Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2342953953128280.0
YDR091C60853125330.0
KLLA0C17556g60753125300.0
AGR125W60753125080.0
CAGL0G08041g60753124870.0
Scas_636.1460853224480.0
YPL226W (NEW1)11963341613e-11
CAGL0D03674g11863231561e-10
Sklu_2403.511793191533e-10
Scas_566.14662321461e-09
KLLA0C16115g11833201471e-09
AEL032W7535111462e-09
Scas_720.3611903201452e-09
AFL131W11893341443e-09
Kwal_0.16710441931434e-09
Sklu_2187.27524821434e-09
Sklu_2442.2010443061425e-09
CAGL0B03487g10452001417e-09
YLR249W (YEF3)10441911391e-08
CAGL0K10472g7524811381e-08
AAL028W10443091372e-08
KLLA0A10857g7524771362e-08
YNL014W (HEF3)10443091363e-08
Scas_703.1710461921363e-08
KLLA0F12210g10441931354e-08
Kwal_34.162407525101301e-07
YFR009W (GCN20)7525111301e-07
Scas_618.37931901292e-07
Kwal_0.32710191841292e-07
Kwal_27.1271112462091283e-07
Scas_712.296104901255e-07
Sklu_2152.56085041238e-07
KLLA0D03432g14832131249e-07
Kwal_33.1556112971711222e-06
CAGL0K00363g12272001222e-06
KLLA0C04477g12532151212e-06
Kwal_33.156235621971202e-06
CAGL0I08019g12852321193e-06
YKL209C (STE6)12901811193e-06
YOL075C12942361193e-06
Scas_716.8115651991184e-06
AGR047W14921301167e-06
AFR432W12842001168e-06
Scas_288.14942131131e-05
YER036C6104881122e-05
AFR232C6074651112e-05
YDR011W (SNQ2)15012131113e-05
KLLA0A01452g6074981103e-05
KLLA0D00748g7891981103e-05
CAGL0I04862g15072201103e-05
CAGL0M13739g7271661094e-05
Scas_695.2412881721085e-05
KLLA0D04554g10221901077e-05
CAGL0C02343g6101841078e-05
Scas_573.11689731068e-05
CAGL0E00385g6082771051e-04
CAGL0L07744g10551601042e-04
KLLA0F08833g2731881003e-04
Sklu_2316.113102401014e-04
Kwal_47.19116607179997e-04
Scas_40.1203179957e-04
AER190W1011184997e-04
ABR125C1488179997e-04
YMR301C (ATM1)690156988e-04
Scas_108.1335131978e-04
CAGL0L06402g1535132980.001
Scas_574.8702198980.001
Kwal_26.9480719198980.001
CAGL0E03355g1535172980.001
Scas_710.50602166960.001
KLLA0C01991g706206960.002
KLLA0B14256g1271117960.002
ABR126W1512265950.002
YCR011C (ADP1)1049246950.002
Scas_628.131060181950.002
YPL270W (MDL2)773311930.003
Kwal_56.22329776196930.003
CAGL0M01760g1499201930.004
KLLA0A10131g720168930.004
Scas_587.8715183920.004
Scas_693.421512132930.004
Sklu_2343.3774173920.004
YLR188W (MDL1)695231920.004
Kwal_56.238441494129920.005
Scas_468.1691296910.005
KLLA0D02156g52174890.009
KLLA0F20075g1516132900.010
Kwal_56.227471538187890.012
KLLA0D04059g1568161880.013
KLLA0B09702g1518225880.014
YOR011W (AUS1)139472880.015
YDR135C (YCF1)1515125870.021
CAGL0M07293g1515188850.030
CAGL0A01133g801267850.030
AGL335W691196850.032
Sklu_1870.3265186830.034
YKR104W (NFT1)306208830.034
YLL015W (BPT1)1559178850.035
KLLA0C14234g1454167840.042
KLLA0A00286g128053840.043
Scas_552.4720199840.044
ACR022W75473840.044
KLLA0E19074g32683820.048
AGL142C1497199830.060
Kwal_14.2052523236820.063
YGL091C (NBP35)328100810.079
CAGL0H03091g33479800.088
AFR683C677197800.11
Scas_711.39122753800.12
Kwal_14.2435124756800.12
Kwal_27.11147323100790.13
Sklu_2062.2328115790.14
Scas_472.1*39361780.16
YPL058C (PDR12)1511181790.17
YGR281W (YOR1)1477137790.17
Scas_586.31531170790.18
CAGL0G05093g54472780.19
Scas_643.11289176780.20
YIL013C (PDR11)141159780.22
Scas_567.1810181780.23
KLLA0F21692g1525246780.26
Scas_627.1853371770.27
YLL048C (YBT1)1661195770.27
Kwal_23.51611489171770.28
Scas_716.82675186760.33
YJL074C (SMC3)123053760.36
KLLA0D03476g1560218760.41
YNR070W133383760.44
Scas_612.11*1506196750.48
Scas_707.829432740.50
YOR153W (PDR5)1511199750.58
Kwal_27.96661474177750.58
AAL182W123153750.59
YHL035C1592179740.65
YFL028C (CAF16)289167730.66
Scas_167.1*279165720.75
CAGL0H02805g121953730.87
Kwal_56.23638492243731.0
Scas_720.733286711.2
CAGL0C03289g1648197721.4
CAGL0G00242g1477212711.4
Kwal_14.124226920701.5
Kwal_26.95321471153711.6
Scas_717.6*140072711.6
AFR152C27020691.7
Kwal_26.670261785692.1
CAGL0F01419g1398167702.2
YLR106C (MDN1)491043702.3
Scas_455.1925211692.3
Scas_622.91657197702.3
CAGL0E03982g165983692.5
AFL060W52986682.7
CAGL0K12474g29420682.7
Sklu_2140.267229682.9
Sklu_2035.347484683.4
YHR107C (CDC12)40744673.8
KLLA0F14575g85158673.9
KLLA0B02563g80884666.6
KLLA0E00462g165081657.7
Scas_664.8*56268649.3
Kwal_14.159164066649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23429
         (531 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23429                                                        1093   0.0  
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...   980   0.0  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...   979   0.0  
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...   970   0.0  
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...   962   0.0  
Scas_636.14                                                           947   0.0  
YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the non-t...    67   3e-11
CAGL0D03674g 370066..373626 highly similar to tr|Q08972 Saccharo...    65   1e-10
Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement       64   3e-10
Scas_566.1                                                             61   1e-09
KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomy...    61   1e-09
AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH] complement...    61   2e-09
Scas_720.36                                                            60   2e-09
AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH] complement(...    60   3e-09
Kwal_0.167                                                             60   4e-09
Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement         60   4e-09
Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement      59   5e-09
CAGL0B03487g complement(345399..348536) highly similar to sp|P16...    59   7e-09
YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongat...    58   1e-08
CAGL0K10472g 1020016..1022274 highly similar to sp|P43535 Saccha...    58   1e-08
AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W (H...    57   2e-08
KLLA0A10857g complement(941784..944042) highly similar to sp|P43...    57   2e-08
YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongat...    57   3e-08
Scas_703.17                                                            57   3e-08
KLLA0F12210g 1125630..1128764 highly similar to sp|P16521 Saccha...    57   4e-08
Kwal_34.16240                                                          55   1e-07
YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a prot...    55   1e-07
Scas_618.3                                                             54   2e-07
Kwal_0.327                                                             54   2e-07
Kwal_27.12711                                                          54   3e-07
Scas_712.29                                                            53   5e-07
Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement         52   8e-07
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...    52   9e-07
Kwal_33.15561                                                          52   2e-06
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    52   2e-06
KLLA0C04477g complement(409543..413304) similar to sp|Q08234 Sac...    51   2e-06
Kwal_33.15623                                                          51   2e-06
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    50   3e-06
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    50   3e-06
YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member...    50   3e-06
Scas_716.81                                                            50   4e-06
AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH] complement(...    49   7e-06
AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH] complement(...    49   8e-06
Scas_288.1                                                             48   1e-05
YER036C (YER036C) [1461] chr5 complement(223366..225198) Member ...    48   2e-05
AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH] (859615..8...    47   2e-05
YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump invo...    47   3e-05
KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharo...    47   3e-05
KLLA0D00748g complement(69839..72208) similar to sp|P33311 Sacch...    47   3e-05
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...    47   3e-05
CAGL0M13739g complement(1346231..1348414) similar to sp|P40416 S...    47   4e-05
Scas_695.24                                                            46   5e-05
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...    46   7e-05
CAGL0C02343g 236840..238672 highly similar to sp|P40024 Saccharo...    46   8e-05
Scas_573.11                                                            45   8e-05
CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces cer...    45   1e-04
CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces c...    45   2e-04
KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces c...    43   3e-04
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           44   4e-04
Kwal_47.19116                                                          43   7e-04
Scas_40.1                                                              41   7e-04
AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -...    43   7e-04
ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W ...    43   7e-04
YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of...    42   8e-04
Scas_108.1                                                             42   8e-04
CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharo...    42   0.001
Scas_574.8                                                             42   0.001
Kwal_26.9480                                                           42   0.001
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    42   0.001
Scas_710.50                                                            42   0.001
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    42   0.002
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    42   0.002
ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W (...    41   0.002
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...    41   0.002
Scas_628.13                                                            41   0.002
YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-bin...    40   0.003
Kwal_56.22329                                                          40   0.003
CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharo...    40   0.004
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    40   0.004
Scas_587.8                                                             40   0.004
Scas_693.42                                                            40   0.004
Sklu_2343.3 YPL270W, Contig c2343 2058-4382                            40   0.004
YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the ATP-b...    40   0.004
Kwal_56.23844                                                          40   0.005
Scas_468.1                                                             40   0.005
KLLA0D02156g complement(184520..186085) similar to sgd|S0002468 ...    39   0.009
KLLA0F20075g complement(1868786..1873336) similar to sp|P39109 S...    39   0.010
Kwal_56.22747                                                          39   0.012
KLLA0D04059g complement(338422..343128) similar to sp|P14772 Sac...    39   0.013
KLLA0B09702g complement(842245..846801) highly similar to sp|Q02...    39   0.014
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...    39   0.015
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    38   0.021
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...    37   0.030
CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces c...    37   0.030
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    37   0.032
Sklu_1870.3 YFL028C, Contig c1870 3336-4133                            37   0.034
YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the ATP-b...    37   0.034
YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporte...    37   0.035
KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces...    37   0.042
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...    37   0.043
Scas_552.4                                                             37   0.044
ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH] complement(...    37   0.044
KLLA0E19074g complement(1691643..1692623) highly similar to sp|P...    36   0.048
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....    37   0.060
Kwal_14.2052                                                           36   0.063
YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative ...    36   0.079
CAGL0H03091g complement(292976..293980) highly similar to sp|P52...    35   0.088
AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH] (1697345..1...    35   0.11 
Scas_711.39                                                            35   0.12 
Kwal_14.2435                                                           35   0.12 
Kwal_27.11147                                                          35   0.13 
Sklu_2062.2 YGL091C, Contig c2062 3197-4183                            35   0.14 
Scas_472.1*                                                            35   0.16 
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...    35   0.17 
YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resista...    35   0.17 
Scas_586.3                                                             35   0.18 
CAGL0G05093g complement(483230..484864) similar to sp|Q12298 Sac...    35   0.19 
Scas_643.1                                                             35   0.20 
YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane ...    35   0.22 
Scas_567.1                                                             35   0.23 
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    35   0.26 
Scas_627.18                                                            34   0.27 
YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein wit...    34   0.27 
Kwal_23.5161                                                           34   0.28 
Scas_716.82                                                            34   0.33 
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...    34   0.36 
KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces c...    34   0.41 
YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidr...    34   0.44 
Scas_612.11*                                                           33   0.48 
Scas_707.8                                                             33   0.50 
YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump in...    33   0.58 
Kwal_27.9666                                                           33   0.58 
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...    33   0.59 
YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of...    33   0.65 
YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein tha...    33   0.66 
Scas_167.1*                                                            32   0.75 
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...    33   0.87 
Kwal_56.23638                                                          33   1.0  
Scas_720.7                                                             32   1.2  
CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces c...    32   1.4  
CAGL0G00242g complement(20428..24861) highly similar to sp|P5304...    32   1.4  
Kwal_14.1242                                                           32   1.5  
Kwal_26.9532                                                           32   1.6  
Scas_717.6*                                                            32   1.6  
AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH] (710017..7...    31   1.7  
Kwal_26.6702                                                           31   2.1  
CAGL0F01419g complement(142623..146819) highly similar to tr|Q08...    32   2.2  
YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear p...    32   2.3  
Scas_455.1                                                             31   2.3  
Scas_622.9                                                             32   2.3  
CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces c...    31   2.5  
AFL060W [3133] [Homologous to ScYGL091C (NBP35) - SH] complement...    31   2.7  
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    31   2.7  
Sklu_2140.2 YER173W, Contig c2140 1850-3868                            31   2.9  
Sklu_2035.3 YBR186W, Contig c2035 2344-3764 reverse complement         31   3.4  
YHR107C (CDC12) [2395] chr8 complement(326815..328038) Septin, c...    30   3.8  
KLLA0F14575g complement(1351796..1354351) some similarities with...    30   3.9  
KLLA0B02563g complement(222951..225377) similar to sp|P34230 Sac...    30   6.6  
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    30   7.7  
Scas_664.8*                                                            29   9.3  
Kwal_14.1591                                                           29   9.4  

>Kwal_56.23429
          Length = 539

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/531 (100%), Positives = 531/531 (100%)

Query: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60
           MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI
Sbjct: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360
           YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK
Sbjct: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360

Query: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420
           RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ
Sbjct: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420

Query: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480
           KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480

Query: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
           ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA
Sbjct: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 97/193 (50%), Gaps = 38/193 (19%)

Query: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLG----RYDDPPEWQDIIRYFRGSELQNYFTKM 159
           ++L ++G NG GK+T +K+LAG   P+ G    + +   + Q I   F G+  Q +F ++
Sbjct: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRI 438

Query: 160 LEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDV 219
                   + PQ+                          Q D   V+K L ++ ++ ++V
Sbjct: 439 R----GQFLNPQF--------------------------QTD---VVKPLKIESIIDQEV 465

Query: 220 GALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRS-LLNATTYVISVE 278
             LSGGELQR AI ++    AD+Y+ DEPS+YLD +QR+  + VIR  +L+       VE
Sbjct: 466 QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVE 525

Query: 279 HDLSVLDYLSDFV 291
           HD  +  YL+D V
Sbjct: 526 HDFIMATYLADKV 538

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
           ortholog of human Rnase L inhibitor (RLI) of the
           interferon-regulated 2-5A pathway, putative ortholog of
           C. elegans Y39E4B.1, member of the non-transporter group
           in the ATP-binding cassette (ABC) superfamily [1827 bp,
           608 aa]
          Length = 608

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/531 (88%), Positives = 502/531 (94%)

Query: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60
           MS KN+RIAIV+ DKCKPKKCRQECKRSCPVVKTGKLCIEVTPT+KIAFISE LCIGCGI
Sbjct: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNLE  VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEWQ+II+YFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+E+S +D K  IK L L++VLKRD+  LSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA +IRSLL  T YVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360
           YGVVTLP+SVREGINIFL+GHIP+EN+RFR EALQFR+ DA E L+ + A+R+F+YPS+K
Sbjct: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360

Query: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420
           +TQGDFVLNVE G FSDSEILVMMGENGTGKTTLIKLLAGAL PD+GQ +PKLNVSMKPQ
Sbjct: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420

Query: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480
           KIAPKFPGTVRQLFFK+IRGQFLNPQFQTDVVKPL+I+ IIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
           ALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMA
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMA 531

 Score =  105 bits (263), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 129/263 (49%), Gaps = 52/263 (19%)

Query: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEW------QDIIRYFRGSELQNYFT 157
           ++L ++G NG GK+T +K+LAG  KP+ G+  D P+       Q I   F G+  Q +F 
Sbjct: 379 EILVMMGENGTGKTTLIKLLAGALKPDEGQ--DIPKLNVSMKPQKIAPKFPGTVRQLFFK 436

Query: 158 KMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKR 217
           K+        + PQ+                          Q D   V+K L +  ++ +
Sbjct: 437 KIR----GQFLNPQF--------------------------QTD---VVKPLRIDDIIDQ 463

Query: 218 DVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL--NATTYVI 275
           +V  LSGGELQR AI ++    AD+Y+ DEPS+YLD +QR+  + VIR  +  N  T  I
Sbjct: 464 EVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 523

Query: 276 SVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQ 335
            VEHD  +  YL+D V +  G+PS       P S+  G N FL+    + N+ FR++   
Sbjct: 524 -VEHDFIMATYLADKVIVFEGIPSKNAHARAPESLLTGCNRFLK----NLNVTFRRDPNS 578

Query: 336 FR----MVDAQEQLEAEDATRSF 354
           FR     +D+Q   E + +   F
Sbjct: 579 FRPRINKLDSQMDKEQKSSGNYF 601

>KLLA0C17556g complement(1544404..1546227) highly similar to
           sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1,
           start by similarity
          Length = 607

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/531 (88%), Positives = 502/531 (94%), Gaps = 1/531 (0%)

Query: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60
           MS+KN RIAIV+EDKCKPKKCRQECKRSCPVVKTGKLCIEV PT+KIAFISE LCIGCGI
Sbjct: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNL+ +VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR++DPPEWQ+II+YFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLRLE+S+DDAK  I  L L++VL R+V ALSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAL+IRSLLN TTYVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360
           YGVVTLPSSVREGINIFL+GHIPSEN+RFR EALQFRM DA ++LEA DA+R+F YP MK
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEA-DASRAFTYPDMK 359

Query: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420
           RTQGDF L VE+G FSDS+ILVMMGENGTGKTTLIKLLAGA+  DDGQ +PKLNVSMKPQ
Sbjct: 360 RTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQ 419

Query: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480
           KIAPKF GTVRQLFFKRIR QFLNPQFQTDVVKPLKI+ IIDQEVQHLSGGELQRVAIVL
Sbjct: 420 KIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 479

Query: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
           +LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMA
Sbjct: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMA 530

 Score =  105 bits (261), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/264 (32%), Positives = 129/264 (48%), Gaps = 54/264 (20%)

Query: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEW------QDIIRYFRGSELQNYFT 157
           Q+L ++G NG GK+T +K+LAG    + G+  D P+       Q I   F G+  Q +F 
Sbjct: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQ--DIPKLNVSMKPQKIAPKFTGTVRQLFFK 435

Query: 158 KMLEDNIKA-IIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK 216
           +     I+A  + PQ+                          Q D   V+K L +  ++ 
Sbjct: 436 R-----IRAQFLNPQF--------------------------QTD---VVKPLKIDDIID 461

Query: 217 RDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL--NATTYV 274
           ++V  LSGGELQR AI +S    AD+Y+ DEPS+YLD +QR+  + VIR  +  N  T  
Sbjct: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521

Query: 275 ISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEAL 334
           I VEHD  +  YL+D V +  G+PS       P S+  G N FL+    + N+ FR++  
Sbjct: 522 I-VEHDFIMATYLADKVIVFDGIPSKQAFARAPESLLTGCNKFLK----NLNVTFRRDPT 576

Query: 335 QFR----MVDAQEQLEAEDATRSF 354
            FR     +D+Q   E + +   F
Sbjct: 577 SFRPRINKLDSQMDKEQKSSGNYF 600

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
           complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score =  970 bits (2508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/531 (87%), Positives = 498/531 (93%), Gaps = 1/531 (0%)

Query: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60
           MS KN RIAIV++DKCKPKKCRQECKRSCPVVKTGKLCIEV PT+K+AFISE LCIGCGI
Sbjct: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AI IINLPTNL+ +VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRYDDPPEW DII+YFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240
           KGP+QKVGELLK R+E+ + D K  IK L+LQ+VLKRDV ALSGGELQRFAIGMSCVQ+A
Sbjct: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAAL+IRSLL+ TTYVI VEHDLSVLDYLSDF+CILYGVPSV
Sbjct: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360
           YGVVTLPSSVREGINIFL+GHIPSEN+RFR EALQFR+ +A E+L + DA R+F YP MK
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHS-DAMRAFQYPPMK 359

Query: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420
           RTQGDFVLNVE G FSDSEILVMMGENGTGKTTLIKLLAGA++ DDG+ +PKLNVSMKPQ
Sbjct: 360 RTQGDFVLNVEPGEFSDSEILVMMGENGTGKTTLIKLLAGAIAADDGKDIPKLNVSMKPQ 419

