

Query: 378 GILADEMGLGKTVQTVAFISWLIYAR----------------RQNGPHLVVVPLSTMPAW 421
           G+L++EMGLGKT++ +A I  ++  R                R+    L+V P + +  W
Sbjct: 371 GLLSEEMGLGKTIEVLALI--MLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQW 428

Query: 422 QETFEKWAPDLNCIYFVGNQKSRDAIREGEFFT-NPQAKTKKHAKFNVLLTTYEYI 476
                    +L   +++G+  +R      +F T N Q    + +++++++T+Y+ +
Sbjct: 429 INETNAHTENLKIFHYMGSLATR-----IQFDTDNIQEILDRLSEYDIIITSYDIV 479

>Kwal_14.1287
          Length = 1518

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 53/122 (43%), Gaps = 17/122 (13%)

Query: 719  YQRLDGTVPSAQRRISIDHFNAPDSNDF--------------VFLLSTRAGGLGINLMTA 764
            Y    G +    ++ SI H N   S  F                LL+      G+ L+ A
Sbjct: 1339 YSEFLGLLSKVLKQHSIQHCNTAGSGKFSKIVEKFKKNPEVTCLLLNVTRQATGLTLVNA 1398

Query: 765  DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824
              V I D   N   +LQA+ R HRIGQ     V+ FV ++TVE+ ++   R K +LE  I
Sbjct: 1399 THVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIV---RLKGVLEERI 1455

Query: 825  IS 826
             S
Sbjct: 1456 AS 1457

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 35/134 (26%)

Query: 374 KNDNGILADEMGLGKTVQTVAFISWLIYARRQNGP----------------HLVVVPLST 417
           K+  G+L++EMGLGKT++ +A +  L++ R  NG                 +L+V P S 
Sbjct: 351 KHAKGVLSEEMGLGKTLEILALM--LVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSI 408

Query: 418 MPAWQETFEKWAP------DLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLT 471
           +  W +  E           +N  ++ G Q+ +       F T   A    H      L+
Sbjct: 409 LQQWIDEVEAHVVSEASHRSMNIFHYRGYQEVKK-----HFDTEDIAAIVSH------LS 457

Query: 472 TYEYILKDRAELGA 485
           TY+ IL   A + +
Sbjct: 458 TYDIILCSYATVSS 471

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 62/128 (48%), Gaps = 6/128 (4%)

Query: 694  RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTR 753
            +++I+SQ   +L+I+   L    I +      V +  +   ++ F A D      LL T+
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNSIKFLTTTKNVRNFAK--VVETFKA-DPEITCLLLDTK 1415

Query: 754  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 813
                G+ L+ A  V + +   N   + QA+ R HRIGQ +   V+ F+  +TVE  +L  
Sbjct: 1416 RQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL-- 1473

Query: 814  ARKKMILE 821
             R K ILE
Sbjct: 1474 -RYKSILE 1480

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 337 SERPRFEKLVEQPSFIKGGELRDFQLT---------GINWMAFLWSKND-NGILADEMGL 386
           S R   E L +  + I+G EL   +LT         G++W+  +   N   G+LAD+MGL
Sbjct: 856 SLRNLLEGLKQHETEIEGEELTPEELTVNLLKHQRRGLHWLLNVEKSNKRGGLLADDMGL 915

Query: 387 GKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPAWQ---ETFEKWAPDLNCIYFVGNQK 442
           GKTVQ +A +            +L+V P++ +  WQ   +T  K         + GN K
Sbjct: 916 GKTVQAIALMIANRSELESCKTNLIVAPVAVLRVWQAEIQTKIKKNATFKAFIYGGNNK 974

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 17/102 (16%)

Query: 734  SIDHFNAP--------------DSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 779
            SI HFN                DS+    L++ +    G+ L  A  VI+ +     +  
Sbjct: 1324 SISHFNTEFGQDLAKEAELFKRDSSITCLLMNPKWCSRGLKLTNATHVILMEPMSEGRIQ 1383

Query: 780  LQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 821
             QA+ R HRIGQ     V+  ++++T EE  L   + +M+LE
Sbjct: 1384 EQAVERIHRIGQGKDTFVWHLMTRNTAEESTL---KYRMLLE 1422

>ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C
           (DBP1) - SH] (225070..226941) [1872 bp, 623 aa]
          Length = 623

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 12/178 (6%)

Query: 647 DMAEDRVLAKFGDGRMSRENILRGLIMSSG---KMVLLDQLLTRLKKDGHRVLIFSQMVR 703
           D  +D +    G    + ENI + ++       + VLLD L      DG   L+F +  R
Sbjct: 357 DFLKDYIFLSVGRVGSTSENITQKVLHVEDIDKRSVLLDLLAA---SDGGLTLVFVETKR 413

Query: 704 MLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMT 763
           M D L D+L ++ ++   + G    A+R  ++  F    +N    L++T     G+++  
Sbjct: 414 MADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRAN---VLVATAVAARGLDIPN 470

Query: 764 ADTVIIFDSDWNPQADLQAMARAHRIGQKN-HVMVYRFVSKDTVEE--EVLERARKKM 818
              VI +D   +    +  + R  R G        +   +K+ V+E  ++LE A +++
Sbjct: 471 VTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFNRGNKNVVKELVDILEEANQEV 528

>CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces
           cerevisiae YKR024c DBP7 RNA helicase, start by
           similarity
          Length = 715

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 6/111 (5%)

Query: 692 GHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDS----NDFV 747
           G  V + S+  ++L  + D   + GI   +L G++    R +++ HF A DS       +
Sbjct: 439 GDSVRVLSKGNKILPSIKDE-ELPGIICYKLHGSLSQQMRTMTLKHF-ATDSEQTKGKHL 496

Query: 748 FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVY 798
            L  T     G++L    TVI FD  +  +  L  + R  R G+    +++
Sbjct: 497 ILFCTDVASRGLDLPDVSTVIEFDPPFAVEDHLHRIGRTARAGRSGEALLF 547

>KLLA0A05203g complement(462167..463474) highly similar to sp|P38719
           Saccharomyces cerevisiae YHR169w DBP8, start by
           similarity
          Length = 435

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 58/140 (41%), Gaps = 7/140 (5%)

Query: 681 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNA 740
           L Q+LT  K      +IF       +IL   L    +    L   +P  +R  S+  F A
Sbjct: 245 LYQILTSEKYVKSSCIIFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRA 304

Query: 741 PDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRF 800
             +     L++T     G+++   + V+ +D   NP   +    R  R G+    +   F
Sbjct: 305 QAAR---VLIATDVASRGLDIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHGESLC--F 359

Query: 801 VSKDTVE--EEVLERARKKM 818
           V++  ++  E + ER  KKM
Sbjct: 360 VTEKDIQRVEAIEERINKKM 379

>KLLA0F10505g complement(966736..969174) some similarities with
           sp|P21372 Saccharomyces cerevisiae YBR237w PRP5 pre-mRNA
           processing RNA-helicase, hypothetical start
          Length = 812

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 8/128 (6%)

Query: 680 LLDQLLTRL---KKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISID 736
           LL +L  RL   + +  + +IF    ++ D+L D L + GIT   +    PSA+R  ++ 
Sbjct: 485 LLKRLSDRLALHRGEDEKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQ 544

Query: 737 HFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVM 796
            F   D+     L+ T     G+N+     VII+++       +  + R  R G  N V 
Sbjct: 545 KFKETDNG---ILICTEVLSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGR-GTNNGVA 600

Query: 797 VYRFVSKD 804
           +  FV  D
Sbjct: 601 L-SFVMVD 607

>Kwal_56.24760
          Length = 433

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 57/140 (40%), Gaps = 7/140 (5%)

Query: 681 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNA 740
           L Q+LT         +IF       +IL   L    +    L   +P  +R  S+  F A
Sbjct: 244 LYQILTSAAYIDSSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRA 303

Query: 741 PDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRF 800
              N    L++T     G+++ T   V+ +D   NP   +    R  R G+K   +   F
Sbjct: 304 ---NAARVLIATDVASRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESIC--F 358

Query: 801 VSKDTVE--EEVLERARKKM 818
           V++  V   + + ER  KKM
Sbjct: 359 VAQRDVSRIQAIEERINKKM 378

>Sklu_2273.4 YHR169W, Contig c2273 4981-6288
          Length = 435

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 54/138 (39%), Gaps = 3/138 (2%)

Query: 681 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNA 740
           L Q+LT    +    +IF       +IL   L    +    L   +P  +R  S+  F A
Sbjct: 247 LYQILTSEDYENSSAIIFVNRTVTAEILRRTLKGLDVRVASLHSQMPQQERTNSLHRFRA 306

Query: 741 PDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRF 800
              N    L++T     G+++ +   V+ +D   NP   +    R  R G+    + +  
Sbjct: 307 ---NAARVLIATDVASRGLDIPSVALVVNYDIPANPDTFIHRAGRTARAGRSGESICFVT 363

Query: 801 VSKDTVEEEVLERARKKM 818
               T  E + ER  KKM
Sbjct: 364 QRDITRIESIEERINKKM 381

>YHR169W (DBP8) [2456] chr8 (442180..443475) Essential nucleolar RNA
           helicase required for biogenesis of 40S ribosomal
           subunits [1296 bp, 431 aa]
          Length = 431

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 681 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNA 740
           L QLLT  + +    +IF       +IL   L    +    L   +P  +R  S+  F A
Sbjct: 243 LYQLLTCEEYENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRA 302

Query: 741 PDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQ---AMARAHRIGQKNHVMV 797
              N    L++T     G+++ T + V+ +D   +P   +      ARA RIG     + 
Sbjct: 303 ---NAARILIATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVT 359

Query: 798 YRFVSKDTVEEEVLERARKKM 818
            R VS+    + + +R  KKM
Sbjct: 360 QRDVSRI---QAIEDRINKKM 377

>CAGL0L02915g complement(340834..342687) highly similar to sp|P06634
           Saccharomyces cerevisiae YOR204w DED1 ATP-dependent RNA
           helicase, start by similarity
          Length = 617

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 75/180 (41%), Gaps = 16/180 (8%)

Query: 647 DMAEDRVLAKFGDGRMSRENILRGLIMSSGK---MVLLDQLLTRLKKDGHRVLIFSQMVR 703
           D   D +    G    + ENI + ++    +     LLD L      + +  LIF +  R
Sbjct: 357 DFLHDYIFLSVGRVGSTSENITQRILYVENRDKNSALLDLLAA---SNDNLTLIFVETKR 413

Query: 704 MLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMT 763
           M D L D+L ++  +   + G    A+R  ++  F +  +N    L++T     G+++  
Sbjct: 414 MADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGRAN---ILVATAVAARGLDIPN 470

Query: 764 ADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVE-----EEVLERARKKM 818
              VI +D   +    +  + R  R G  N  +   F ++D         E+LE A +++
Sbjct: 471 VTHVINYDLPSDVDDYVHRIGRTGRAG--NTGVATAFFNRDNNNIVKGLYEILEEANQEI 528

>CAGL0I02354g 209279..210592 highly similar to sp|P38719
           Saccharomyces cerevisiae YHR169w DBP8, hypothetical
           start
          Length = 437

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 55/138 (39%), Gaps = 5/138 (3%)

Query: 681 LDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNA 740
           L QLLT         +IF       ++L   L    +    L   +P  +R  S+  F A
Sbjct: 250 LYQLLTCESYANSTAIIFVNRTTAAEVLRRTLKALDVRVASLHSQMPQQERTNSMHRFRA 309

Query: 741 PDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRF 800
              N    L++T     G+++ T + VI +D   +P   +    R  R G+K   + +  
Sbjct: 310 ---NAARVLIATDVASRGLDIPTVELVINYDIPSDPDTFIHRSGRTARAGRKGDAISF-I 365

Query: 801 VSKDTVEEEVLERARKKM 818
             +D    E +E AR  M
Sbjct: 366 TQRDVSRIEAIE-ARINM 382

>AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH]
           (576175..578307) [2133 bp, 710 aa]
          Length = 710

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 3/83 (3%)

Query: 719 YQRLDGTVPSAQRRISIDHFN---APDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWN 775
           + +L G++P A R  ++ HF+   A      + L  T     G++L    TVI  D  + 
Sbjct: 467 FYKLHGSLPQAVRVATLRHFSSDAAATRGKHLVLFCTDVASRGLDLPRVSTVIEMDPPFA 526