Query: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480
           KIAPKFPGTVRQLFFKRIR QFLNPQFQTDV KPL+I+ IIDQEVQHLSGGELQRVAIVL
Sbjct: 420 KIAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVL 479

Query: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
           ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMA
Sbjct: 480 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMA 530

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 119/243 (48%), Gaps = 50/243 (20%)

Query: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEW------QDIIRYFRGSELQNYFT 157
           ++L ++G NG GK+T +K+LAG    + G+  D P+       Q I   F G+  Q +F 
Sbjct: 378 EILVMMGENGTGKTTLIKLLAGAIAADDGK--DIPKLNVSMKPQKIAPKFPGTVRQLFFK 435

Query: 158 KMLEDNIKA-IIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK 216
           +     I+A  + PQ+                          Q D   V K L +  ++ 
Sbjct: 436 R-----IRAQFLNPQF--------------------------QTD---VCKPLRIDDIID 461

Query: 217 RDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL--NATTYV 274
           ++V  LSGGELQR AI ++    AD+Y+ DEPS+YLD +QR+  + VIR  +  N  T  
Sbjct: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521

Query: 275 ISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEAL 334
           I VEHD  +  YL+D V +  G PS       P S+  G N FL+    + N+ FR++  
Sbjct: 522 I-VEHDFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLK----NLNVTFRRDPN 576

Query: 335 QFR 337
            FR
Sbjct: 577 SFR 579

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
           Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/531 (86%), Positives = 492/531 (92%), Gaps = 1/531 (0%)

Query: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60
           MS K +RIA+VN D+CKPKKCRQECKRSCPVVKTGKLCIEVTPT+KIAFISE LCIGCGI
Sbjct: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE  VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEWQ+II+YFRGSELQNYFTKMLED+IKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180

Query: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+E+ QD  K  IK L L H+L R++G LSGGELQRFAI MSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAL+IRSLL  + YVI+VEHDLSVLDYLSDFVCILYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360
           YGVVTLPSSVREGINIFL+GHIPSENMRFR EALQFR+ D+   +   DATR+++YP MK
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRIADSAADIIV-DATRAYSYPDMK 359

Query: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420
           RTQGDF LNV+SG FSDSEILVMMGENGTGKTTLIKLLAGA+  DDG  VPKLNVSMKPQ
Sbjct: 360 RTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQ 419

Query: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480
            IAPKFPGTVRQLFFK+IR QFLNPQFQTDVVKPLKI+ IIDQEV+HLSGGELQRVAIVL
Sbjct: 420 TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479

Query: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
           +LG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMA
Sbjct: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMA 530

 Score =  101 bits (252), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 120/241 (49%), Gaps = 46/241 (19%)

Query: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLG----RYDDPPEWQDIIRYFRGSELQNYFTKM 159
           ++L ++G NG GK+T +K+LAG    + G    + +   + Q I   F G+  Q +F K 
Sbjct: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKK- 436

Query: 160 LEDNIKA-IIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRD 218
               I+A  + PQ+                          Q D   V+K L +  ++ ++
Sbjct: 437 ----IRAQFLNPQF--------------------------QTD---VVKPLKIDDIIDQE 463

Query: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL--NATTYVIS 276
           V  LSGGELQR AI +S    AD+Y+ DEPS+YLD +QR+  + VIR  +  N  T  I 
Sbjct: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI- 522

Query: 277 VEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQF 336
           VEHD  +  YL+D V +  G PS     T P S+  G N FL+    + N+ FR++   F
Sbjct: 523 VEHDFIMATYLADKVIVFDGTPSQNTTATAPESLLTGCNRFLK----NLNVTFRRDPNSF 578

Query: 337 R 337
           R
Sbjct: 579 R 579

>Scas_636.14
          Length = 608

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/532 (85%), Positives = 490/532 (92%), Gaps = 2/532 (0%)

Query: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60
           MS KN+RIAIV+ D+CKPKKCRQECKRSCPVVKTGKLCIEVTPT+KIAFISE LCIGCGI
Sbjct: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE  VTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEWQ+II+YFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+E+  +  K  IK L L+HVL R++G LSGGELQRFAIG+SCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA +IR LL  T YVI+VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360
           YGVVTLPSSVREGINIFL+GHIP+EN+RFR EALQFR+ DA E  + E A ++F YP+MK
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGE-ANKTFEYPAMK 359

Query: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDD-GQKVPKLNVSMKP 419
           RTQGDF L VESG FSDSEILVMMGENGTGKTTLIKLLAG +  D+  +KV KLNVSMKP
Sbjct: 360 RTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKP 419

Query: 420 QKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIV 479
           Q IAPKFPGTVRQLFFK+IRGQFL+PQFQTDVVKPLKI+ IIDQEVQHLSGGELQRVAIV
Sbjct: 420 QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479

Query: 480 LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
           LALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMA
Sbjct: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMA 531

 Score = 99.8 bits (247), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 117/240 (48%), Gaps = 43/240 (17%)

Query: 104 QVLGLVGTNGIGKSTALKILAG-----KQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTK 158
           ++L ++G NG GK+T +K+LAG     +    + + +   + Q I   F G+  Q +F K
Sbjct: 378 EILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKK 437

Query: 159 MLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRD 218
           +        + PQ+                          Q D   V+K L +  ++ ++
Sbjct: 438 IR----GQFLSPQF--------------------------QTD---VVKPLKIDDIIDQE 464

Query: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRS-LLNATTYVISV 277
           V  LSGGELQR AI ++    AD+Y+ DEPS+YLD +QR+  + VIR  +L+       V
Sbjct: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVV 524

Query: 278 EHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFR 337
           EHD  +  YL+D V +  G PS +     P S+  G N FL+    + N+ FR++   FR
Sbjct: 525 EHDFIMATYLADKVIVFEGTPSKHANARAPESLLTGCNRFLK----NLNVTFRRDTTSFR 580

>YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the
           non-transporter group of the ATP-binding cassette (ABC)
           superfamily, also a prion responsible for the [NU+]
           determinant [3591 bp, 1196 aa]
          Length = 1196

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 134/334 (40%), Gaps = 73/334 (21%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRY-FRGSELQNYFTKMLE 161
           G   GL G NG GKST ++ +A       G+ D  P+ +D +R  F   +LQ     +  
Sbjct: 597 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPD-KDTLRTCFVEHKLQGEEGDL-- 647

Query: 162 DNIKAIIKPQYVDNIPRA-IKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVG 220
           D +  I   + + +  R  I   ++ VG       ER                   + VG
Sbjct: 648 DLVSFIALDEELQSTSREEIAAALESVG----FDEERR-----------------AQTVG 686

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYV-ISVEH 279
           +LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T    + V H
Sbjct: 687 SLSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLEEYLLEHTDITSLIVSH 743

Query: 280 DLSVLD----------------YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIP 323
           D   LD                Y  +    +   P      TL  S              
Sbjct: 744 DSGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDS-------------- 789

Query: 324 SENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVM 383
           +  MRF    +    V +  +  A+    +F+YP  ++     V    S S S S  +  
Sbjct: 790 NAQMRFPPPGI-LTGVKSNTRAVAKMTDVTFSYPGAQKPSLSHV----SCSLSLSSRVAC 844

Query: 384 MGENGTGKTTLIKLLAGALSPDDG--QKVPKLNV 415
           +G NG GK+TLIKLL G L P++G  +K P L +
Sbjct: 845 LGPNGAGKSTLIKLLTGELVPNEGKVEKHPNLRI 878

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 125/297 (42%), Gaps = 73/297 (24%)

Query: 254 VKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREG 313
           VK  +N   VI+ +    + +++V+ +++    L DF+  ++G            S RE 
Sbjct: 498 VKPYMNDETVIKYM----SKILTVDSNVNDWKRLEDFLTAVFGGSD---------SQREF 544

Query: 314 INIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESG 373
           +    +  I +    F QE       D  E +E  +   S AY S        +LN  + 
Sbjct: 545 VK---QDFIHNLRALFYQEK---ERADEDEGIEIVNTDFSLAYGSR------MLLNKTNL 592

Query: 374 SFSDSEILVMMGENGTGKTTLIKLLA-GALSPDDGQKVPKLNVSMKPQKIAPKFPG--TV 430
                    + G NG GK+TL++ +A G L   DG                  FP   T+
Sbjct: 593 RLLKGHRYGLCGRNGAGKSTLMRAIANGQL---DG------------------FPDKDTL 631

Query: 431 RQLFFK-RIRGQ----------FLNPQFQTDVVKPLK--IESI-IDQE-----VQHLSGG 471
           R  F + +++G+           L+ + Q+   + +   +ES+  D+E     V  LSGG
Sbjct: 632 RTCFVEHKLQGEEGDLDLVSFIALDEELQSTSREEIAAALESVGFDEERRAQTVGSLSGG 691

Query: 472 ELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFLVEHD 527
              ++ +  A+   ADI L+DEP+ +LD    +   K +  ++L H   T+ +V HD
Sbjct: 692 WKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLEEYLLEHTDITSLIVSHD 744

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
            +G+LSGG+L +  I  +      + + DEP++YLD       A+ IR   + +  V+ + 
Sbjct: 1030 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIR---DWSGGVVMIS 1086

Query: 279  HD 280
            H+
Sbjct: 1087 HN 1088

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 468  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1033 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNE 1090

>CAGL0D03674g 370066..373626 highly similar to tr|Q08972
           Saccharomyces cerevisiae YPL226w NEW1, start by
           similarity
          Length = 1186

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/323 (25%), Positives = 137/323 (42%), Gaps = 51/323 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+                       
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSIAN------GQLDGFPD----------------------- 620

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGEL-LKLRLER-SQDDAKYVIKALDLQHVLK-RDV 219
             K  +K  +V++  +  +G +  V  + L  +L+  S+DD    + ++      + + V
Sbjct: 621 --KDTLKTCFVEHKLQGEEGDLDLVSFIALDEQLQTTSRDDIANALASVGFDETRRAQTV 678

Query: 220 GALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL---NATTYVIS 276
           G+LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL   N T+ ++S
Sbjct: 679 GSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVA---NVKWLEEYLLEHTNITSLIVS 735

Query: 277 VEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSEN--MRFRQEAL 334
             HD   LD +   +        +Y    L   V +         +   N  MRF    +
Sbjct: 736 --HDSGFLDAVCTDIIHYENKKLIYYKGNLAKFVEQKPEAKAYYTLSDTNAQMRFPPPGI 793

Query: 335 QFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTL 394
               V +  +  A+    +F YP         V    S + S S  + ++G NG GK+TL
Sbjct: 794 -LTGVKSNTRAVAKVTDVTFTYPGASTPSLSHV----SCALSLSSRVAVLGPNGAGKSTL 848

Query: 395 IKLLAGALSPDDG--QKVPKLNV 415
           IKLL G L P +G  +K P L +
Sbjct: 849 IKLLTGELVPQEGKVEKHPNLRI 871

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 89/211 (42%), Gaps = 35/211 (16%)

Query: 329 FRQEALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENG 388
           F QE ++    D  E +E  +   S AY S        +LN  +          + G NG
Sbjct: 550 FHQEKVKH---DEDEGIEIVNTDFSLAYGSR------MLLNKTNLRLIKGHRYGLCGRNG 600

Query: 389 TGKTTLIKLLA-GALS--PDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNP 445
            GK+TL++ +A G L   PD          ++K   +  K  G    L    +    L+ 
Sbjct: 601 AGKSTLMRSIANGQLDGFPDKD--------TLKTCFVEHKLQGEEGDLDL--VSFIALDE 650

Query: 446 QFQT----DVVKPLKI----ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAY 497
           Q QT    D+   L      E+   Q V  LSGG   ++ +  A+   ADI L+DEP+ +
Sbjct: 651 QLQTTSRDDIANALASVGFDETRRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNH 710

Query: 498 LDSEQRIICSKVIRRFIL-HNKKTAFLVEHD 527
           LD    +   K +  ++L H   T+ +V HD
Sbjct: 711 LD----VANVKWLEEYLLEHTNITSLIVSHD 737

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 219  VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
            +G+LSGG+L +  I  +      + + DEP++YLD       A+ IR        V+ + 
Sbjct: 1023 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGG---VVMIS 1079

Query: 279  HD 280
            H+
Sbjct: 1080 HN 1081

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 468  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1026 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGGVVMISHNNE 1083

>Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement
          Length = 1179

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 133/319 (41%), Gaps = 43/319 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ     +  D
Sbjct: 578 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTRFVEHKLQGEEGDL--D 629

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK-RDVGA 221
            +  I           A+   +Q V          S++D    ++++      + + VG+
Sbjct: 630 LVSFI-----------ALDPELQGV----------SREDIANALESVGFDDYRRSQTVGS 668

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYV-ISVEHD 280
           LSGG   +  +  + +Q+ADV + DEP+++LDV    N   +   LL  T    + V HD
Sbjct: 669 LSGGWKMKLELARAMLQKADVLLLDEPTNHLDVA---NVKWLEDYLLEHTEITSLIVSHD 725

Query: 281 LSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSEN--MRFRQEALQFRM 338
              LD +   +         Y    L + V +         +   N  MRF    +    
Sbjct: 726 SGFLDAVCTEIIHYENKKLAYYKGNLAAFVEQKPEAKAYYTLTDTNAQMRFPPPGI-LTG 784

Query: 339 VDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLL 398
           V +  +  A+    SF YP   +      L   S S S S  + ++G NG GK+TLIKLL
Sbjct: 785 VKSNTRAVAKVTGVSFTYPGASQPS----LTDVSCSLSLSSRVAVLGPNGAGKSTLIKLL 840

Query: 399 AGALSPDDG--QKVPKLNV 415
            G L P +G  +K P L +
Sbjct: 841 TGELVPQEGKVEKHPNLRI 859

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 111/267 (41%), Gaps = 43/267 (16%)

Query: 278 EHDLSVLDYLSDFVCILYGVPSV-----YGVVTLPSSVREGINIFLEGHIPSENMRFRQE 332
           E D +V++YL++ V     V        Y V+ L     E ++      I    + F QE
Sbjct: 485 EDDSTVIEYLTNIVTFDANVNDWKRLQEYLVMVLGEENDEFVSTQF---IHELRLMFHQE 541

Query: 333 ALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKT 392
                + D  E +E  +   S AY S        +LN  +          + G NG GK+
Sbjct: 542 RA---VTDEDEGIEIVNTDFSLAYGSR------MLLNKTNLRLLKGHRYGLCGRNGAGKS 592

Query: 393 TLIKLLA-GALS--PDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQ- 448
           TL++ +A G L   PD          +++ + +  K  G    L    +    L+P+ Q 
Sbjct: 593 TLMRSIANGQLEGFPDKD--------TLRTRFVEHKLQGEEGDLDL--VSFIALDPELQG 642

Query: 449 ---TDVVKPLKIESIID----QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 501
               D+   L+     D    Q V  LSGG   ++ +  A+   AD+ L+DEP+ +LD  
Sbjct: 643 VSREDIANALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQKADVLLLDEPTNHLD-- 700

Query: 502 QRIICSKVIRRFIL-HNKKTAFLVEHD 527
             +   K +  ++L H + T+ +V HD
Sbjct: 701 --VANVKWLEDYLLEHTEITSLIVSHD 725

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
            +G+LSGG+L +  I  +      + + DEP++YLD       A+ IR   + T  V+ + 
Sbjct: 1011 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIR---DWTGGVVMIS 1067

Query: 279  HD 280
            H+
Sbjct: 1068 HN 1069

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 468  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1014 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWTGGVVMISHNNE 1071

>Scas_566.1
          Length = 466

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 109/232 (46%), Gaps = 40/232 (17%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYF-- 147
           NSF L  LP+   G V+ ++G +G GK+T L +LA K    L    D       I Y   
Sbjct: 68  NSFSLD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLKTDGD-------IHYILE 116

Query: 148 ----RGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAK 203
               R SE +    + ++D++K    PQ   ++  A     + +     L+L+RS+++ K
Sbjct: 117 EKPQRDSEQE----QEVQDHVKMAYLPQ--QDVLSARLTCRETLMYAADLKLDRSKEEKK 170

Query: 204 YV----IKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
            V    I  L L+   +  VG      LSGGE +R ++G   +    +   DEP++ LD 
Sbjct: 171 LVVDQLIHELGLKDCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDA 230

Query: 255 KQRLNAALVIRSLL-----NATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
               +A LV+++L      +  T+++S+    S + +L D VCIL     VY
Sbjct: 231 ---YSAYLVVKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGKVVY 279

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 81/196 (41%), Gaps = 44/196 (22%)

Query: 366 FVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA----GALSPD-------------DGQ 408
           F L++ SGS     ++ +MG +G+GKTTL+ +LA    G L  D             D +
Sbjct: 70  FSLDLPSGS-----VMAVMGGSGSGKTTLLNVLASKISGGLKTDGDIHYILEEKPQRDSE 124

Query: 409 KVPKLNVSMK----PQKIAPKFPGTVRQLFF--------------KRIRGQFLNPQFQTD 450
           +  ++   +K    PQ+       T R+                 K +  Q ++     D
Sbjct: 125 QEQEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLIHELGLKD 184

Query: 451 VVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 510
             + L    + D   + LSGGE +R+++   +     I  +DEP+  LD+    +  K +
Sbjct: 185 CAETL----VGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTL 240

Query: 511 RRFILHNKKTAFLVEH 526
           ++    + +T  +  H
Sbjct: 241 KKLAKEDGRTFIMSIH 256

>KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomyces
           cerevisiae YPL226w NEW1, start by similarity
          Length = 1183

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 132/320 (41%), Gaps = 45/320 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRY-FRGSELQNYFTKMLE 161
           G   GL G NG GKST ++ +A       G+ +  P+ +D +R  F   +LQ     +  
Sbjct: 583 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPD-KDTLRTCFVEHKLQGEEGDL-- 633

Query: 162 DNIKAI-IKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVG 220
           D +  I + P   D     I   ++ VG           DD +             + VG
Sbjct: 634 DLVSFIALDPILKDVSKEDISNALESVG----------FDDYRR-----------SQTVG 672

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYV-ISVEH 279
           +LSGG   +  +  + +Q ADV + DEP+++LDV    N   +   LL  T    + V H
Sbjct: 673 SLSGGWKMKLELARAMLQRADVLLLDEPTNHLDVA---NVKWLQDYLLEHTDITSLIVSH 729

Query: 280 DLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSEN--MRFRQEALQFR 337
           D   LD +   +         Y    L   V +         + + N  M F    +   
Sbjct: 730 DSGFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKAYYTLTNSNAQMHFPPPGI-LS 788

Query: 338 MVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKL 397
            V +  +  A+    +F YP   +      L+  S + S S  + ++G NG GK+TLIKL
Sbjct: 789 GVKSNTRAVAKMTDVTFTYPGASKPS----LSNVSCALSLSSRVAILGPNGAGKSTLIKL 844

Query: 398 LAGALSPDDG--QKVPKLNV 415
           L G L PD G  +K P L +
Sbjct: 845 LNGELLPDSGKVEKHPNLRI 864

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 463 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 521
           Q V  LSGG   ++ +  A+   AD+ L+DEP+ +LD    +   K ++ ++L H   T+
Sbjct: 669 QTVGSLSGGWKMKLELARAMLQRADVLLLDEPTNHLD----VANVKWLQDYLLEHTDITS 724

Query: 522 FLVEHD 527
            +V HD
Sbjct: 725 LIVSHD 730

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 219  VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
            +G+LSGG+L +  I  +      + + DEP++YLD       A+ IR     T  V+ + 
Sbjct: 1017 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMIS 1073

Query: 279  HD 280
            H+
Sbjct: 1074 HN 1075

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 468  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1020 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHNNE 1077

>AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH]
           complement(572196..574457) [2262 bp, 753 aa]
          Length = 753

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 114/511 (22%), Positives = 209/511 (40%), Gaps = 115/511 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRY------------DDPPEWQ-----DIIR 145
           G+  GLVG NGIGKST L+ L+ +++ N+ ++            DD    Q     D+ R
Sbjct: 226 GRRYGLVGQNGIGKSTLLRALS-RRELNVPKHISILHVEQELRGDDTKVLQSVLDADVWR 284

Query: 146 YFRGSELQNYFTKMLE-DNIKA-----IIKPQYVDNIPRAIKGPVQKVGE-LLKLRLERS 198
               SE      ++ + D ++A      ++ + +DN    ++  +Q++ E L  +  +++
Sbjct: 285 KQLLSEELKINERLQDIDKLRAEFDEDSLEVKKLDNERDDLESHLQQIAEKLADMESDKA 344