Query: 776 PQADLQAMARAHRIGQKNHVMVY 798
            +  L  + R  R G     +++
Sbjct: 527 VEDHLHRIGRTARAGVAGESLLF 549

>Scas_588.16
          Length = 693

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 671 LIMSSGKMVLLDQLLTRL---KKD--GHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGT 725
           LI +SGK  +  QLL +L   +KD    +VL+ S  ++ LDIL  +L  + +  +R+ GT
Sbjct: 122 LINTSGKFKVFQQLLFKLLDKEKDEVSKKVLLISHSIKELDILEGFLLGQKVRIKRISGT 181

>YLR404W (YLR404W) [3781] chr12 (928741..929598) Protein of unknown
           function [858 bp, 285 aa]
          Length = 285

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 26/63 (41%)

Query: 828 GVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATDNQRKLEDLNLDDVLNHAEDHVTT 887
           GV  G+   QS KS P   +L + +  G   +    DN     DLNL        DH+  
Sbjct: 63  GVQFGTKFFQSIKSIPVGTDLPQTIDNGLSQLIPMRDNMEYKLDLNLQLYCQSKTDHLNL 122

Query: 888 PDL 890
            +L
Sbjct: 123 DNL 125

>CAGL0J06908g complement(659917..661731) similar to sp|P24784
           Saccharomyces cerevisiae YPL119c DBP1 or sp|P06634
           Saccharomyces cerevisiae YOR204w, hypothetical start
          Length = 604

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 61/148 (41%), Gaps = 9/148 (6%)

Query: 647 DMAEDRVLAKFGDGRMSRENILRGLIMSSG---KMVLLDQLLTRLKKDGHRVLIFSQMVR 703
           D  +D +    G    + ENI + ++          LLD L+  +  DG   L+F +  R
Sbjct: 350 DFLKDYIFLSVGRVGSTSENIQQKVLFVEDYDKNSALLDILINEI--DG-LTLVFVETKR 406

Query: 704 MLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMT 763
           M D L D+L ++      + G    A+R  ++  F    +N    L++T     G+++  
Sbjct: 407 MADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIAN---ILVATAVAARGLDIPN 463

Query: 764 ADTVIIFDSDWNPQADLQAMARAHRIGQ 791
              VI +D   +    +  + R  R G 
Sbjct: 464 VTNVINYDLPTDIDDYVHRIGRTGRAGN 491

>CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c, start by similarity
          Length = 1544

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 27/103 (26%)

Query: 220  IKKIDNYIKQFI----------------ILDKQIRSDPYTTAEDIEVMD--LEKERRLDE 261
            IK +D+ I+QF+                IL+K I         + E+ +  L K++  D+
Sbjct: 1150 IKNLDSMIEQFVSMQLCCNIGYMRLLVAILEKTIYEKQQINLIEFELENQKLGKDKTQDD 1209

Query: 262  -------FEEYKIPERIIDSDRVTLEDGSSQLQYQVKWRRLNY 297
                   FEEYKIPE ++ S    L   S  L+Y+ ++R LNY
Sbjct: 1210 NQEDERSFEEYKIPEILMTSLITNL--PSEYLEYENQYRFLNY 1250

>Kwal_33.15028
          Length = 717

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 1260 PLPGASTGSKKRVRKAPTSRSATPDAKADEIRSGPAK 1296
            P+   S+GS K VR   TSR +TP A  DE+R  P +
Sbjct: 431  PIAPNSSGSTKNVR---TSRGSTPSAGKDELRKPPTR 464

>YHR065C (RRP3) [2353] chr8 complement(227533..229038) Helicase
           required for maturation of pre-rRNA [1506 bp, 501 aa]
          Length = 501

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 692 GHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLS 751
           G  ++IF++     + L    N+   +   L G +   QR  S+D F A   +    L++
Sbjct: 321 GKTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRS---ILVA 377

Query: 752 TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQ 791
           T     G+++ + D V+ +D   + ++ +  + R  R G+
Sbjct: 378 TDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGR 417

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 45,246,237
Number of extensions: 2016062
Number of successful extensions: 7422
Number of sequences better than 10.0: 151
Number of HSP's gapped: 7234
Number of HSP's successfully gapped: 218
Length of query: 1414
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1300
Effective length of database: 12,649,657
Effective search space: 16444554100
Effective search space used: 16444554100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)