Query: 199 QDDAKYVIKALDLQ-HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           +  A  ++  L       ++   + SGG   R ++  +   + D+ + DEPS+ LDV   
Sbjct: 345 EARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP-- 402

Query: 258 LNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYG----------VPSVYGV---- 303
            + A +   L      V+ V HD S L+ ++  +   +             S Y      
Sbjct: 403 -SIAYLAEYLKTYPATVLVVSHDRSFLNEVATDIIYQHNERLDYYRGQDFDSFYATKEER 461

Query: 304 -----------VTLPSSVREGINIFLEGHIPSENMRFR---------------QEALQFR 337
                      +     ++E I+ +      S+  + R               ++++ F+
Sbjct: 462 RKNAQREYDNQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEEEKSITFK 521

Query: 338 MVDAQEQ----LEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTT 393
             D ++     ++ +D   SF Y   +    D  L+V+     DS I  ++G NG GKTT
Sbjct: 522 FADCEKLSPPIIQLQDV--SFGYDESQLLLKDVNLDVQM----DSRI-ALVGANGCGKTT 574

Query: 394 LIKLLAGALSPDDGQ--KVPKLNVSMKPQK--------------IAPKFPGTVRQLFFKR 437
           L+K++   L P  G   + P+L +    Q               ++  FPG   + + +R
Sbjct: 575 LLKVMMEQLRPITGHVSRNPRLRIGYFTQHHIDSMDLNASAVDWMSKTFPGKTDEEY-RR 633

Query: 438 IRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSA 496
             G F        +   L +     Q++Q LSGG+  RVA   L L  P  I ++DEPS 
Sbjct: 634 HLGAF-------GITGSLGL-----QKMQLLSGGQKSRVAFAALCLNSPH-ILILDEPSN 680

Query: 497 YLDSEQRIICSKVIRRFILHNKKTAFLVEHD 527
           +LD+       + ++ F         +V HD
Sbjct: 681 HLDTAGLDALVQALKNF----SGGVLMVSHD 707

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 87/188 (46%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 562 IALVGANGCGKTTLLKVMMEQLRPITGHVSRNPRLR-----------IGYFTQHHIDSMD 610

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
             +    VD + +   G   K  E  +  L      A  +  +L LQ +       LSGG
Sbjct: 611 --LNASAVDWMSKTFPG---KTDEEYRRHL-----GAFGITGSLGLQKM-----QLLSGG 655

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           +  R A    C+    + + DEPS++LD    L+A  ++++L N +  V+ V HD+SV+D
Sbjct: 656 QKSRVAFAALCLNSPHILILDEPSNHLDTAG-LDA--LVQALKNFSGGVLMVSHDISVID 712

Query: 286 YLSDFVCI 293
            + D + +
Sbjct: 713 SVCDEIWV 720

>Scas_720.36
          Length = 1190

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/320 (26%), Positives = 131/320 (40%), Gaps = 45/320 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRY-FRGSELQNYFTKMLE 161
           G   GL G NG GKST ++ +A       G+ D  P+ +D +R  F   +LQ     +  
Sbjct: 593 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPD-KDTLRTCFVEHKLQGEEGDL-- 643

Query: 162 DNIKAIIKPQYVDNIPRA-IKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVG 220
           D +  I   + +    R  I   ++ VG       ER                   + VG
Sbjct: 644 DLVSFIALDEELQATSREEISNALEHVG----FDEERR-----------------AQTVG 682

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYV-ISVEH 279
           +LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T    + V H
Sbjct: 683 SLSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLQDYLLEHTDITSLIVSH 739

Query: 280 DLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSEN--MRFRQEALQFR 337
           D   LD +   +         Y    L   V +         +   N  M F    +   
Sbjct: 740 DSGFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKSYYTLSDSNAQMHFPPPGI-LT 798

Query: 338 MVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKL 397
            V +  +  A+    +F+YP   +     V    S + S S  + ++G NG GK+TLIKL
Sbjct: 799 GVKSNTRAVAKMTDVTFSYPGADKPSLSHV----SCALSLSSRVAVLGPNGAGKSTLIKL 854

Query: 398 LAGALSPDDG--QKVPKLNV 415
           L G L P +G  +K P L +
Sbjct: 855 LTGELVPQEGKVEKHPNLRI 874

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 115/278 (41%), Gaps = 61/278 (21%)

Query: 276 SVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSV-REGINIFLEGHIPSENMR--FRQE 332
           S+  D +V+DYL+  + +   V     +    ++V  E    F+E  I +  +R  F QE
Sbjct: 498 SILDDETVMDYLTKILTVQANVNDWTKLTEFLTNVLGESNKDFIEKEIIA-GLRAIFHQE 556

Query: 333 ALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKT 392
                  D  E +E  +   S AY S        +LN  +          + G NG GK+
Sbjct: 557 KAAH---DENEGIEIVNTDFSLAYGSR------MLLNKTNLRLLKGHRYGLCGRNGAGKS 607

Query: 393 TLIKLLA-GALSPDDGQKVPKLNVSMKPQKIAPKFPG--TVRQLFFK-RIRGQ------- 441
           TL++ +A G L   DG                  FP   T+R  F + +++G+       
Sbjct: 608 TLMRAIANGQL---DG------------------FPDKDTLRTCFVEHKLQGEEGDLDLV 646

Query: 442 -FLNPQFQTDVVKPLKIESIID----------QEVQHLSGGELQRVAIVLALGLPADIYL 490
            F+    +       +I + ++          Q V  LSGG   ++ +  A+   ADI L
Sbjct: 647 SFIALDEELQATSREEISNALEHVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILL 706

Query: 491 IDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFLVEHD 527
           +DEP+ +LD    +   K ++ ++L H   T+ +V HD
Sbjct: 707 LDEPTNHLD----VSNVKWLQDYLLEHTDITSLIVSHD 740

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 219  VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
            +G+LSGG+L +  I  +      + + DEP++YLD       A+ IR        V+ + 
Sbjct: 1026 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGG---VVMIS 1082

Query: 279  HD 280
            H+
Sbjct: 1083 HN 1084

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 468  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 519
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1029 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGGVVMISHNNE 1086

>AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH]
           complement(186656..190225) [3570 bp, 1189 aa]
          Length = 1189

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 129/334 (38%), Gaps = 73/334 (21%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ ++       G+ +  P   ++   F    L+     +  D
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSISN------GQLEGFPSQDELKTCFVERALEGEDGSV--D 641

Query: 163 NIKAIIKPQYVDNIPR-AIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGA 221
            +  +     ++N PR  I   ++ VG     R +                      VG+
Sbjct: 642 IVSFLASAPSLENTPRKEIVAALESVGFDADRRAQT---------------------VGS 680

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYV-ISVEHD 280
           LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LLN T    + V HD
Sbjct: 681 LSGGWKMKLELTRAILQKADILLLDEPTNHLDVA---NVRWLEEYLLNNTEITSLIVSHD 737

Query: 281 LSVLD----------------YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPS 324
              LD                Y  +    +   P      TL  S         + H P+
Sbjct: 738 TGFLDKVCTDIIHYENKKLAYYKGNLHDFVEQKPEAKSYYTLTDS-------NAQMHFPA 790

Query: 325 ENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSM-KRTQGDFVLNVESGSFSDSEILVM 383
             +           V +  +  A+    +F YP   K +  D      S S S S  + +
Sbjct: 791 PGI--------LSGVKSNTRAVAKMTDVTFTYPGAPKPSMADV-----SCSLSLSSRVAI 837

Query: 384 MGENGTGKTTLIKLLAGALSPDDG--QKVPKLNV 415
           +G NG GK+TLIKLL G L P  G  +K P L +
Sbjct: 838 IGPNGAGKSTLIKLLTGELVPTSGKVEKHPNLRI 871

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 463 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK-TA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   + +  ++L+N + T+
Sbjct: 676 QTVGSLSGGWKMKLELTRAILQKADILLLDEPTNHLD----VANVRWLEEYLLNNTEITS 731

Query: 522 FLVEHD 527
            +V HD
Sbjct: 732 LIVSHD 737

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 4/103 (3%)

Query: 208  ALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSL 267
             LD +      +G+LSGG+L +  I  +      + + DEP++YLD       A+ IR  
Sbjct: 1013 GLDAEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW 1072

Query: 268  LNATTYVISVEHDLSVLDYLSDFVCIL-YGVPSVYGVVTLPSS 309
               T  V+ + H    +  L     I+  G     GVVT+  S
Sbjct: 1073 ---TGGVVMISHSTEFVGALCPEQWIVENGTMVQKGVVTVDQS 1112

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 468  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +
Sbjct: 1027 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW 1072

>Kwal_0.167
          Length = 1044

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 88/193 (45%), Gaps = 12/193 (6%)

Query: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
           + +LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 ISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFR-QEALQFR 337
           HD   LD ++ ++    G+        +   V++         + +  + FR  E     
Sbjct: 598 HDSGFLDNVTQYIIHYEGLKLRKYKGNMSEFVKKCPTAKSYYELGASELEFRFPEPGFLE 657

Query: 338 MVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSF--SDSEILVMMGENGTGKTTLI 395
            V  +++   + +  +F YP   + Q      +   SF  S S  + ++G NG GK+TLI
Sbjct: 658 GVKTKQKAIVKVSNMTFQYPGTSKPQ------ISDISFQCSLSSRIAVIGPNGAGKSTLI 711

Query: 396 KLLAGALSPDDGQ 408
            +L G L P  G+
Sbjct: 712 NVLTGELLPTSGE 724

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQF 442
           + G NG GK+TL++ +A         +     V ++          +V    F+   G  
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQDECRTVYVEHDIDGTHSDTSVLDFVFQ---GDV 517

Query: 443 LNPQFQTDVVKPLKI-ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
              +  TD ++     + +I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 518 GTKEAITDKLREFGFSDEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD
Sbjct: 870 LTRKEIEEHCAMLGLDSELVSHSRIRGLSGGQKVKLVLAACSWQRPHLIVLDEPTNYLD 928

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ 
Sbjct: 884 LDSELVSHSRIRGLSGG--QKVKLVLAACSWQRPHLIVLDEPTNYLDRDSLGALSKALKA 941

Query: 513 F 513
           F
Sbjct: 942 F 942

>Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement
          Length = 752

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 111/482 (23%), Positives = 193/482 (40%), Gaps = 107/482 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEW-- 140
           G+  GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRLERSQ 199
           Q +    + +E      K+ E+  +  ++ + +DN    +   ++++ E L+ +  ++++
Sbjct: 285 QLLSEESKINERLQEIEKLREEFDEDSLEVKKLDNEREDLDNHLEQISEKLVDMESDKAE 344

Query: 200 DDAKYVIKALDLQ-HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV---- 254
             A  ++  L       ++   + SGG   R ++  +   + D+ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIA 404

Query: 255 ------KQRLNAALVI---RSLLNATTYVISVEHDLSVLDYL--SDFVCILYGVP----- 298
                 K      LV+   R+ LN     I  +H+   LDY    DF    Y        
Sbjct: 405 YLSEYLKTYPATVLVVSHDRAFLNEVATDIIYQHN-ERLDYYRGQDFDT-FYATKEERRK 462

Query: 299 ----SVYGVVTLPSSVREGINIFLEGHIPSENMRFR---------------QEALQFRMV 339
                    +     ++E I+ +      S+  + R               ++++ F+  
Sbjct: 463 NAQREYENQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEEEKSINFKFP 522

Query: 340 DAQEQ----LEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLI 395
           D ++     ++ +D   SF Y        D  L+V+     DS I  ++G NG GKTTL+
Sbjct: 523 DCEKLSPPIIQLQDV--SFGYEENSPLLKDVNLDVQ----MDSRI-ALVGANGCGKTTLL 575

Query: 396 KLLAGALSPDDG--QKVPKLNVSMKPQK--------------IAPKFPGTVRQLFFKRIR 439
           K++   L P  G   + P+L +    Q               ++  FPG   +  ++R  
Sbjct: 576 KVMMEQLRPTKGYVSRNPRLRIGYFTQHHVDSMDLNTSAVDWMSKTFPGKTDEE-YRRHL 634

Query: 440 GQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAI-VLALGLPADIYLIDEPSAYL 498
           G F        +   L +     Q++Q LSGG+  RVA   L L  P  I ++DEPS +L
Sbjct: 635 GAF-------GITGSLGL-----QKMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHL 681

Query: 499 DS 500
           D+
Sbjct: 682 DT 683

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 86/188 (45%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
             +    VD + +   G   K  E  +  L      A  +  +L LQ +       LSGG
Sbjct: 610 --LNTSAVDWMSKTFPG---KTDEEYRRHL-----GAFGITGSLGLQKM-----QLLSGG 654

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           +  R A    C+    + + DEPS++LD    L+A  +I +L N T  V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LIDALKNFTGGVLMVSHDISVID 711

Query: 286 YLSDFVCI 293
           ++   + +
Sbjct: 712 HVCSEIWV 719

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 468 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHD 527
            SGG   R+++  AL    D+ L+DEPS  LD       S+ ++ +      T  +V HD
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVLVVSHD 423

>Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement
          Length = 1044

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 128/306 (41%), Gaps = 45/306 (14%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKA 166
           GL G NG GKST ++ +A       G+ D  P  QD  R           T  +E +I  
Sbjct: 460 GLCGPNGAGKSTLMRAIAN------GQVDGFPS-QDECR-----------TVYVEHDIDG 501

Query: 167 IIKPQYV-DNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
                 V + + +   G  + + E  KLR     D+            +++  + +LSGG
Sbjct: 502 THSDTSVLEFVFQGDVGTKETISE--KLREFGFSDE------------MIEMPIASLSGG 547

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
              + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I V HD   LD
Sbjct: 548 WKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVSHDSGFLD 604

Query: 286 YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFR-QEALQFRMVDAQEQ 344
            +  ++    G+        L   V++         + +  + FR  E      V  +++
Sbjct: 605 SVCQYIIHYEGLKLRKYRGNLSEFVKKCPTAKSYYELGASELEFRFPEPGYLEGVKTKQK 664

Query: 345 LEAEDATRSFAYPSMKRTQGDFVLNVESGSF--SDSEILVMMGENGTGKTTLIKLLAGAL 402
              + +  +F YP   + Q      +   SF  S S  + ++G NG GK+TLI +L G L
Sbjct: 665 AIVKVSNMTFQYPGTSKPQ------ISDISFQCSLSSRIAVIGPNGAGKSTLINVLTGEL 718

Query: 403 SPDDGQ 408
            P  G+
Sbjct: 719 LPTIGE 724

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
           + +I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +    ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ 
Sbjct: 884 LDAELVSHSRIRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKA 941

Query: 513 F 513
           F
Sbjct: 942 F 942

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD
Sbjct: 870 LTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD 928

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG 132
           + ++G NG GKST + +L G+  P +G
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTIG 723

>CAGL0B03487g complement(345399..348536) highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 or sp|P53978
           Saccharomyces cerevisiae YNL014w HEF3, start by
           similarity
          Length = 1045

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 91/200 (45%), Gaps = 12/200 (6%)

Query: 212 QHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNAT 271
           + ++   + +LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L    
Sbjct: 534 EEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCG 590

Query: 272 TYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFR- 330
              + V HD   LD +  ++    G+        L   V++         + + ++ F+ 
Sbjct: 591 ITSVIVSHDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAQSYYELGASDLEFKF 650

Query: 331 QEALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSF--SDSEILVMMGENG 388
            E      V  +++   + +  +F YP   + Q      +   SF  S S  + ++G NG
Sbjct: 651 PEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKPQ------ISDISFQCSLSSRIAVIGPNG 704

Query: 389 TGKTTLIKLLAGALSPDDGQ 408
            GK+TLI +L G L P  G+
Sbjct: 705 AGKSTLINVLTGELLPTSGE 724

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 54/118 (45%), Gaps = 2/118 (1%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQF 442
           + G NG GK+TL++ +A      DG   P+  +++  +            L F       
Sbjct: 461 LCGPNGAGKSTLMRAIANGQV--DGFPTPEECMTVYVEHDIDGTHADTSVLDFVVSSEVG 518

Query: 443 LNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
                   +V+    E +I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 519 TKEAITAKLVEFGFTEEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD
Sbjct: 870 LTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACSWQRPHLIVLDEPTNYLD 928

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ 
Sbjct: 884 LDAELVSHSRIRGLSGG--QKVKLVLAACSWQRPHLIVLDEPTNYLDRDSLGALSKALKA 941

Query: 513 F 513
           F
Sbjct: 942 F 942

>YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongation
           factor EF-3A, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 86/191 (45%), Gaps = 8/191 (4%)

Query: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
           + ALSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I++ 
Sbjct: 541 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 597

Query: 279 HDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFR-QEALQFR 337
           HD   LD + +++    G+            V++         + + ++ F+  E     
Sbjct: 598 HDSVFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSNTDLEFKFPEPGYLE 657

Query: 338 MVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKL 397
            V  +++   +     F YP   + Q   + ++       S I V +G NG GK+TLI +
Sbjct: 658 GVKTKQKAIVKVTNMEFQYPGTSKPQ---ITDINFQCSLSSRIAV-IGPNGAGKSTLINV 713

Query: 398 LAGALSPDDGQ 408
           L G L P  G+
Sbjct: 714 LTGELLPTSGE 724

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +    ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ 
Sbjct: 884 LDPEIVSHSRIRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKE 941

Query: 513 F 513
           F
Sbjct: 942 F 942

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
           + +I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 534 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT 576

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD
Sbjct: 870 LTRKEIEEHCSMLGLDPEIVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD 928

>CAGL0K10472g 1020016..1022274 highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 111/481 (23%), Positives = 191/481 (39%), Gaps = 105/481 (21%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRLERSQ 199
           Q +    + +E      K+ E+  +  ++ + +DN    +   + ++ E L+ +  ++++
Sbjct: 285 QLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEKLVDMESDKAE 344

Query: 200 DDAKYVIKALDLQ-HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV---- 254
             A  ++  L       ++   + SGG   R ++  +   + D+ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIA 404

Query: 255 ------KQRLNAALVI---RSLLNATTYVISVEHDLSVLDYL--SDFVCILY-------G 296
                 K   +  L +   R+ LN     I  +H+   LDY    DF             
Sbjct: 405 YLAEYLKSYPSTVLTVSHDRAFLNEVATDIIYQHN-ERLDYYRGQDFDTFYTTKEERRKN 463

Query: 297 VPSVY-GVVTLPSSVREGINIFLEGHIPSENMRFR---------------QEALQFRMVD 340
               Y   +     ++E I+ F      S   + R               ++++ F+  D
Sbjct: 464 AQREYDNQMAYRKHLQEFIDKFRYNAAKSSEAQSRIKKLEKLPVLEPPEQEKSIDFKFPD 523

Query: 341 AQEQ----LEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIK 396
            ++     ++ +D   SF Y   K    D  L+++     DS I  ++G NG GKTTL+K
Sbjct: 524 CEKLSPPIIQLQDV--SFGYSPDKLLLKDVNLDIQM----DSRI-ALVGANGCGKTTLLK 576

Query: 397 LLAGALSPDDG--QKVPKLNVSMKPQK--------------IAPKFPGTVRQLFFKRIRG 440
           ++   L P  G   + P+L +    Q               ++  FPG   + + +R  G
Sbjct: 577 VMLEQLRPLSGYVSRNPRLRIGYFTQHHVDSMDLSTSAVDWMSKTFPGKTDEEY-RRHLG 635

Query: 441 QFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSAYLD 499
            F        +   L +     Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD
Sbjct: 636 SF-------GITGTLGL-----QKMQLLSGGQKSRVAFAALCLNNPH-ILILDEPSNHLD 682

Query: 500 S 500
           +
Sbjct: 683 T 683

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 78/180 (43%), Gaps = 29/180 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKVMLEQLRPLSGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
             +    VD + +   G   K  E  +  L      +  +   L LQ +       LSGG
Sbjct: 610 --LSTSAVDWMSKTFPG---KTDEEYRRHL-----GSFGITGTLGLQKM-----QLLSGG 654

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           +  R A    C+    + + DEPS++LD         ++ ++ N T  ++ V HD+SV++
Sbjct: 655 QKSRVAFAALCLNNPHILILDEPSNHLDTT---GIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 463 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKSY----PSTVL 418

Query: 523 LVEHD 527
            V HD
Sbjct: 419 TVSHD 423

>AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W
           (HEF3) - SH] complement(291808..294942) [3135 bp, 1044
           aa]
          Length = 1044

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 130/309 (42%), Gaps = 39/309 (12%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
           R  +  GL G NG GKST ++ +A       G+ D  P  QD        E +  + +  
Sbjct: 454 RRARRYGLCGPNGAGKSTLMRAIAN------GQVDGFPT-QD--------ECRTVYVEHD 498

Query: 161 EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVG 220
            D  +A      +D + +   G  + + E  KLR     D+            ++   + 
Sbjct: 499 IDGTQA--DTSVLDFVFQGDVGTREVITE--KLREFGFSDE------------MIAMPIM 542

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHD 280
           +LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I V HD
Sbjct: 543 SLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVSHD 599

Query: 281 LSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFR-QEALQFRMV 339
              LD +  ++    G+        L   V++         + + ++ F+  E      V
Sbjct: 600 SGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASDLEFKFPEPGFLEGV 659

Query: 340 DAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA 399
             +++   + +  SF YP   + Q   + ++       S I V+ G NG GK+TLI +L 
Sbjct: 660 KTKQKAIVKVSNMSFQYPGTSKPQ---IADINFQCSLSSRIAVI-GPNGAGKSTLINVLT 715

Query: 400 GALSPDDGQ 408
           G L P  G+
Sbjct: 716 GELLPTTGE 724

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
           + +I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 534 DEMIAMPIMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L+ E +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ 
Sbjct: 884 LEAELVSHSRIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKA 941

Query: 513 F 513
           F
Sbjct: 942 F 942

>KLLA0A10857g complement(941784..944042) highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 106/477 (22%), Positives = 201/477 (42%), Gaps = 97/477 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQN------YF 156
           G+  GLVG NGIGKST LK L+ +++ N+ ++      +  IR      LQ+      + 
Sbjct: 225 GRRYGLVGQNGIGKSTLLKALS-RRELNVPKHISVLHVEQEIRGDETKALQSVLDADVWR 283

Query: 157 TKMLEDNIKAIIKPQYVDNIPRA-----------------IKGPVQKVGE-LLKLRLERS 198
            ++L +  K   + Q ++N+ +                  ++  ++++ E L+ +  +++
Sbjct: 284 KQLLSEESKINERLQEIENLRKEFNEESLEVKKLDNERTDLEEHLEQISEKLIDMESDKA 343

Query: 199 QDDAKYVIKALDLQ-HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           +  A  ++  L       ++   + SGG   R ++  +   + D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP-- 401

Query: 258 LNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYG----------VPSVYGVVT-- 305
            + A +   L      V+ V HD + L+ ++  +   +             + Y      
Sbjct: 402 -SIAYLAEYLKTYPATVLVVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYATKEER 460

Query: 306 LPSSVREGIN-IFLEGHIPSENMRFRQEALQFRMVDAQ-EQLE--------AEDATRSFA 355
             ++ RE  N +    H+     ++R  A + +   ++ ++LE         E+   +F 
Sbjct: 461 RKTAQREYENQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPILEPPEEEKVVNFH 520

Query: 356 YPSMKRTQGDFV-LNVESGSFSDSEILV--------------MMGENGTGKTTLIKLLAG 400
           +P  ++     + L   S S+ +S+ L+              ++G NG GKTTL+K++  
Sbjct: 521 FPDCEKLSPPIIQLQDVSFSYKESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMME 580

Query: 401 ALSPDDG--QKVPKLNVSMKPQK--------------IAPKFPGTVRQLFFKRIRGQFLN 444
            L P  G   + P+L +    Q               ++  FPG   +  ++R  G F  
Sbjct: 581 QLRPTKGFVSRNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEE-YRRHLGAF-- 637

Query: 445 PQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAI-VLALGLPADIYLIDEPSAYLDS 500
                 +   L I     Q +Q LSGG+  RVA   L L  P  I ++DEPS +LD+
Sbjct: 638 -----GISGSLGI-----QRMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDT 683

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 ISLVGANGCGKTTLLKVMMEQLRPTKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
             +    VD +  A  G   K  E  +  L      A  +  +L +Q +       LSGG
Sbjct: 610 --LNQSAVDWMSTAFPG---KTDEEYRRHL-----GAFGISGSLGIQRM-----QLLSGG 654

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           +  R A    C+    + + DEPS++LD    L+A  ++ +L +    V+ V HD+SV++
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LVDALKSFNGGVLMVSHDISVIN 711

Query: 286 YLSDFVCILYG 296
            + + + +  G
Sbjct: 712 SVCNEIWVSEG 722

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 463 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVL 418

Query: 523 LVEHD 527
           +V HD
Sbjct: 419 VVSHD 423

>YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongation
           factor EF-3B, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 129/309 (41%), Gaps = 43/309 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ D  P   +    +   ++ N  + M   
Sbjct: 456 GRRYGLCGPNGAGKSTLMRSIAN------GQVDGFPTQDECRTVYVEHDIDNTHSDM--- 506

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGAL 222
              +++   Y  N+     G    +   LK   E    D            +++  + +L
Sbjct: 507 ---SVLDFVYSGNV-----GTKDVITSKLK---EFGFSD-----------EMIEMPIASL 544

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLS 282
           SGG   + A+  + +++AD+ + DEP+++LD    +N   ++  L       + V HD  
Sbjct: 545 SGGWKMKLALARAVLKDADILLLDEPTNHLDT---VNVEWLVNYLNTCGITSVIVSHDSG 601

Query: 283 VLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQF-RMVDA 341
            LD +  ++    G+        L   V++         + + ++ F+     +   V  
Sbjct: 602 FLDKVCQYIIHYEGLKLRKYKGNLSEFVQKCPTAQSYYELGASDLEFQFPTPGYLEGVKT 661

Query: 342 QEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSF--SDSEILVMMGENGTGKTTLIKLLA 399
           +++   + +  +F YP   + Q      V   +F  S S  + ++G NG GK+TLI +L 
Sbjct: 662 KQKAIVKVSNMTFQYPGTTKPQ------VSDVTFQCSLSSRIAVIGPNGAGKSTLINVLT 715

Query: 400 GALSPDDGQ 408
           G L P  G+
Sbjct: 716 GELLPTSGE 724

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
           + +I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDT 576

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 3/97 (3%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD 
Sbjct: 870 LTRKEIELHCAMLGLDSELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD- 928

Query: 255 KQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFV 291
             R +   + ++L      VI + H       L+D V
Sbjct: 929 --RDSLGALSKALKAFEGGVIIITHSAEFTKNLTDEV 963

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ 
Sbjct: 884 LDSELVSHSRIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKA 941

Query: 513 F 513
           F
Sbjct: 942 F 942

>Scas_703.17
          Length = 1046

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 88/192 (45%), Gaps = 12/192 (6%)

Query: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
           + ALSGG   + A+  + ++ AD+ + DEP+++LD    +N   ++  L       I V 
Sbjct: 542 ISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT---INVKWLVDYLNTCGITSIIVS 598

Query: 279 HDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQF-R 337
           HD   LD +  ++    G+        L   +++  +      + + ++ F+  A  +  
Sbjct: 599 HDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFIKKCPSAKSYSELGASDLEFQFPAPGYLE 658

Query: 338 MVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSF--SDSEILVMMGENGTGKTTLI 395
            V  +++   + +  +F YP   + Q      +   SF  S S  + ++G NG GK+TLI
Sbjct: 659 GVKTKQKAIVKVSNMTFQYPRTSKPQ------ISDVSFQCSLSSRIAVIGPNGAGKSTLI 712

Query: 396 KLLAGALSPDDG 407
            +L G L P  G
Sbjct: 713 NVLTGELLPTSG 724

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           +  I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    I  K +  ++   
Sbjct: 535 DETINMPISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT----INVKWLVDYLNTC 590

Query: 518 KKTAFLVEHD 527
             T+ +V HD
Sbjct: 591 GITSIIVSHD 600

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +   +++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ 
Sbjct: 885 LDSELVSHSQIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKA 942

Query: 513 F 513
           F
Sbjct: 943 F 943

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD
Sbjct: 871 LTRKEIEEHCSMLGLDSELVSHSQIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD 929

>KLLA0F12210g 1125630..1128764 highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 translation
           elongation factor eEF3 P6.7.f5.1, start by similarity
          Length = 1044

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 86/193 (44%), Gaps = 12/193 (6%)

Query: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
           + +LSGG   + A+  + ++ AD+ + DEP+++LD    +N   ++  L       I V 
Sbjct: 541 IASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVNWLVEYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFR-QEALQFR 337
           HD   LD +  ++    G+        L   V++         + +  + FR  E     
Sbjct: 598 HDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASELEFRFPEPGYLE 657

Query: 338 MVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSF--SDSEILVMMGENGTGKTTLI 395
            V  +++   + +  +F YP   + Q      +   SF  S S  + ++G NG GK+TLI
Sbjct: 658 GVKTKQKAIVKVSNMTFQYPGTAKPQ------ISDISFQCSLSSRIAVIGPNGAGKSTLI 711

Query: 396 KLLAGALSPDDGQ 408
            +L G L P  G+
Sbjct: 712 NVLTGELLPTVGE 724

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 4/119 (3%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQF 442
           + G NG GK+TL++ +A         +     V ++      +   +V    F    G  
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQEECRTVYVEHDIDGTQADTSVVDFVFS---GNV 517

Query: 443 LNPQFQTDVVKPLKI-ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
                 TD ++     + +I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 518 GTKDVITDKLREFGFSDEMIAMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD
Sbjct: 870 LTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD 928

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ 
Sbjct: 884 LDAELVSHSRIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKA 941

Query: 513 F 513
           F
Sbjct: 942 F 942

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG 132
           + ++G NG GKST + +L G+  P +G
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTVG 723

>Kwal_34.16240
          Length = 752

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 110/510 (21%), Positives = 201/510 (39%), Gaps = 113/510 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEWQD 142
           G   G+VG NGIGKST L+ L+                    G +   L    D   W+ 
Sbjct: 225 GHRYGIVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALNSVLDADVWRK 284

Query: 143 IIRYF------RGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRL 195
            +         R  E++   ++  ED++++    + +DN    ++  ++++ E L+ +  
Sbjct: 285 QLLSEESKINERLQEIEKLRSEFEEDSLES----KKLDNEREDLESHLEQISEKLIDMES 340

Query: 196 ERSQDDAKYVIKALDLQ-HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPS----- 249
           ++++  A  ++  L       ++   + SGG   R ++  +   + D+ + DEPS     
Sbjct: 341 DKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDV 400

Query: 250 ---SYLDVKQRLNAALVI-----RSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
              +YL    +   A V+     R+ LN     I  +H+  +  Y        Y      
Sbjct: 401 PSIAYLSEYLKTYPATVVVVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYATKEE- 459

Query: 302 GVVTLPSSVREGIN-IFLEGHIPSENMRFRQEALQFRMVDAQ-EQLE--------AEDAT 351
                 ++ RE  N +    H+     ++R  A + +   ++ ++LE         E+  
Sbjct: 460 ---RRKNAQREYENQLAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEEEKN 516

Query: 352 RSFAYPSMKRTQGDFVLNVESGSFS-----------------DSEILVMMGENGTGKTTL 394
             F +P  ++     ++ ++  SF                  DS I  ++G NG GKTTL
Sbjct: 517 IDFHFPECEKLSPP-IIQLQDVSFGFDPKQLLLKDVNLDVQMDSRI-ALVGANGCGKTTL 574

Query: 395 IKLLAGALSPDDG--QKVPKLNVSMKPQK--------------IAPKFPGTVRQLFFKRI 438
           +K+L   L P  G   + P+L V+   Q               ++  FPG   +  ++R 
Sbjct: 575 LKILMEQLRPIQGYVSRNPRLRVAYFTQHHVDSMDLNTSAVDWMSTTFPGKTDEE-YRRH 633

Query: 439 RGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAI-VLALGLPADIYLIDEPSAY 497
            G F        +   L +     Q++Q LSGG+  RVA   L L  P  I ++DEPS +
Sbjct: 634 LGAF-------GITGSLGL-----QKMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNH 680

Query: 498 LDSEQRIICSKVIRRFILHNKKTAFLVEHD 527
           LD+         +++F         +V HD
Sbjct: 681 LDTAGLDALMDALKKFT----GGVLMVSHD 706

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 80/180 (44%), Gaps = 29/180 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LKIL  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLR-----------VAYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
             +    VD +     G   K  E  +  L      A  +  +L LQ +       LSGG
Sbjct: 610 --LNTSAVDWMSTTFPG---KTDEEYRRHL-----GAFGITGSLGLQKM-----QLLSGG 654

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           +  R A    C+    + + DEPS++LD    L+A  ++ +L   T  V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LMDALKKFTGGVLMVSHDISVID 711

>YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a protein
           complex required for activation of Gcn2p protein kinase
           in response to amino acid starvation, member of the
           non-transporter group within the ATP-binding cassette
           (ABC) superfamily [2259 bp, 752 aa]
          Length = 752

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 115/511 (22%), Positives = 205/511 (40%), Gaps = 115/511 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRY------------DDPPEWQ-----DIIR 145
           G   GLVG NGIGKST L+ L+ +++ N+ ++            DD    Q     D+ R
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALS-RRELNVPKHVSILHVEQELRGDDTKALQSVLDADVWR 283

Query: 146 YFRGSELQNYFTKMLEDNI------KAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRLERS 198
               SE      ++ E ++      +  ++ + +DN    +   + ++ + L+ +  +++
Sbjct: 284 KQLLSEEAKINERLKEMDVLRQEFEEDSLEVKKLDNEREDLDNHLIQISDKLVDMESDKA 343

Query: 199 QDDAKYVIKALDLQ-HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV--- 254
           +  A  ++  L       ++   + SGG   R ++  +   + D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSI 403

Query: 255 -------KQRLNAALVI---RSLLNATTYVISVEHDLSVLDYL--SDFVCIL-------- 294
                  K   N  L +   R+ LN     I  +H+   LDY    DF            
Sbjct: 404 AYLAEYLKTYPNTVLTVSHDRAFLNEVATDIIYQHN-ERLDYYRGQDFDTFYTTKEERRK 462

Query: 295 -----YGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQ-FRMVDAQEQLEAE 348
                Y    VY        ++E I+ +      S+  + R + L+   +++  EQ    
Sbjct: 463 NAQREYDNQMVY-----RKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEQ---- 513

Query: 349 DATRSFAYPSMKRTQGDFV-LNVESGSFSDSEILV--------------MMGENGTGKTT 393
           D T  F +P   +     + L   S  + ++ +L+              ++G NG GKTT
Sbjct: 514 DKTIDFKFPECDKLSPPIIQLQDVSFGYDENNLLLKDVNLDVQMDSRIALVGANGCGKTT 573

Query: 394 LIKLLAGALSPDDG--QKVPKLNVSMKPQK--------------IAPKFPGTVRQLFFKR 437
           L+K++   L P  G   + P+L +    Q               ++  FPG   + + +R
Sbjct: 574 LLKIMMEQLRPLKGFVSRNPRLRIGYFTQHHVDSMDLTTSAVDWMSKSFPGKTDEEY-RR 632

Query: 438 IRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSA 496
             G F        +   L +     Q++Q LSGG+  RVA   L L  P  I ++DEPS 
Sbjct: 633 HLGSF-------GITGTLGL-----QKMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSN 679

Query: 497 YLDSEQRIICSKVIRRFILHNKKTAFLVEHD 527
           +LD+       + ++ F         +V HD
Sbjct: 680 HLDTTGLDALVEALKNF----NGGVLMVSHD 706

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 81/180 (45%), Gaps = 29/180 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LKI+  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
             +    VD + ++  G   K  E  +  L      +  +   L LQ +       LSGG
Sbjct: 610 --LTTSAVDWMSKSFPG---KTDEEYRRHL-----GSFGITGTLGLQKM-----QLLSGG 654

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           +  R A    C+    + + DEPS++LD    L+A  ++ +L N    V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVEALKNFNGGVLMVSHDISVID 711

>Scas_618.3
          Length = 793

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 90/190 (47%), Gaps = 33/190 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQ-NYFTKMLEDNI 164
           + LVG NG GK+T LK++  + +P  G               R   L+  YFT+   D++
Sbjct: 602 IALVGANGCGKTTLLKVMMEELRPTKGFVS------------RNGRLRIGYFTQHHVDSM 649

Query: 165 KAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK-RDVGALS 223
              +    VD + +A  G              ++ ++ ++ + +  +   L  + +  LS
Sbjct: 650 D--LTTSAVDWMSKAYPG--------------KTDEEYRHHLGSFGITGTLGLQKMELLS 693

Query: 224 GGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSV 283
           GG+  R A    C+    + + DEPS++LD    L+A  ++ SL N +  V+ V HD+S+
Sbjct: 694 GGQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVESLKNFSGGVLMVSHDISI 750

Query: 284 LDYLSDFVCI 293
           +D++ + + +
Sbjct: 751 IDHVCNEIWV 760

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 100/483 (20%), Positives = 188/483 (38%), Gaps = 109/483 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEWQD 142
           G   GLVG NGIGKST L+ L+                    G +   L    D   W+ 
Sbjct: 266 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHVSILHVEQELRGDETLALQSVLDADVWRK 325

Query: 143 IIRYF------RGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGE-LLKLRL 195
            +         R  E+    ++  ED+++     + +DN    +   + ++ E L  +  
Sbjct: 326 QLLSEEAKINERLKEMDKLRSEFEEDSLEV----KKLDNEREDLDKHLIQIDEKLADMES 381

Query: 196 ERSQDDAKYVIKALDLQ-HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
           ++++  A  ++  L       ++   + SGG   R ++  +   + D+ + DEPS+ LDV
Sbjct: 382 DKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDV 441

Query: 255 KQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVY-------GVVTLP 307
               + A +   L    + V++V HD + L+ ++  +   +     Y          T  
Sbjct: 442 P---SIAYLAEYLKTYPSTVLTVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYTTK 498

Query: 308 SSVREGINIFLEG------HIPSENMRFRQEALQFRMVDAQEQLE-----------AEDA 350
              R+      E       H+     +FR  A   +  +AQ +++            E+ 
Sbjct: 499 EERRKNAQREYENQMAYRKHLQEFIDKFRYNAA--KSSEAQSRIKKLEKLPVLEPPEEEK 556

Query: 351 TRSFAYPSMKRTQGDFVLNVESGSFSDSEI----------------LVMMGENGTGKTTL 394
           T +F +P  ++     ++ ++  SF   E                 + ++G NG GKTTL
Sbjct: 557 TITFKFPDCEKLSPP-IIQLQDVSFGYDENNLLLNDVNLDVQMDSRIALVGANGCGKTTL 615

Query: 395 IKLLAGALSPDDG---------------QKVPKLNVSMKP-QKIAPKFPGTVRQLFFKRI 438
           +K++   L P  G                 V  ++++      ++  +PG   + +   +
Sbjct: 616 LKVMMEELRPTKGFVSRNGRLRIGYFTQHHVDSMDLTTSAVDWMSKAYPGKTDEEYRHHL 675

Query: 439 RGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAI-VLALGLPADIYLIDEPSAY 497
            G F        +   L +     Q+++ LSGG+  RVA   L L  P  I ++DEPS +
Sbjct: 676 -GSF-------GITGTLGL-----QKMELLSGGQKSRVAFAALCLNNPH-ILVLDEPSNH 721

Query: 498 LDS 500
           LD+
Sbjct: 722 LDT 724

>Kwal_0.327
          Length = 1019

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 82/184 (44%), Gaps = 24/184 (13%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKF 426
           +LN  SGS    EI+ +MG +G GKTTL+ +LA            K+N S   ++   K 
Sbjct: 384 ILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSIKINGSEITKQNLSKI 443

Query: 427 PGTVRQLFF----------------KRI--RGQFLNPQFQT-DVVKPLKIESIIDQEV-- 465
            G V Q  F                 R+  +  F+  Q +   V++ L+I  I D+ +  
Sbjct: 444 AGFVDQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQKRVYQVLEELRILDIKDRIIGD 503

Query: 466 ---QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
              + +SGGE +RV+I   L     +  +DEP++ LDS       + + R  LH  +T  
Sbjct: 504 DLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECLVRLALHYNRTLI 563

Query: 523 LVEH 526
           L  H
Sbjct: 564 LSIH 567

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 87/218 (39%), Gaps = 31/218 (14%)

Query: 74  NLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILA-----GKQK 128
           N+  N+  E   R   N        + +PG+++ L+G +G GK+T L ILA     GK  
Sbjct: 370 NIEYNIRSEKGERMILNGIS----GSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKAS 425

Query: 129 PNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVG 188
            ++         Q++ +     + +N+    L   +   +    +  +PR          
Sbjct: 426 GSIKINGSEITKQNLSKIAGFVDQENFLLPTL--TVYETVLNSALLRLPR---------- 473

Query: 189 ELLKLRLERSQDDAKYVIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVY 243
              KL   + Q     V++ L +  +  R +G      +SGGE +R +I    V    V 
Sbjct: 474 ---KLSFVQKQKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVL 530

Query: 244 MFDEPSSYLDVKQRLNA--ALVIRSLLNATTYVISVEH 279
             DEP+S LD     N    LV  +L    T ++S+  
Sbjct: 531 FLDEPTSGLDSNNANNVIECLVRLALHYNRTLILSIHQ 568

>Kwal_27.12711
          Length = 1246

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 94/209 (44%), Gaps = 39/209 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYDDPPEWQDIIRYFRGSELQNYFTK- 158
           G ++ ++G +G GK+T L +LA K    L   G +   PE         G    +Y T+ 
Sbjct: 46  GSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPETSS----HSGEITTSYLTQQ 101

Query: 159 -MLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERS--QDDAKYVIKALDLQHVL 215
            +L  N+      QY  +               LKL+  +S  Q   + +I  L L+   
Sbjct: 102 DILASNLTCRETLQYAAD---------------LKLQSSKSERQGLVEELIAELGLKDCA 146

Query: 216 KRDVGA-----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNA 270
              VG+     LSGGE +R +IG+  +    +   DEP++ LD     +A LV+R+L   
Sbjct: 147 NTLVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDA---YSAYLVVRTLRKL 203

Query: 271 T-----TYVISVEHDLSVLDYLSDFVCIL 294
           +     ++++S+    + + +L D VCI+
Sbjct: 204 SHKGGRSFIMSIHQPRADILFLLDQVCIM 232

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 77/163 (47%), Gaps = 20/163 (12%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN-LGRYDDPPEWQDIIRYFRGSELQNYFTKM 159
           +P  +  ++G +G GKST L  L+GK     L  ++          +F  S++    T+ 
Sbjct: 674 QPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGS-----IFFNNSQV----TQD 724

Query: 160 LEDNIKAIIKPQYVDNI-PRAIKGPVQKVGELLKLRLERSQDDAKYV---IKALDLQHVL 215
           +  ++ + + PQ  D++ P+            L+L   ++++    V   I  L L+H  
Sbjct: 725 IFKDVCSFV-PQDDDHLLPQLTVRETLLFAADLRLHHMKARNRISRVDDLISELGLKHCE 783

Query: 216 KRDVGA-----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
              VG+     +SGGE +R ++G   + ++ + + DEP+S LD
Sbjct: 784 NTLVGSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLD 826

 Score = 35.8 bits (81), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 79/181 (43%), Gaps = 29/181 (16%)

Query: 375 FSDSEILVMMGENGTGKTTLIKLLAG-------ALSPDDG----------QKVPKLNVSM 417
           F    I  +MG +G+GK+TL+  L+G       A     G          Q + K   S 
Sbjct: 673 FQPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGSIFFNNSQVTQDIFKDVCSF 732

Query: 418 KPQKIAPKFPG-TVRQ--LFFKRIRGQFLNPQFQT----DVVKPLKIE----SIIDQE-V 465
            PQ      P  TVR+  LF   +R   +  + +     D++  L ++    +++  E V
Sbjct: 733 VPQDDDHLLPQLTVRETLLFAADLRLHHMKARNRISRVDDLISELGLKHCENTLVGSELV 792

Query: 466 QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVE 525
           + +SGGE +R+++   L   + I L+DEP++ LDS       +V+        KT  L  
Sbjct: 793 KGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDSFTSFKILEVLTNISRKPGKTVILTI 852

Query: 526 H 526
           H
Sbjct: 853 H 853

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 39/190 (20%), Positives = 84/190 (44%), Gaps = 23/190 (12%)

Query: 358 SMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALS------------PD 405
           S+  + G  ++N  S +     I+ ++G +G+GKTTL+ +LA  +S            P+
Sbjct: 26  SVLASNGTAIVNDISMTVPSGSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPE 85

Query: 406 DGQKVPKLNVSMKPQKIAPKFPGTVRQL--FFKRIRGQFLNPQFQ---TDVVKPLKIESI 460
                 ++  S   Q+       T R+   +   ++ Q    + Q    +++  L ++  
Sbjct: 86  TSSHSGEITTSYLTQQDILASNLTCRETLQYAADLKLQSSKSERQGLVEELIAELGLKDC 145

Query: 461 IDQEVQH-----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
            +  V       LSGGE +R++I + +     +  +DEP+  LD+    +  + +R+ + 
Sbjct: 146 ANTLVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDAYSAYLVVRTLRK-LS 204

Query: 516 HNKKTAFLVE 525
           H    +F++ 
Sbjct: 205 HKGGRSFIMS 214

>Scas_712.29
          Length = 610

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 118/490 (24%), Positives = 197/490 (40%), Gaps = 88/490 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY-----DDPPEWQDIIRYFRGSELQN 154
           G+  GL+G NG GKST LK LA ++ P   N+  Y      +P E+  +    R  E QN
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVVR--EAQN 164

Query: 155 YFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDD-----AKYVIKAL 209
              K LED ++  I  +          GP  ++ E L  R++    D     A  ++  L
Sbjct: 165 EL-KRLEDLVEKYIVEE----------GPECELLEPLYERMDSLDPDTFESRAAVILIGL 213

Query: 210 DL--QHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSL 267
               + +LK+    +SGG   R A+  +   +  + + D+P+++LD    L A + +   
Sbjct: 214 GFNSKTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLD----LEACVWLEEY 268

Query: 268 L---NATTYVISVEHDL------SVLDYLSDFVCILYGVPSVYGVVTLPSSVREG----- 313
           L   + T  ++S   D       ++LD  +  +    G    Y          +      
Sbjct: 269 LKRFDRTLVLVSHSQDFLNGVCTNMLDMRAQKLTAYGGNYDSYWKTRSELETNQTKQYNK 328

Query: 314 -------INIFLEGHIPSENM----RFRQEALQFRMVDAQEQLEAEDATRSFAYPSMKRT 362
                  I  F+       N+    + RQ+ L     D   Q    D   SF +P ++R 
Sbjct: 329 QQEEIQHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQPVQADKVFSFRFPPVERL 388

Query: 363 ------------------QGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSP 404
                             + +   N++ G   DS I  ++G NG GK+TL+K++ G L+P
Sbjct: 389 PPPVLAFDSISFSYDGNPENNLYENLDFGVDMDSRI-ALVGPNGVGKSTLLKIMTGELTP 447

Query: 405 DDGQ--KVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIID 462
             G+  +   + + +  Q    +   T   L F R +   ++  FQ    +  +     +
Sbjct: 448 QSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLGRYGLTGE 507

Query: 463 -QEVQ--HLSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            Q VQ   LS G+  RV   +LAL  P ++ L+DEP+  LD       ++ I  F     
Sbjct: 508 GQTVQMGTLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLAEAINEF----N 562

Query: 519 KTAFLVEHDF 528
               +V HDF
Sbjct: 563 GGVVVVSHDF 572

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 80/179 (44%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALSP-DDGQKVPKLNVSMKPQKI-APKFPGTVRQLFFKRIRG 440
           ++GENG GK+T +K LA    P  +   +  L+   +P +  A ++     Q   KR+  
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQNELKRLED 171

Query: 441 -------------QFLNPQFQ-TDVVKPLKIES--------------IIDQEVQHLSGGE 472
                        + L P ++  D + P   ES               I ++ + +SGG 
Sbjct: 172 LVEKYIVEEGPECELLEPLYERMDSLDPDTFESRAAVILIGLGFNSKTILKKTKDMSGGW 231

Query: 473 LQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  LV H  DF+
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 79/189 (41%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+  P  GR       + +  Y + S+ Q   TK   + ++
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVK-LGVYSQHSQDQLDLTKSALEFVR 482

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
                   D  P   +      G+L +  L       +               +G LS G
Sbjct: 483 --------DKYPNISQDFQYWRGQLGRYGLTGEGQTVQ---------------MGTLSEG 519

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           +  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  +LD
Sbjct: 520 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEFNGG---VVVVSHDFRLLD 576

Query: 286 YLSDFVCIL 294
            ++  + ++
Sbjct: 577 KIAKDIFVV 585

>Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement
          Length = 608

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 119/504 (23%), Positives = 199/504 (39%), Gaps = 116/504 (23%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY--DDPPEWQDIIRY-FRGSELQNYF 156
           G+  GL+G NG GKST LK +A ++ P   N+  Y  D+P E  ++    +  +E QN  
Sbjct: 105 GRHYGLLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNEL 164

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDL----- 211
            K LED ++ II             GP  ++ E L  +++ S D   +  +A  +     
Sbjct: 165 -KRLEDLVEKIILED----------GPESELLEPLYEKMD-SMDPNTFESRAAVILIGLG 212

Query: 212 --QHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLN 269
                + +    +SGG   R A+  +   +  + + D+P+++LD    L A + +   L 
Sbjct: 213 FNSKTITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLD----LEACVWLEEYLK 268

Query: 270 A-TTYVISVEHDLSVLDYL-SDFVCILYGVPSVYG-----VVTLPSSVREG--------- 313
                ++ V H    L+ + ++ + +     + YG      V   S +            
Sbjct: 269 RFDRTLVLVSHSQDFLNGVCTNMIDMRLQQLTAYGGNYDSYVKTRSELETNQMKQYSKQQ 328

Query: 314 -----INIFLEGHIPSENM----RFRQEALQFRMVDAQEQLEAEDATRSFAYPSMKRTQG 364
                I  F+       N+    + RQ+ L     D   Q    D   SF +P ++R   
Sbjct: 329 EEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLVQAVVADKVFSFRFPPVERLPP 388

Query: 365 DFVLNVESGSFS-------------------DSEILVMMGENGTGKTTLIKLLAGALSPD 405
             VL  +  SFS                   DS I  ++G NG GK+TL+K++ G L P 
Sbjct: 389 P-VLAFDDISFSYDDNPENNLYEKLNFGVDMDSRI-ALVGPNGVGKSTLLKIMTGQLMPQ 446

Query: 406 DGQ---------------KVPKLNVSMKP-QKIAPKFPGTVRQLFFKRIRGQF----LNP 445
            G+                  +L+++  P + +  K+P   +   F+  RGQ     L  
Sbjct: 447 SGRVSRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDKYPNISQD--FQYWRGQLGRYGLTG 504

Query: 446 QFQTDVVKPLKIESIIDQEVQHLSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRI 504
           + QT              ++  LS G+  RV   +LAL  P ++ L+DEP+  LD     
Sbjct: 505 EAQT-------------SQMGTLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTID 550

Query: 505 ICSKVIRRFILHNKKTAFLVEHDF 528
             +  I  F         +V HDF
Sbjct: 551 SLADAINEF----NGGVVVVSHDF 570

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 81/179 (45%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALSP-DDGQKVPKLNVSMKPQKI-APKFPGTVRQLFFKRIR- 439
           ++GENG GK+T +K +A    P  +   V  L+   +P ++ A  +  T  Q   KR+  
Sbjct: 110 LLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNELKRLED 169

Query: 440 ------------GQFLNPQFQ-TDVVKPLKIES--------------IIDQEVQHLSGGE 472
                        + L P ++  D + P   ES               I ++ + +SGG 
Sbjct: 170 LVEKIILEDGPESELLEPLYEKMDSMDPNTFESRAAVILIGLGFNSKTITKKTKDMSGGW 229

Query: 473 LQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  LV H  DF+
Sbjct: 230 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 284

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 81/197 (41%), Gaps = 43/197 (21%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+  P  GR         + R+                ++K
Sbjct: 422 IALVGPNGVGKSTLLKIMTGQLMPQSGR---------VSRH---------------THVK 457

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALD----LQHVLKRDVGA 221
             +  Q+  +     K P+    E ++ +      D +Y    L             +G 
Sbjct: 458 LGVYSQHSQDQLDLTKSPL----EFVRDKYPNISQDFQYWRGQLGRYGLTGEAQTSQMGT 513

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY----VISV 277
           LS G+  R    +  +++ +V + DEP++ LD+         I SL +A       V+ V
Sbjct: 514 LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVV 566

Query: 278 EHDLSVLDYLSDFVCIL 294
            HD  +LD ++  + ++
Sbjct: 567 SHDFRLLDKIAQDIFVV 583

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
           cerevisiae YDR011w SNQ2 multidrug resistance protein,
           start by similarity
          Length = 1483

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 92/213 (43%), Gaps = 19/213 (8%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RYDDPPEWQDIIRYFRGSELQNY 155
           RPG++L ++G  G G ST LK +AG+     G      YD   + +D+++YF+   + N 
Sbjct: 169 RPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQ-KDMLKYFKSDVIYN- 226

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVL 215
               ++ +   +   Q +D    A K P +++ +  + +      D    I    L+H  
Sbjct: 227 --GEMDVHFPHLTVQQTLD-FAVACKTPSKRINDFTRQQYIEFIRDLYATI--FGLKHTY 281

Query: 216 KRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLN- 269
              VG      +SGGE +R +I  +      +Y +D  +  LD    L     IR + N 
Sbjct: 282 NTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNL 341

Query: 270 -ATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
             +T +I+V      +    D V ILY    +Y
Sbjct: 342 LKSTALITVYQASENIYETFDKVTILYEGKQIY 374

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 71/178 (39%), Gaps = 32/178 (17%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDG-----------QK------------------ 409
           E+L+++G  G+G +T +K +AG LS   G           QK                  
Sbjct: 172 EMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYFKSDVIYNGEMDV 231

Query: 410 -VPKLNVSMKPQ-KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDV-VKPLKIESIIDQEVQ 466
             P L V       +A K P      F ++   +F+   + T   +K      + D  V+
Sbjct: 232 HFPHLTVQQTLDFAVACKTPSKRINDFTRQQYIEFIRDLYATIFGLKHTYNTKVGDDFVR 291

Query: 467 HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLV 524
            +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR      K TA + 
Sbjct: 292 GVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTALIT 349

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLA 399
           +L+  SG      +  +MGE+G GKTTL+  LA
Sbjct: 855 LLDNVSGYVKPGTLTALMGESGAGKTTLLNTLA 887

>Kwal_33.15561
          Length = 1297

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 82/171 (47%), Gaps = 26/171 (15%)

Query: 379  EILVMMGENGTGKTTLIKLLAGALSPDDGQ-KVPKLNVSMKPQKIAPKFPGTVRQ--LFF 435
            EI+ ++G +G+GK+TL  LL      ++G   +   +++   +K        V Q  LFF
Sbjct: 1088 EIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPLFF 1147

Query: 436  -------------KRIRGQFLNPQFQT----DVVK--PLKIESIIDQEVQHLSGGELQRV 476
                         +++  + +N    T    + V   P ++ S+ID   Q LSGG++QR+
Sbjct: 1148 SGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVID--TQLLSGGQVQRL 1205

Query: 477  AIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHD 527
            AIV AL     + ++DE ++ LD+    I S+ ++  + H   T  +V H 
Sbjct: 1206 AIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHT--TTLVVTHS 1254

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 82/185 (44%), Gaps = 30/185 (16%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
            G+++GL+GT+G GKST   +L        G                G+++  +  K L  
Sbjct: 1087 GEIVGLIGTSGSGKSTLWSLLTRLYPVENGSIS-----------IDGTDINQWDRKALRS 1135

Query: 163  NIKAI-IKPQY-----VDNIPRAIKGPV--QKVGELLKL--RLERSQDDAKYVIKALDLQ 212
             I  +  KP +     ++N+   +   V  ++V ELL     LE      K +   +D Q
Sbjct: 1136 CIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ 1195

Query: 213  HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR-LNAALVIRSLLNAT 271
                     LSGG++QR AI  + +++  + + DE +S LD +   + +  V   L + T
Sbjct: 1196 --------LLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHTT 1247

Query: 272  TYVIS 276
            T V++
Sbjct: 1248 TLVVT 1252

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 96/223 (43%), Gaps = 39/223 (17%)

Query: 333 ALQFRMVDAQEQLEAEDATRSFAYPSMKR--TQGDFVLNVESGSFSDSEILVMMGENGTG 390
           ++   ++  Q Q+  E+   SFAYPS  +     +  L V  G F+      ++G++G+G
Sbjct: 348 SMHLPLLWEQAQISFENV--SFAYPSRSKHPVIKNLNLKVPGGRFT-----FIVGKSGSG 400

Query: 391 KTTLIKLLAGALSPDDGQ-KVPKLNVSMKPQKIAPKFPGTVRQ---LFFKRIRGQFLNPQ 446
           K+T+  LL     P  G  KV  +++    Q+   +    V Q   LF   I+    N Q
Sbjct: 401 KSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKN---NIQ 457

Query: 447 FQTD-------------------VVKPLK--IESIIDQEVQHLSGGELQRVAIVLALGLP 485
             +D                   V++ L   +++II      LSGGE QRVA+  A    
Sbjct: 458 LTSDEHRDDGRLSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRD 517

Query: 486 ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDF 528
           + I ++DE  +  D   + +  + IR +     +T  ++ H+ 
Sbjct: 518 SPILILDEALSAQDRMHKDLLMEAIRFW--RKGRTTIILTHEL 558

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 93/217 (42%), Gaps = 59/217 (27%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPP----EWQDIIRYFRGSELQNYF 156
           G+   +VG +G GKST   +L    +P  G  + +D        QD+   FR   L    
Sbjct: 388 GRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDL---FRSITLVEQN 444

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKY-----------V 205
           + + ED+IK        +NI               +L  +  +DD +            V
Sbjct: 445 SPLFEDSIK--------NNI---------------QLTSDEHRDDGRLSQACQAAMLEGV 481

Query: 206 IKALDLQHVLKRDVGA----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAA 261
           I+  DL   L   +G+    LSGGE QR A+  + V+++ + + DE    L  + R++  
Sbjct: 482 IR--DLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEA---LSAQDRMHKD 536

Query: 262 LV---IRSLLNATTYVISVEHDLSVLDYLS-DFVCIL 294
           L+   IR      T +I + H+L+  D L  DFV ++
Sbjct: 537 LLMEAIRFWRKGRTTII-LTHELN--DILEDDFVLLM 570

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
           Saccharomyces cerevisiae YKL209c STE6, hypothetical
           start
          Length = 1227

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 87/200 (43%), Gaps = 29/200 (14%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ-KVP 411
           SF YP  K    D V +  +     +++  ++G +G+GK+TL  L+        G   + 
Sbjct: 358 SFCYPERKT---DKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLG 414

Query: 412 KLNVSMKPQKIAPKFPGTVRQ---LFFKRIRGQFLNPQFQTDVVKPLKIESI-------- 460
            L++    + I  +    V Q   LF   IR   L     T++   L++E I        
Sbjct: 415 DLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECICKFALLEN 474

Query: 461 --------IDQEVQH----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSK 508
                   +D  +      LSGG+ Q+VA+  A      I L+DEP + +D  QRI+  +
Sbjct: 475 LIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLME 534

Query: 509 VIRRFILHNKKTAFLVEHDF 528
            I+R+   N KT  ++ HD 
Sbjct: 535 NIKRW--RNGKTTVIITHDL 552

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDL 281
           LSGG+ Q+ A+  +  +   + + DEP S +D++QR+     I+   N  T VI + HDL
Sbjct: 494 LSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGKTTVI-ITHDL 552

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 84/178 (47%), Gaps = 25/178 (14%)

Query: 342  QEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGA 401
            Q  +E  + + ++A    K+T  +  + + S     ++I  ++G++G+GK+TLI L+ G 
Sbjct: 989  QPVIEVSNLSFTYAQVHNKKTLTNINMQLYS-----NQIYGIVGKSGSGKSTLINLICGL 1043

Query: 402  LSPDDGQ-KVPKLNVSMKPQKIAPKFPGTVRQ---LFFKRIRGQFLNPQFQT-------D 450
             S  +G   +   +++    K   K    ++Q   L F  IR   L    +T       +
Sbjct: 1044 YSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLN 1103

Query: 451  VVKPLKIESII-------DQEVQH--LSGGELQRVAIVLALGLPADIYLIDEPSAYLD 499
            V++ + ++S I       D ++    LSGG+ QR+ +   +     + ++DE ++ LD
Sbjct: 1104 VLEYVGLKSFIISLNNGLDSKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALD 1161

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 78/179 (43%), Gaps = 19/179 (10%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYD----DPPEWQDIIRYFRGSELQNYFT 157
              Q+ G+VG +G GKST + ++ G    + G  +    D  +W          EL     
Sbjct: 1019 SNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKWST-------KELHKT-V 1070

Query: 158  KMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKR 217
             +L+ N   +++   + N    + G  + VG+   L +        ++I +L+     K 
Sbjct: 1071 ALLQQN--PVLQFDTIRN--NLLYGLTETVGDEHLLNVLEYVGLKSFII-SLNNGLDSKL 1125

Query: 218  DVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK--QRLNAALVIRSLLNATTYV 274
            D   LSGG+ QR  +    ++   V + DE +S LDV   +++N  +  RSL   T  V
Sbjct: 1126 DDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGSRSLAPVTIIV 1184

>KLLA0C04477g complement(409543..413304) similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, start by similarity
          Length = 1253

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 97/215 (45%), Gaps = 26/215 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           GQ++ ++G +G GK+T L +LAGK   ++  YD        I+Y R +  +       ++
Sbjct: 41  GQLMAIIGGSGSGKTTMLNVLAGKTNSSI-NYDGE------IQYSRDAAKEG---SKADE 90

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDA--KYVIKALDLQHVLKRDVG 220
            +      Q+     R       ++   LKL L + +  +  + +I  L L+   +  VG
Sbjct: 91  KVTTAYLTQHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVG 150

Query: 221 -----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSL-----LNA 270
                 LSGGE +R +I +  +    V   DEP++ LD     +A L+I++L        
Sbjct: 151 DSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDA---YSAFLLIKTLKKLCEHGG 207

Query: 271 TTYVISVEHDLSVLDYLSDFVCILY-GVPSVYGVV 304
            T ++S+    S + +  D VC+L  G P   G V
Sbjct: 208 RTIIMSIHQPRSDILFALDQVCLLSKGFPMYCGAV 242

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 81/188 (43%), Gaps = 30/188 (15%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD---------------DGQKV- 410
           ++N  S S  + +++ ++G +G+GKTT++ +LAG  +                 +G K  
Sbjct: 30  IVNNVSFSLPNGQLMAIIGGSGSGKTTMLNVLAGKTNSSINYDGEIQYSRDAAKEGSKAD 89

Query: 411 PKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQF---LNPQFQTDVVKPLKIE--------- 458
            K+  +   Q  A     T R+    RI       L  Q +  +V+ L  E         
Sbjct: 90  EKVTTAYLTQHDALAARLTCRETL--RIAADLKLHLPKQERYSLVEELIAELGLRDCSET 147

Query: 459 SIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            + D   + LSGGE +R++I + +     +  +DEP+  LD+    +  K +++   H  
Sbjct: 148 FVGDSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGG 207

Query: 519 KTAFLVEH 526
           +T  +  H
Sbjct: 208 RTIIMSIH 215

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 72/178 (40%), Gaps = 50/178 (28%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
           RP  +  ++G +G GK++ L +++ +                           N+FTK  
Sbjct: 683 RPNAINAIMGPSGSGKTSLLNLISDRV------------------------CSNFFTKFN 718

Query: 161 EDN---------IKAIIKPQ--YVDNIPRAIKGPVQKVGELLK----LRLE-----RSQD 200
           E           +K++ K    YV      +  P   V E LK    LRL      R + 
Sbjct: 719 ESGRIIFNQQPVMKSMFKSVCCYVSQDDNHLL-PNLTVYETLKYAARLRLSHHNESRIET 777

Query: 201 DAKYVIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             + +I  L L++     VG      +SGGE +R +IG+  + +  V + DEP+S LD
Sbjct: 778 RVRTLISDLGLKNCANTLVGNDLIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLD 835

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 29/158 (18%)

Query: 372 SGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD-------------DGQKVPK------ 412
           + SF  + I  +MG +G+GKT+L+ L++  +  +             + Q V K      
Sbjct: 679 NASFRPNAINAIMGPSGSGKTSLLNLISDRVCSNFFTKFNESGRIIFNQQPVMKSMFKSV 738

Query: 413 -LNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLN-PQFQTDV---VKPLKIESIIDQEVQH 467
              VS     + P         +  R+R    N  + +T V   +  L +++  +  V +
Sbjct: 739 CCYVSQDDNHLLPNLTVYETLKYAARLRLSHHNESRIETRVRTLISDLGLKNCANTLVGN 798

Query: 468 -----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
                +SGGE +RV+I + L     + L+DEP++ LDS
Sbjct: 799 DLIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDS 836

>Kwal_33.15623
          Length = 562

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 90/197 (45%), Gaps = 17/197 (8%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           G  + +VG NGIGK+T LK+L+G         DD P    I    R   L  +F ++ + 
Sbjct: 61  GDKVTIVGENGIGKTTFLKLLSG--------VDDYPFSGSIEIEGRIGFLPQHFEEV-DG 111

Query: 163 NIKAI---IKPQYVDNIPRAIKGPVQKVGE--LLKLRLERSQDDAKYVIKALDLQHVLKR 217
           N+ A+   +K  Y D I   ++ P+       + +L      +  + V      Q +L+R
Sbjct: 112 NLLAVEVLLKSLYDDEINEFLELPLTPFSHEWIQELNSLGGHEIFRQVSHIGLRQEILRR 171

Query: 218 DVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISV 277
               LSGGE  +  +    +   D  + DEP+++LD K        +R   N T  V+ V
Sbjct: 172 PFRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRK-FNGT--VVMV 228

Query: 278 EHDLSVLDYLSDFVCIL 294
            HD ++++ +S F+  L
Sbjct: 229 THDRALINAVSSFISEL 245

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 80/193 (41%), Gaps = 40/193 (20%)

Query: 362 TQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALS-PDDGQKVPKLNVSMKPQ 420
           T  DFV+     S+ D   + ++GENG GKTT +KLL+G    P  G    +  +   PQ
Sbjct: 52  TDLDFVV-----SYGDK--VTIVGENGIGKTTFLKLLSGVDDYPFSGSIEIEGRIGFLPQ 104

Query: 421 KIAPKFPGTVR--QLFFKRIRGQFLNPQFQTDVVKPLKIESI----------IDQEVQH- 467
               +  G +   ++  K +    +N +F    + P   E I          I ++V H 
Sbjct: 105 HFE-EVDGNLLAVEVLLKSLYDDEIN-EFLELPLTPFSHEWIQELNSLGGHEIFRQVSHI 162

Query: 468 -------------LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFI 514
                        LSGGE  +  +     L  D  L+DEP+ +LD++        +R+F 
Sbjct: 163 GLRQEILRRPFRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF- 221

Query: 515 LHNKKTAFLVEHD 527
                T  +V HD
Sbjct: 222 ---NGTVVMVTHD 231

 Score = 35.8 bits (81), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 16/138 (11%)

Query: 372 SGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVR 431
           S + +  E LV+ G NG GKTTL ++L   + PD G       VSM    +         
Sbjct: 387 SFTLTKGERLVIQGPNGCGKTTLNRILMAHIKPDHG------TVSMSGNAVVGYLDQEQE 440

Query: 432 QLFFKRIRGQFLNPQFQTDVVKPLKIESIID----------QEVQHLSGGELQRVAIVLA 481
            L  ++   Q L    + D  +   I ++ D            ++ LS G  ++  +   
Sbjct: 441 NLPLEKSPIQLLEEDPKIDASRQTAIRNLRDFGIYKWHDLKSPLRDLSVGCRRKTQLCQI 500

Query: 482 LGLPADIYLIDEPSAYLD 499
           +     I ++DEP+ ++D
Sbjct: 501 IMRKCSILVLDEPTNHID 518

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 101/232 (43%), Gaps = 39/232 (16%)

Query: 89  ANSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYF 147
            +S  +H L    P G V+ ++G +G GK+T L +LA K    L    +       I Y 
Sbjct: 33  TDSVLVHPLSLDLPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGE-------ISYI 85

Query: 148 RGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKV-------GELL----KLRLE 196
             ++  N      E +    +   Y +N+  A   P Q V        E L     L+L+
Sbjct: 86  LEADKNNVDDSSSEASFD--LNATYKENVTLAYV-PQQDVLCSRLTCRETLMYAADLKLD 142

Query: 197 RSQDDAKYV----IKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDE 247
            S+ +   +    I  L L+      VG      LSGGE +R ++G   V    V   DE
Sbjct: 143 ASKVEKTLIVNQLIDELGLKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDE 202

Query: 248 PSSYLDVKQRLNAALVIRSLL-----NATTYVISVEHDLSVLDYLSDFVCIL 294
           P++ LD     +A LV+++L      +  T+++S+    S + +L D+VCIL
Sbjct: 203 PTTGLDA---YSAYLVVKTLKKLAKEDGRTFILSIHQPRSDILFLFDYVCIL 251

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 83/167 (49%), Gaps = 28/167 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG---------RYDDPPEWQDIIRYFRGSE 151
           +PG +  ++G +G GKS+ L +++G+ + +L          + +D P  QD+ ++     
Sbjct: 710 KPGMINAIMGPSGSGKSSFLNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHLCSYV 769

Query: 152 LQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDL 211
            Q+      +D++ A++  +   +   A++       + L    +RS+ D+  +I  L L
Sbjct: 770 SQD------DDHLLAMLTVRETFDFAAALRL------KHLSKDDKRSRTDS--LIAILGL 815

Query: 212 QHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           +H     +G      +SGGE +R ++G+  + +  + + DEP+S LD
Sbjct: 816 KHCENTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGLD 862

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 78/189 (41%), Gaps = 29/189 (15%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD-----DGQKVPKLNVSMKPQK 421
           +L   S  F    I  +MG +G+GK++ + L++G L        +     KLN +   Q 
Sbjct: 701 ILQNVSAVFKPGMINAIMGPSGSGKSSFLNLISGRLESSLLVKFNTAGTIKLNDTPISQD 760

Query: 422 IAPKFPGTVRQ-----LFFKRIRGQF-----LNPQFQTDVVKPLKIESII---------- 461
           +       V Q     L    +R  F     L  +  +   K  + +S+I          
Sbjct: 761 MFKHLCSYVSQDDDHLLAMLTVRETFDFAAALRLKHLSKDDKRSRTDSLIAILGLKHCEN 820

Query: 462 ----DQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
               ++ ++ +SGGE +RV++ + L     I L+DEP++ LDS       +++      +
Sbjct: 821 TIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGLDSFTSSTILEILENLCSEH 880

Query: 518 KKTAFLVEH 526
            KT  L  H
Sbjct: 881 NKTVILTIH 889

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 79/200 (39%), Gaps = 48/200 (24%)

Query: 368 LNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSP-------------------DDGQ 408
           L++ SGS     ++ +MG +G+GKTTL+ +LA  +S                    DD  
Sbjct: 43  LDLPSGS-----VMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNVDDSS 97

Query: 409 KVPK--LNVSMKPQKIAPKFPGTVRQLFFKRIRGQ---FLNPQFQTD---VVKPLKIESI 460
                 LN + K        P   + +   R+  +         + D   V K L +  +
Sbjct: 98  SEASFDLNATYKENVTLAYVPQ--QDVLCSRLTCRETLMYAADLKLDASKVEKTLIVNQL 155

Query: 461 IDQ------------EVQH--LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIIC 506
           ID+            +  H  LSGGE +R+++   +     +  +DEP+  LD+    + 
Sbjct: 156 IDELGLKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLV 215

Query: 507 SKVIRRFILHNKKTAFLVEH 526
            K +++    + +T  L  H
Sbjct: 216 VKTLKKLAKEDGRTFILSIH 235

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
            transporter responsible for export of a factor mating
            pheromone, member of ATP-binding cassette (ABC)
            superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 84/181 (46%), Gaps = 25/181 (13%)

Query: 353  SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD------D 406
            +FAYPS       FV    +      + L ++GE+GTGK+TL+ LL    + +      D
Sbjct: 1058 TFAYPSAPTA---FVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKID 1114

Query: 407  GQKVPKLNVSMKPQKIAPK------FPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESI 460
            G  V   N++   ++I+        F GT+R      ++ + L  +   D +K + I   
Sbjct: 1115 GTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMY-DALKYVGIHDF 1173

Query: 461  IDQEVQHL---------SGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
            +    Q L         SGG+ QR+ I  AL   + I ++DE ++ LDS    I +++++
Sbjct: 1174 VISSPQGLDTRIDTTLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVK 1233

Query: 512  R 512
            +
Sbjct: 1234 K 1234

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 84/210 (40%), Gaps = 36/210 (17%)

Query: 350 ATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ- 408
           A  SF+YPS      + VL   S +FS  +   ++G++G+GK+TL  LL       +G  
Sbjct: 360 ANVSFSYPSRP---SEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSI 416

Query: 409 KVPKLNVSMKPQKIAPKFPGTVRQ---LFFKRIRGQFL----------------NPQFQT 449
            +   N+    QK+  +    V Q   LF   +R   L                N     
Sbjct: 417 SINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIK 476

Query: 450 DVVK-----------PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYL 498
           D  +           P  +E++I      LSGG+ QRVAI  A      I  +DE  + L
Sbjct: 477 DACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSAL 536

Query: 499 DSEQRIICSKVIRRFILHNKKTAFLVEHDF 528
           D   R +  K IR +     KT  ++ H+ 
Sbjct: 537 DIVHRNLLMKAIRHW--RKGKTTIILTHEL 564

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 67/157 (42%), Gaps = 21/157 (13%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
            GQ LG++G +G GKST + +L       +G+               G+++ ++    L  
Sbjct: 1080 GQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIK-----------IDGTDVNDWNLTSLRK 1128

Query: 163  NIKAI-IKPQYV-----DNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK 216
             I  +  KP        DN+   ++  + ++     L+     D      + LD     +
Sbjct: 1129 EISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDT----R 1184

Query: 217  RDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             D   LSGG+ QR  I  + ++++ + + DE +S LD
Sbjct: 1185 IDTTLLSGGQAQRLCIARALLRKSKILILDECTSALD 1221

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 88/207 (42%), Gaps = 38/207 (18%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLE 161
            GQ   +VG +G GKST   +L       L  YD       I     G  +Q    K+L 
Sbjct: 384 AGQFTFIVGKSGSGKSTLSNLL-------LRFYDGYNGSISI----NGHNIQTIDQKLLI 432

Query: 162 DNIKAIIK--PQYVDNIPRAIKGPVQKVGELLKLR-LERSQDDAKYVIK----------- 207
           +NI  + +    + D + + I      +G    +R  + S ++ +++IK           
Sbjct: 433 ENITVVEQRCTLFNDTLRKNIL-----LGSTDSVRNADCSTNENRHLIKDACQMALLDRF 487

Query: 208 ALDLQHVLKRDVGA----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALV 263
            LDL   L+  +G     LSGG+ QR AI  + +++  +   DE  S LD+  R      
Sbjct: 488 ILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKA 547

Query: 264 IRSLLNATTYVISVEHDLSVL---DYL 287
           IR      T +I + H+LS +   DYL
Sbjct: 548 IRHWRKGKTTII-LTHELSQIESDDYL 573

>YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member of
           the ATP-binding cassette (ABC) superfamily, has
           similarity to Drosophila white protein [3885 bp, 1294
           aa]
          Length = 1294

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 104/236 (44%), Gaps = 38/236 (16%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYF-- 147
           N+F +  LP+   G V+ ++G +G GK+T L +LA K    L            IRY   
Sbjct: 46  NTFSMD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLTH-------NGSIRYVLE 94

Query: 148 -RGSELQNYFTK--MLEDNIKAIIKPQYVDNIPRA-IKGPVQKVGELLK----LRLERSQ 199
             GSE      K   L+     I K   +  +P+  +  P     E LK    L+L  S+
Sbjct: 95  DTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSE 154

Query: 200 DDAKY----VIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSS 250
              K     +I+ L L+      VG      LSGGE +R +IG   +    +   DEP++
Sbjct: 155 RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTT 214

Query: 251 YLDVKQRLNAALVIRSLL-----NATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
            LD     +A LVI++L      +  T+++S+    S + +L D VCIL     VY
Sbjct: 215 GLDA---YSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVY 267

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 82/163 (50%), Gaps = 20/163 (12%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN-LGRYDDPPE--WQDIIRYFRGSEL--QNY 155
           +PG +  ++G +G GKS+ L +++G+ K +   ++D      + DI    + SEL  +N 
Sbjct: 718 KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDI----QVSELMFKNV 773

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVL 215
            + + +D+   +      + +  A    +  + E    R+ER+ +    +I++L L+H  
Sbjct: 774 CSYVSQDDDHLLAALTVKETLKYAAALRLHHLTE--AERMERTDN----LIRSLGLKHCE 827

Query: 216 KRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
              +G      +SGGE +R  +G+  + +  + + DEP+S LD
Sbjct: 828 NNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLD 870

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 83/202 (41%), Gaps = 46/202 (22%)

Query: 366 FVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA----GALSPDDGQKVPKLNVSMKPQK 421
           F +++ SGS     ++ +MG +G+GKTTL+ +LA    G L+ +   +    +   +P +
Sbjct: 48  FSMDLPSGS-----VMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNE 102

Query: 422 IAPK--------FPGTVRQLFFKRIRGQFLNP--------QFQTDV-------VKPLKIE 458
             PK         P     +     +   L+P        +F  D+        K L +E
Sbjct: 103 TEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSERTKKLMVE 162

Query: 459 SII--------------DQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRI 504
            +I              D   + LSGGE +R++I   +     I  +DEP+  LD+    
Sbjct: 163 QLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAF 222

Query: 505 ICSKVIRRFILHNKKTAFLVEH 526
           +  K +++    + +T  +  H
Sbjct: 223 LVIKTLKKLAKEDGRTFIMSIH 244

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 92/235 (39%), Gaps = 45/235 (19%)

Query: 332 EALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDF------VLNVESGSFSDSEILVMMG 385
           EA + + +    +LE  D    F+ P     +G+F      +L   +  F    I  +MG
Sbjct: 668 EAEKGKNIHITIKLEDIDLRVIFSAPFSNWKEGNFHHETKEILQSVNAIFKPGMINAIMG 727

Query: 386 ENGTGKTTLIKLLAGAL---------------------------------SPDDGQKVPK 412
            +G+GK++L+ L++G L                                 S DD   +  
Sbjct: 728 PSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAA 787

Query: 413 LNVSMKPQKIAPKFPGTVRQLFFKRI-RGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGG 471
           L V     K   K+   +R        R +  +   ++  +K  +   I ++ V+ +SGG
Sbjct: 788 LTV-----KETLKYAAALRLHHLTEAERMERTDNLIRSLGLKHCENNIIGNEFVKGISGG 842

Query: 472 ELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH 526
           E +RV + + L     I L+DEP++ LDS       +++ +      KT  +  H
Sbjct: 843 EKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIH 897

>Scas_716.81
          Length = 1565

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (46%), Gaps = 26/199 (13%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK--QKPNLGR----YDDPPEWQDI 143
           NS+ L      +PG+++ ++G  G G S+ LK++AG+  Q P   +    YD  P+ +++
Sbjct: 236 NSYAL-----AKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDGIPQ-KEM 289

Query: 144 IRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAK 203
           +++++   + N     L+ +   +   Q +D    A K P ++V  + +    +S  +  
Sbjct: 290 MKHYKSDVIYN---GELDVHFPHLTVQQTLD-FALACKTPAKRVNNISRDEYIKSSRELY 345

Query: 204 YVIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRL 258
             I    L+H     VG      +SGGE +R +I  +      +Y +D  +  LD    L
Sbjct: 346 ATI--FGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTAL 403

Query: 259 NAALVIR---SLLNATTYV 274
             A  IR   +LL +T +V
Sbjct: 404 EYAKAIRIMTNLLGSTAFV 422

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 77/186 (41%), Gaps = 22/186 (11%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA + +  +   D             G  +   F +   
Sbjct: 940  PGTLTALMGESGAGKTTLLNTLAKRNEIGVVTGD---------MLVNGRPVDASFERR-- 988

Query: 162  DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYV---IKALDLQHVLKRD 218
                  ++ Q +      ++  +Q    + +      ++   YV   I+ L+++      
Sbjct: 989  ---TGYVQQQDIHIAELTVRESLQFSARMRRSEHVSDEEKLAYVEKIIRVLEMEEFADAL 1045

Query: 219  VGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIRSLLNATTY 273
            VGA+  G    + ++ +IG+  V + D+ +F DEP+S LD +       ++R L  A   
Sbjct: 1046 VGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRKLAQAGQS 1105

Query: 274  VISVEH 279
            ++   H
Sbjct: 1106 ILCTIH 1111

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR        TAF+ 
Sbjct: 364 VRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALEYAKAIRIMTNLLGSTAFVT 423

>AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH]
           complement(802685..807163) [4479 bp, 1492 aa]
          Length = 1492

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 9/130 (6%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQ--LFF 435
           SE+  ++G+ G+GK+ LI+ + G L   +G  V + NV+   Q +A    GTVR   LF 
Sbjct: 638 SELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGNVAYVSQ-VAWIMNGTVRDNILFG 696

Query: 436 KRIRGQFLNPQFQT-----DV-VKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIY 489
            +   +F     +      D+ + P    + + ++   LSGG+  R+++  A+   AD Y
Sbjct: 697 HKYDAKFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTY 756

Query: 490 LIDEPSAYLD 499
           L+D+P A +D
Sbjct: 757 LLDDPLAAVD 766

>AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH]
            complement(1213217..1217071) [3855 bp, 1284 aa]
          Length = 1284

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 96/200 (48%), Gaps = 35/200 (17%)

Query: 353  SFAYPSMKRTQ--GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD----- 405
            +FAYP+ K  Q   +F L +  G+      + ++GE+G+GK+TL  L+ G L P      
Sbjct: 1052 NFAYPAAKDVQIYKNFNLRINQGT-----KVAIVGESGSGKSTLFYLICG-LYPVKPASL 1105

Query: 406  --DGQKVPKLNVSMKPQKIA-----PKF-PGTVRQLFFKRIRGQFLNPQFQTDVVK---- 453
              DG  +    +S   + IA     P+F  GT+R+     + G   + +    + +    
Sbjct: 1106 FIDGTDICNWEMSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRII 1165

Query: 454  ------PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICS 507
                  P  +E+ +D  +  +SGG+LQR++IV AL     + ++DE ++ LD+      +
Sbjct: 1166 NFVRSLPEGLETRVDTNL--VSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIA 1223

Query: 508  KVIRRFILHNKKTAFLVEHD 527
             V+R   LH+  T  ++ H 
Sbjct: 1224 NVVRNS-LHD-ITVIVITHS 1241

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 84/185 (45%), Gaps = 24/185 (12%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
            G  + +VG +G GKST   ++ G        Y   P       +  G+++ N+    L  
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICG-------LYPVKPA----SLFIDGTDICNWEMSALRK 1122

Query: 163  NIKAI-IKPQYVD-----NIPRAIKGPVQKVGELLKLRLE-RSQDDAKYVIKALDLQHVL 215
             I  +  KP++ +     N+   ++G +    E+ ++  E R  +  + + + L+     
Sbjct: 1123 IIAVVEQKPRFFNGTIRENLVYGLEGTITD-NEIYEVLAEVRIINFVRSLPEGLET---- 1177

Query: 216  KRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVI 275
            + D   +SGG+LQR +I  + ++   + + DE +S LD       A V+R+ L+  T VI
Sbjct: 1178 RVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSLHDIT-VI 1236

Query: 276  SVEHD 280
             + H 
Sbjct: 1237 VITHS 1241

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 86/198 (43%), Gaps = 28/198 (14%)

Query: 99  TPRPGQVLGLVGTNGIGKSTA----LKILAGKQ------KPNLGRYDDPPEWQDIIRYFR 148
           T RP Q+  +VG +G GKST     LK  +  +        NL   D     Q+I    +
Sbjct: 383 TFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQ 442

Query: 149 GSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKA 208
              L   F   L +NI    KP  V+    A+K   Q +  L KL  +  +         
Sbjct: 443 SCTL---FNGTLFENITLSAKP--VNKTAGAVKRACQ-MALLEKLVFDLPEG-------- 488

Query: 209 LDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL 268
             L   +     ++SGG+ QR A+  + +++A V + DE  S LD+  R     VIRS  
Sbjct: 489 --LHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWR 546

Query: 269 NATTYVISVEHDLS-VLD 285
              T +I + H+LS VLD
Sbjct: 547 ADKTTII-LTHELSHVLD 563

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDG 407
           SF YP+   T+    L+  S +F  ++I  ++G++G+GK+TL  LL    S  +G
Sbjct: 365 SFNYPARPDTKA---LDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEG 416

>Scas_288.1
          Length = 494

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RYDDPPEWQDIIRYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       YD  P+  ++++ +R   + N  
Sbjct: 73  GEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQ-DEMMKKYRADVIYN-- 129

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK 216
              L+ +   +   Q +D    A K P ++V ++ K    +S  +    I    L+H   
Sbjct: 130 -GELDVHFPYLTVQQTLD-FAIACKTPAKRVNDVSKEEYIKSTRELYATI--FGLRHTYN 185

Query: 217 RDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIR---SLL 268
             VG      +SGGE +R +I  +      +Y +D  +  LD    L  A  IR   +LL
Sbjct: 186 TKVGNDFVRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIRIMTNLL 245

Query: 269 NATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
            +T +V   +   ++ +   D V +LY    +Y
Sbjct: 246 KSTAFVTIYQASENIYETF-DKVTVLYSGRQIY 277

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 522
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR  I+ N  K TAF
Sbjct: 193 VRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIR--IMTNLLKSTAF 250

Query: 523 LV 524
           + 
Sbjct: 251 VT 252

>YER036C (YER036C) [1461] chr5 complement(223366..225198) Member of
           the non-transporter group of the ATP-binding cassette
           (ABC) superfamily [1833 bp, 610 aa]
          Length = 610

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 114/488 (23%), Positives = 194/488 (39%), Gaps = 84/488 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRYDDPPEWQDIIRY-FRGSELQNYF 156
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E  ++    +  +E Q+  
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHEL 166

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDD-----AKYVIKALDL 211
            K +ED ++  I             GP  ++ E L  R++    D     A  ++  L  
Sbjct: 167 -KRIEDLVEKTILED----------GPESELLEPLYERMDSLDPDTFESRAAIILIGLGF 215

Query: 212 --QHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL- 268
             + +LK+    +SGG   R A+  +   +  + + D+P+++LD    L A + +   L 
Sbjct: 216 NKKTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLD----LEACVWLEEYLK 270

Query: 269 --NATTYVISVEHDL------SVLDYLSDFVCILYGVPSVYGVVTLPSSVR--------- 311
             + T  ++S   D       +++D  +  +    G    Y                   
Sbjct: 271 RFDRTLVLVSHSQDFLNGVCTNMIDMRAQKLTAYGGNYDSYHKTRSELETNQMKQYNKQQ 330

Query: 312 ---EGINIFLEGHIPSENM----RFRQEALQFRMVDAQEQLEAEDATRSFAYPSMKR--- 361
              + I  F+       N+    + RQ+ L     D   Q    D   SF +P ++R   
Sbjct: 331 EEIQHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLVQPVVPDKVFSFRFPQVERLPP 390

Query: 362 ---TQGDFVLNVES------------GSFSDSEILVMMGENGTGKTTLIKLLAGALSPDD 406
                 D   + ES            G   DS I  ++G NG GK+TL+K++ G L+P  
Sbjct: 391 PVLAFDDISFHYESNPSENLYEHLNFGVDMDSRI-ALVGPNGVGKSTLLKIMTGELTPQS 449

Query: 407 GQ--KVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIID-Q 463
           G+  +   + + +  Q    +   T   L F R +   ++  FQ    +  +     + Q
Sbjct: 450 GRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLTGEGQ 509

Query: 464 EVQHLSGGELQRVAIV---LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            VQ  +  E QR  +V   LAL  P ++ L+DEP+  LD       +  I  F       
Sbjct: 510 TVQMATLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAINEF----NGG 564

Query: 521 AFLVEHDF 528
             +V HDF
Sbjct: 565 VVVVSHDF 572

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 82/184 (44%), Gaps = 46/184 (25%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQKVPK------LNVSMKPQKI-APKFPGTVRQLFF 435
           ++GENG GK+T +K LA    P     +P+      L+   +P ++ A  +  T  Q   
Sbjct: 112 LLGENGCGKSTFLKALATREYP-----IPEHIDIYLLDEPAEPSELSALDYVVTEAQHEL 166

Query: 436 KRIR-------------GQFLNPQFQ-TDVVKPLKIES--------------IIDQEVQH 467
           KRI               + L P ++  D + P   ES               I ++ + 
Sbjct: 167 KRIEDLVEKTILEDGPESELLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKD 226

Query: 468 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH- 526
           +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  LV H 
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHS 282

Query: 527 -DFI 529
            DF+
Sbjct: 283 QDFL 286

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 86/193 (44%), Gaps = 35/193 (18%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+  P  GR       + +  Y + S+ Q   TK    +  
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVK-LGVYSQHSQDQLDLTK----SAL 478

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
             ++ +Y  NI +  +    ++G              +Y +   + Q V    +  LS G
Sbjct: 479 EFVRDKY-SNISQDFQFWRGQLG--------------RYGLTG-EGQTV---QMATLSEG 519

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY----VISVEHDL 281
           +  R    +  +++ +V + DEP++ LD+         I SL +A       V+ V HD 
Sbjct: 520 QRSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVVSHDF 572

Query: 282 SVLDYLSDFVCIL 294
            +LD ++  + ++
Sbjct: 573 RLLDKIAQDIFVV 585

>AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH]
           (859615..861438) [1824 bp, 607 aa]
          Length = 607

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 112/465 (24%), Positives = 187/465 (40%), Gaps = 92/465 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY-----DDPPEWQDIIRYFRGSELQN 154
           G+  GL+G NG GKST LK +A ++ P   N+  Y      +P E+  +    R  E QN
Sbjct: 104 GRRYGLLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVR--EAQN 161

Query: 155 YFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDL--- 211
              K LED ++ I+             GP  ++ + L  +++ S D + +  +A  +   
Sbjct: 162 EL-KRLEDLVEKILLED----------GPESELLDPLYEKMD-SMDPSTFESRAAIILIG 209

Query: 212 ----QHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSL 267
                  + R    +SGG   R A+  +   +  + + D+P+++LD    L A + +   
Sbjct: 210 LGFNAKTINRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLD----LEACVWLEEY 265

Query: 268 L---NATTYVISVEHDL------SVLDYLSDFVCILYGVPSVYGVVTLPSSVREG----- 313
           L   + T  ++S   D       ++LD     +    G    Y  V   S +        
Sbjct: 266 LKRFDRTLVLVSHSQDFLNGVCTNMLDMRLQKLTAYGGNYDSY--VKTRSELETNQMKQY 323

Query: 314 ---------INIFLEGHIPSENM----RFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360
                    I  F+       N+    + RQ+ L     D   Q    D   SF +P ++
Sbjct: 324 HKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQAVVADRVFSFRFPEVE 383

Query: 361 RTQGDFVLNVESGSFS-------------------DSEILVMMGENGTGKTTLIKLLAGA 401
           R     VL  +  SFS                   DS    ++G NG GK+TL+K++ G 
Sbjct: 384 RLPPP-VLAFDEISFSYDGNPENNLYEKLNFGVDMDSRT-ALVGPNGVGKSTLLKIMTGE 441

Query: 402 LSPDDGQ--KVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVK----PL 455
           L+P  G+  +   + + +  Q    +   T   L F R +   ++  FQ    +     L
Sbjct: 442 LTPHGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYAHISEDFQFWRGQLGRYGL 501

Query: 456 KIESIIDQEVQHLSGGELQRVAI-VLALGLPADIYLIDEPSAYLD 499
             E+   Q +  LS G+  RV   +LAL  P ++ L+DEP+  LD
Sbjct: 502 TGEAQTAQ-MATLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLD 544

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALSP-DDGQKVPKLNVSMKPQKI-APKFPGTVRQLFFKRIR- 439
           ++GENG GK+T +K +A    P  +   V  L+   +P +  A ++     Q   KR+  
Sbjct: 109 LLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVREAQNELKRLED 168

Query: 440 ------------GQFLNPQFQ-TDVVKPLKIES--------------IIDQEVQHLSGGE 472
                        + L+P ++  D + P   ES               I+++ + +SGG 
Sbjct: 169 LVEKILLEDGPESELLDPLYEKMDSMDPSTFESRAAIILIGLGFNAKTINRKTKDMSGGW 228

Query: 473 LQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  LV H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 84/192 (43%), Gaps = 35/192 (18%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKA 166
            LVG NG+GKST LKI+ G+  P+ GR       + +  Y + S+ Q   TK   + ++ 
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVK-LGVYSQHSQDQLDLTKSALEFVRD 480

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGE 226
             K  ++    +  +G + + G  L    + +Q                   +  LS G+
Sbjct: 481 --KYAHISEDFQFWRGQLGRYG--LTGEAQTAQ-------------------MATLSEGQ 517

Query: 227 LQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY----VISVEHDLS 282
             R    +  +++ +V + DEP++ LD+         I SL +A       V+ V HD  
Sbjct: 518 RSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAIDAFNGGVVVVSHDFR 570

Query: 283 VLDYLSDFVCIL 294
           +LD ++  + ++
Sbjct: 571 LLDRIAKDIYVV 582

>YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump
           involved in resistance to multiple drugs, member of the
           ATP-binding cassette (ABC) superfamily [4506 bp, 1501
           aa]
          Length = 1501

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RYDDPPEWQDIIRYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       YD  P+ +++++ ++   + N  
Sbjct: 186 GEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQ-EEMMKRYKADVIYN-- 242

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK 216
              L+ +   +   Q +D    A K P  +V  + K     S+ D    I    L+H   
Sbjct: 243 -GELDVHFPYLTVKQTLD-FAIACKTPALRVNNVSKKEYIASRRDLYATI--FGLRHTYN 298

Query: 217 RDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIR---SLL 268
             VG      +SGGE +R +I  +   +  +Y +D  +  LD    L  A  IR   +LL
Sbjct: 299 TKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLL 358

Query: 269 NATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
            +T +V   +   ++ +   D V +LY    +Y
Sbjct: 359 KSTAFVTIYQASENIYETF-DKVTVLYSGKQIY 390

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR      K TAF+ 
Sbjct: 306 VRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFVT 365

>KLLA0A01452g 130078..131901 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 607

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 115/498 (23%), Positives = 195/498 (39%), Gaps = 104/498 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY--DDPPE------WQDIIRYFRGSE 151
           G+  GL+G NG GKST LK +A ++ P   N+  Y  D+P E       + ++R  +G  
Sbjct: 104 GRRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGE- 162

Query: 152 LQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLER---SQDDAKYVIKA 208
                 K LED ++ I+             GP   + E L  R++    S  +++  I  
Sbjct: 163 -----LKRLEDLVEKILLED----------GPESDLLEPLYERMDDMDPSTFESRAAIIL 207

Query: 209 LDL---QHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIR 265
           + L      + +    +SGG   R A+  +   +  + + D+P+++LD    L A + + 
Sbjct: 208 IGLGFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLD----LEACVWLE 263

Query: 266 SLLNATTYVISVEHDLSVLDYLSDF---VCI---------LYGVPSVYGVVTLPSSVREG 313
                  Y+   +  L ++ +  DF   VC          L      Y       S  E 
Sbjct: 264 E------YLKRFDRTLVLVSHSQDFLNGVCTNMLDMRLQKLMAYGGNYDSYVKTRSELET 317

Query: 314 ---------------INIFLEGHIPSENM----RFRQEALQFRMVDAQEQLEAEDATRSF 354
                          I  F+       N+    + RQ+ L     D   Q  A D   SF
Sbjct: 318 NQMKQYTKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQPVAADKVFSF 377

Query: 355 AYPSMKR------------------TQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIK 396
            +P ++R                  ++ +   +++ G   DS I  ++G NG GK+TL+K
Sbjct: 378 RFPEVERLPPPVLAFDDISFSYDGNSENNLYEHLDFGVDMDSRI-ALVGPNGVGKSTLLK 436

Query: 397 LLAGALSPDDGQ--KVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKP 454
           ++ G L+   G+  +   + + +  Q    +   T   L F R +   ++  FQ    + 
Sbjct: 437 IMTGQLTTQSGRVSRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPHVSQDFQYWRGQL 496

Query: 455 LKIESIID-QEVQH--LSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVI 510
            +     + Q VQ   LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I
Sbjct: 497 GRYGLTGEGQTVQMGTLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAI 555

Query: 511 RRFILHNKKTAFLVEHDF 528
             F         +V HDF
Sbjct: 556 NEF----NGGVVVVSHDF 569

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 83/179 (46%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALSP-DDGQKVPKLNVSMKPQK------IAPKFPGTVRQL-- 433
           ++GENG GK+T +K +A    P  +   +  L+   +P +      +  +  G +++L  
Sbjct: 109 LLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGELKRLED 168

Query: 434 FFKRI------RGQFLNPQFQ-TDVVKPLKIES--------------IIDQEVQHLSGGE 472
             ++I          L P ++  D + P   ES               I+++ + +SGG 
Sbjct: 169 LVEKILLEDGPESDLLEPLYERMDDMDPSTFESRAAIILIGLGFNSKTINKKTKDMSGGW 228

Query: 473 LQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  LV H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 80/193 (41%), Gaps = 35/193 (18%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+     GR       + +  Y + S+ Q   TK   + ++
Sbjct: 421 IALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVK-LGVYSQHSQDQLDLTKSALEFVR 479

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGG 225
                   D  P   +      G+L +  L       +               +G LS G
Sbjct: 480 --------DKYPHVSQDFQYWRGQLGRYGLTGEGQTVQ---------------MGTLSEG 516

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY----VISVEHDL 281
           +  R    +  +++ +V + DEP++ LD+         I SL +A       V+ V HD 
Sbjct: 517 QRSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVVSHDF 569

Query: 282 SVLDYLSDFVCIL 294
            +LD ++  + ++
Sbjct: 570 RLLDKIAKDIFVV 582

>KLLA0D00748g complement(69839..72208) similar to sp|P33311
           Saccharomyces cerevisiae YPL270w MDL2 ATP-binding
           cassette (ABC) transporter family member, hypothetical
           start
          Length = 789

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 88/198 (44%), Gaps = 29/198 (14%)

Query: 353 SFAYPSMKRTQ--GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD----- 405
           SF+YP+ K  Q   D    +E GS      + ++G +G GK+T+  LL    +P      
Sbjct: 478 SFSYPTRKTNQIFKDLNFTIEPGSN-----VCIVGPSGRGKSTIASLLLRYYNPTSGKIL 532

Query: 406 -DGQKVPKLNV-SMKPQ-KIAPKFP----GTVRQLFFKRIRGQFLNPQFQTDVVK----- 453
            DGQ + KL+  S++ Q  +  + P    GT+R+     +  Q    + ++   K     
Sbjct: 533 VDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHA 592

Query: 454 -----PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSK 508
                P   E+II      LSGG+ QR+AI  AL     I ++DE ++ LD E     + 
Sbjct: 593 FISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINY 652

Query: 509 VIRRFILHNKKTAFLVEH 526
            + R +   + T   + H
Sbjct: 653 TLGRLMKSKELTIISIAH 670

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY-VISVEHD 280
           LSGG+ QR AI  + + +  + + DE +S LDV+        +  L+ +    +IS+ H 
Sbjct: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671

Query: 281 LSVL 284
           LS +
Sbjct: 672 LSTI 675

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
           Saccharomyces cerevisiae YDR011w SNQ2 multidrug
           resistance protein, hypothetical start
          Length = 1507

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 94/220 (42%), Gaps = 32/220 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RYDDPPEWQDIIRY-----FRG 149
           R G+++ ++G  G G S+ LK+ AG+     G       YD  P+ + + RY     + G
Sbjct: 186 RAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKRYKPDVIYNG 245

Query: 150 SELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKAL 209
            +  ++    ++  +   I          A K P ++V ++ +     S  D    I   
Sbjct: 246 EQDVHFPHLTVQQTLDFAI----------ACKTPSKRVNDVSREEYIASTRDLHATI--F 293

Query: 210 DLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVI 264
            L+H     VG      +SGGE +R +I  + V +  +Y +D  +  LD    L  A  I
Sbjct: 294 GLRHTYHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAI 353

Query: 265 R---SLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
           R   +LL +T +V   +   ++ +   D V +LY    +Y
Sbjct: 354 RITTNLLGSTAFVTIYQASENIYETF-DKVTVLYTGRQIY 392

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 72/179 (40%), Gaps = 35/179 (19%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPK- 425
           +LN  SG     E+++++G  G G ++++K+ AG +    G    ++     PQK   K 
Sbjct: 177 ILNDVSGLARAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKR 236

Query: 426 --------------FPG-TVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQE------ 464
                         FP  TV+Q     I  +  + +   DV +   I S  D        
Sbjct: 237 YKPDVIYNGEQDVHFPHLTVQQTLDFAIACKTPSKRVN-DVSREEYIASTRDLHATIFGL 295

Query: 465 ------------VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
                       V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR
Sbjct: 296 RHTYHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIR 354

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 77/171 (45%), Gaps = 28/171 (16%)

Query: 367  VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIA-PK 425
            +L+  SG      +  +MGE+G GKTTL+  LA     + G     + V+ KP  I+  +
Sbjct: 875  LLDNVSGFCKPGTLTALMGESGAGKTTLLNTLA---QRNVGIITGDMLVNGKPIDISFER 931

Query: 426  FPGTVRQ--------------LFFKRIRGQFLNPQFQT-----DVVKPLKIESIIDQEVQ 466
              G V+Q               F  R+R     P+ +       ++K L +E   D  V 
Sbjct: 932  RTGYVQQQDIHISELTVRESLQFSARMRRAQNVPEEEKMEHVERIIKVLDMEEYADALVG 991

Query: 467  HLSGG----ELQRVAIVLALGLPADIYL-IDEPSAYLDSEQRIICSKVIRR 512
             +  G    + ++++I + L    D+ L +DEP++ LDS+      +++++
Sbjct: 992  DVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKK 1042

>CAGL0M13739g complement(1346231..1348414) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1, hypothetical
           start
          Length = 727

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 78/166 (46%), Gaps = 23/166 (13%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQ-----------KVPKLN--VSMKPQKIAPKFPGT 429
           + G +G+GK+T++KL+     P++G+            + +L   + + PQ   P F  T
Sbjct: 496 IAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQD-TPLFNDT 554

Query: 430 VRQ-LFFKRIRG------QFLNPQFQTDVVK--PLKIESIIDQEVQHLSGGELQRVAIVL 480
           + + + F RI        + ++    +D++   P    +I+ +    +SGGE QR+AI  
Sbjct: 555 IWENVKFGRIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIAR 614

Query: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH 526
            L   ADI   DE ++ LD+       + IRR     +KT+  + H
Sbjct: 615 VLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAH 660

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 34/182 (18%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLE 161
            G    + G +G GKST LK++         R+ DP E + ++    G +++ Y    L 
Sbjct: 490 AGMKTAIAGPSGSGKSTVLKLVF--------RFYDPEEGRVLVN---GVDVREYDIDQLR 538

Query: 162 DNIKAIIK--PQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKR-- 217
             I  + +  P + D I   +K            R+E S ++   VI    L  ++ +  
Sbjct: 539 KAIGVVPQDTPLFNDTIWENVKFG----------RIEASDEEITRVIDKAQLSDLIAKLP 588

Query: 218 -----DVG----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL 268
                 VG     +SGGE QR AI    +++AD+  FDE +S LD     +    IR   
Sbjct: 589 QGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNF 648

Query: 269 NA 270
           N+
Sbjct: 649 NS 650

>Scas_695.24
          Length = 1288

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 30/172 (17%)

Query: 353  SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA------------- 399
            +FAYPS         LN+E    +  + + ++GE+G+GK+TL+ LL              
Sbjct: 1055 TFAYPSETNVNVYEDLNLEM--HASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLD 1112

Query: 400  GALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVK------ 453
            G    D G    +  +S+  QK    F GTVR+     I    L+ +   D++K      
Sbjct: 1113 GTDVNDWGLMNLRTQISVVEQK-PTLFDGTVRENLSYGISTDILDMEL-FDMLKYVGIYE 1170

Query: 454  -----PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
                 P  +++ ID ++  LSGG+ QR+ I  AL     I ++DE ++ LD+
Sbjct: 1171 FVESLPFGLDTRIDTKL--LSGGQAQRICIARALLRKPKILILDECTSALDA 1220

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 74/172 (43%), Gaps = 34/172 (19%)

Query: 104  QVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDN 163
            + +GLVG +G GKST + +L          Y   P       Y  G+++ ++    L   
Sbjct: 1079 KTIGLVGESGSGKSTLMYLLTK-------LYQVAPH----SIYLDGTDVNDWGLMNLRTQ 1127

Query: 164  IKAIIKPQYVDNIPRAIKGPVQK------VGELLKLRLERSQDDAKYV-----IKALDLQ 212
            I        V+  P    G V++        ++L + L    D  KYV     +++L   
Sbjct: 1128 ISV------VEQKPTLFDGTVRENLSYGISTDILDMEL---FDMLKYVGIYEFVESLPFG 1178

Query: 213  HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVI 264
               + D   LSGG+ QR  I  + +++  + + DE +S LD    L+A ++I
Sbjct: 1179 LDTRIDTKLLSGGQAQRICIARALLRKPKILILDECTSALDA---LSANIII 1227

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 85/205 (41%), Gaps = 35/205 (17%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPK 412
           +F+YPS  R     + NV S  F  ++   ++G++G+GK+TL  LL       +G    K
Sbjct: 363 TFSYPS--RPSHPVLKNV-SLCFEPTKFTFIIGKSGSGKSTLSNLLLKFYDDYNGTITVK 419

Query: 413 -------------LNVSMKPQKIAPKFPGTVRQ-LFFKRIRGQFLNPQFQTDVVKPLKIE 458
                         NV++  Q+    F  T+R  +     + Q  + +     +K     
Sbjct: 420 GNDVKEINRNWLLNNVTVVEQR-CTLFNDTLRNNILLGVSKDQLEDHESIEQKLKDACSI 478

Query: 459 SIIDQEVQHLSGG---------------ELQRVAIVLALGLPADIYLIDEPSAYLDSEQR 503
           S++D+ V  L  G               + QRVAI  A      I ++DE  + LD   R
Sbjct: 479 SMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILILDEAVSALDIIHR 538

Query: 504 IICSKVIRRFILHNKKTAFLVEHDF 528
            +  K IR++   + KT  L+ H+ 
Sbjct: 539 ELLMKNIRQW--RSGKTTILLTHEL 561

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
           Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
           permease, start by similarity
          Length = 1022

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 82/190 (43%), Gaps = 36/190 (18%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLA---------GALSPD----DGQKVPKL 413
           VLN  +GS    E+L +MG +G GKTTL+ +LA         G++  +    D  K  K+
Sbjct: 389 VLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKI 448

Query: 414 ------------NVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESII 461
                        +++    +        RQL F   + +        DV++ L+I  I 
Sbjct: 449 IGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVY------DVLEELRIFDIR 502

Query: 462 DQEV-----QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 516
           D+ +     + +SGGE +RV+I   L     +  +DEP++ LD+       + + R   H
Sbjct: 503 DRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANH 562

Query: 517 NKKTAFLVEH 526
             KT  L  H
Sbjct: 563 YNKTLVLSIH 572

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 88/216 (40%), Gaps = 33/216 (15%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWQDIIRYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K K           G   D  ++  II +    + 
Sbjct: 398 KPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKIIGFV---DQ 454

Query: 153 QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQ 212
           ++Y    L   +   +    +  +PR             +L     Q     V++ L + 
Sbjct: 455 EDYLLPTL--TVYETVLNSALLRLPR-------------QLSFSAKQRRVYDVLEELRIF 499

Query: 213 HVLKRDVGA-----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSL 267
            +  R +G+     +SGGE +R +I    V    V   DEP+S LD     N    +  L
Sbjct: 500 DIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRL 559

Query: 268 LNA--TTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
            N    T V+S+    S +  L D + +L     VY
Sbjct: 560 ANHYNKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVY 595

>CAGL0C02343g 236840..238672 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 610

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 82/184 (44%), Gaps = 46/184 (25%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQKVP-KLNVSMKPQKIAPK----FPGTVR--QLFF 435
           ++GENG GK+T +K LA    P     +P  ++V +  +  AP         VR  Q   
Sbjct: 112 LLGENGCGKSTFLKALATREYP-----IPDHIDVYLLDEPAAPTEYSALEYVVREAQNEL 166

Query: 436 KRIR-------------GQFLNPQFQ-TDVVKPLKIES--------------IIDQEVQH 467
           KR+               + L+P ++  D + P   ES               I ++ + 
Sbjct: 167 KRVEDLVEKIILEDGPESELLDPLYERMDGMDPSTFESRAAVILIGLGFNSQTILKKTKD 226

Query: 468 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH- 526
           +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  LV H 
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHS 282

Query: 527 -DFI 529
            DF+
Sbjct: 283 QDFL 286

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 85/192 (44%), Gaps = 35/192 (18%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKA 166
            LVG NG+GKST LKI+ G+  P  GR       + +  Y + S+ Q   TK    +   
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVK-LGVYSQHSQDQLDLTK----SALE 479

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGE 226
            ++ +Y  NI +  +    ++G              +Y +   D Q V    +G LS G+
Sbjct: 480 FVRDKY-SNISQDFQYWRGQLG--------------RYGLTG-DAQKV---QMGTLSEGQ 520

Query: 227 LQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY----VISVEHDLS 282
             R    +  ++  +V + DEP++ LD+         I SL +A       V+ V HD  
Sbjct: 521 RSRVVFALLALENPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVVSHDFR 573

Query: 283 VLDYLSDFVCIL 294
           +LD ++  + ++
Sbjct: 574 LLDKIAKDIFVV 585

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 77/169 (45%), Gaps = 31/169 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYD--------DPPEWQDIIRYFRGSELQN 154
           G+  GL+G NG GKST LK LA ++ P     D         P E+  +    R  E QN
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVVR--EAQN 164

Query: 155 YFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKA------ 208
              K +ED ++ II             GP  ++ + L  R++   D + +  +A      
Sbjct: 165 EL-KRVEDLVEKIILED----------GPESELLDPLYERMD-GMDPSTFESRAAVILIG 212

Query: 209 --LDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
              + Q +LK+    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 213 LGFNSQTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 81/182 (44%), Gaps = 14/182 (7%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ--KV 410
           SFAY      + +   ++  G   DS    ++G NG GK+TL+K++ G L P  G+  + 
Sbjct: 399 SFAYDG--NPENNLYEHLNFGVDMDSRT-ALVGPNGVGKSTLLKIMTGELMPQSGRVSRH 455

Query: 411 PKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIID-QEVQH-- 467
             + + +  Q    +   T   L F R +   ++  FQ    +  +     D Q+VQ   
Sbjct: 456 THVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLGRYGLTGDAQKVQMGT 515

Query: 468 LSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH 526
           LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I  F         +V H
Sbjct: 516 LSEGQRSRVVFALLALENP-NVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSH 570

Query: 527 DF 528
           DF
Sbjct: 571 DF 572

>Scas_573.11
          Length = 689

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVE 278
           + ALSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I++ 
Sbjct: 581 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 637

Query: 279 HDLSVLDYLSDFV 291
           HD   LD + +++
Sbjct: 638 HDSVFLDSVCEYI 650

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
           + +I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 574 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT 616

>CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 or sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 608

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 106/277 (38%), Gaps = 57/277 (20%)

Query: 48  AFISETLCIGCGICVK-------KCPFDAIQIINLPTNLEG------EVTHRYSAN---- 90
            F SE L  GCG   +       K      + I+ P  L+G       V+  YS      
Sbjct: 324 GFYSE-LMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNVSFAYSNGKSVL 382

Query: 91  ---SFKLHRLPTPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRYDDPPEWQD 142
              +F++H      PG+ +  VG +G GKST   +L      G    ++G YD       
Sbjct: 383 SEMNFQIH------PGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLR 436

Query: 143 IIRYFRGSELQN--YFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQD 200
             R   G   Q    F   + DNI   +  + + ++  A+K                   
Sbjct: 437 KYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTDLNMALKAA----------------- 479

Query: 201 DAKYVIKA--LDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR- 257
           +    IK   + L  ++      LSGG+ QR A+    +Q  D+ + DE +S LD K   
Sbjct: 480 NCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSED 539

Query: 258 -LNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCI 293
            +N  L  R     TT  IS+ H LS + + S  + I
Sbjct: 540 IINKELQRRQEAGMTT--ISIAHRLSTIRHSSRVIVI 574

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 26/181 (14%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ-KVP 411
           SFAY + K    +    +  G     E +  +G +G GK+T+  LL        G   + 
Sbjct: 372 SFAYSNGKSVLSEMNFQIHPG-----EHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIG 426

Query: 412 KLNVSMKPQKIAPKFPGTVRQ---LFFKRIRGQF---LNPQFQTDVVKPLK--------- 456
             ++S    +   +  G V+Q   LF   I       L+ +  TD+   LK         
Sbjct: 427 NYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTDLNMALKAANCDQFIK 486

Query: 457 -----IESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
                +++++      LSGG+ QR+A+        DI ++DE ++ LD++   I +K ++
Sbjct: 487 ESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKELQ 546

Query: 512 R 512
           R
Sbjct: 547 R 547

>CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces
           cerevisiae YCR011c ADP1 ATP-dependent permease, start by
           similarity
          Length = 1055

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 71/160 (44%), Gaps = 24/160 (15%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKF 426
           VLN  SG     EIL +MG +G GKTTL+ +LA      D     ++N  +  +K   K 
Sbjct: 392 VLNDISGLVKPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKL 451

Query: 427 PGTVRQ----LFFKRIRGQFLNP---------QFQT------DVVKPLKIESIIDQEVQH 467
            G V Q    L    +    LN           F+        V++ L+I  I D+ V +
Sbjct: 452 IGFVDQDDYLLPTLTVYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMDIKDRIVGN 511

Query: 468 -----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQ 502
                +SGGE +RV+I   L     +  +DEP++ LD+  
Sbjct: 512 DFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDANN 551

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 89/208 (42%), Gaps = 31/208 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
           +PG++L ++G +G GK+T L ILA K+K          +    IR       +  +TK+ 
Sbjct: 401 KPGEILSIMGGSGAGKTTLLDILAMKRKTG--------DVSGSIRVNGKVVSRKDYTKL- 451

Query: 161 EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKL----RLERSQDDAKYVIKALDLQHVLK 216
              I  + +  Y+  +P            LL+L      E  Q    +V++ L +  +  
Sbjct: 452 ---IGFVDQDDYL--LPTLTVYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMDIKD 506

Query: 217 RDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNAT 271
           R VG      +SGGE +R +I    V    V   DEP+S LD     NA  VI  L+   
Sbjct: 507 RIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAN---NANNVIECLVRLA 563

Query: 272 -----TYVISVEHDLSVLDYLSDFVCIL 294
                T V+S+    S + Y  D + +L
Sbjct: 564 RNYDRTLVMSIHQPRSNIFYRFDKLVLL 591

>KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member singleton, start by similarity
          Length = 273

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 40/188 (21%)

Query: 341 AQEQLEAEDATRSFAYPSMKRTQ-GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA 399
           A   L  E    ++A+P  KR+   D  L+VE     + ++LV+ G NG GK+TL+KLL+
Sbjct: 2   ASNDLAVEVHDLTYAFPGSKRSAIHDLSLSVEW----NKKVLVV-GNNGAGKSTLLKLLS 56

Query: 400 GA---------------LSPDDGQK----VPKLNVSMKPQKIAPKFPGTVR-----QLFF 435
           G                 +P++ Q+       L        I  +  G +       L  
Sbjct: 57  GKHLCLGGNIKVGNKNPFAPNNDQESVILTTYLGTEWASMAIVHRDIGVLELLESIGLSH 116

Query: 436 KRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPS 495
            R RG+        ++V+ L+++  I+  +  LS G+ +RV + + L  P  + L+DE +
Sbjct: 117 YRARGE--------ELVRILEVD--INWRMFKLSDGQKRRVQLCMGLLKPFKVLLLDEVT 166

Query: 496 AYLDSEQR 503
             LD   R
Sbjct: 167 VDLDVVAR 174

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 40  VVGNNGAGKSTLLKLLSGKH 59

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 100/240 (41%), Gaps = 56/240 (23%)

Query: 318  LEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATR-----------------SFAYPSMK 360
            L G IP  +   R     FR++D Q     ++  +                 SF+YPS  
Sbjct: 1028 LIGQIPDISRGQRAATYIFRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAP 1087

Query: 361  RTQ--GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALS-PD-----DGQKVPK 412
             T       L+V SG     E + ++GE+G+GK+TL  L++     P+     DG  + +
Sbjct: 1088 STAIYKGLKLDVFSG-----ETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINR 1142

Query: 413  LN----------VSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQ--------TDVV-- 452
             +          V  KPQ     F GTV +     I G+    Q +         D V  
Sbjct: 1143 WDTNKLRTIISVVEQKPQF----FDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFS 1198

Query: 453  KPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRR 512
             P  +++ ID  +  +SGG+ QR++I  A+     I  +DE ++ LD+      + +I++
Sbjct: 1199 LPEGLDTRIDTSL--ISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIKK 1256

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 78/183 (42%), Gaps = 24/183 (13%)

Query: 102  PGQVLGLVGTNGIGKST-ALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
             G+ + +VG +G GKST  L I A  + PN     D            G ++  + T  L
Sbjct: 1101 SGETIAVVGESGSGKSTLTLLISALYEVPNGSIEID------------GIDINRWDTNKL 1148

Query: 161  EDNIKAI-IKPQYVD-----NIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHV 214
               I  +  KPQ+ D     N+   I G V ++     L L   QD    + + LD    
Sbjct: 1149 RTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDT--- 1205

Query: 215  LKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQ-RLNAALVIRSLLNATTY 273
             + D   +SGG+ QR +I  + +++  +   DE +S LD       A L+ +     TT 
Sbjct: 1206 -RIDTSLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIKKHFCGITTI 1264

Query: 274  VIS 276
            VI+
Sbjct: 1265 VIT 1267

>Kwal_47.19116
          Length = 607

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 81/179 (45%), Gaps = 36/179 (20%)

Query: 383 MMGENGTGKTTLIKLLAGALSP-DDGQKVPKLNVSMKPQKI-APKFPGTVRQLFFKR--- 437
           ++GENG GK+T +K LA    P  +   V  L+   +P +  A ++     Q   KR   
Sbjct: 109 LLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVVNEAQNELKRLED 168

Query: 438 -IRGQFLNPQFQTDVVK----------PLKIES--------------IIDQEVQHLSGGE 472
            +    L    ++DV++          P   ES               I+++ + +SGG 
Sbjct: 169 LVEKTILEDGPESDVLEGIYERMDSLDPSTFESRAAVILIGLGFNSKTINKKTKDMSGGW 228

Query: 473 LQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  LV H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 27/167 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRYDDPPEWQDI--IRYFRGSELQNY 155
           G+  GL+G NG GKST LK LA K+ P     ++   D+P E  +   + Y   +E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVV-NEAQNE 162

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDL---- 211
             K LED ++  I             GP   V E +  R++ S D + +  +A  +    
Sbjct: 163 L-KRLEDLVEKTILED----------GPESDVLEGIYERMD-SLDPSTFESRAAVILIGL 210

Query: 212 ---QHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
                 + +    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 211 GFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 79/197 (40%), Gaps = 43/197 (21%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+     GR         + R+                ++K
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGR---------VSRH---------------THVK 456

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVL----KRDVGA 221
             +  Q+  +     K P+    E ++ +      D +Y    L    +        +  
Sbjct: 457 LGVYSQHSQDQLDLTKSPL----EFVRDKYSHISHDFQYWRGQLGRYGLTGEGQTSQMAT 512

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY----VISV 277
           LS G+  R    +  +Q  +V + DEP++ LD+         I SL +A       V+ V
Sbjct: 513 LSEGQRSRVVFALLALQAPNVLLLDEPTNGLDIA-------TIDSLADAINEFNGGVVVV 565

Query: 278 EHDLSVLDYLSDFVCIL 294
            HD  +LD ++  + ++
Sbjct: 566 SHDFRLLDKIAKDIFVV 582

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 81/183 (44%), Gaps = 16/183 (8%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ--KV 410
           SFAY    + + +   ++  G   DS +  ++G NG GK+TL+K++ G L+   G+  + 
Sbjct: 396 SFAYDG--KPENNLYEHLNFGVDMDSRV-ALVGPNGVGKSTLLKIMTGELATQSGRVSRH 452

Query: 411 PKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVK----PLKIESIIDQEVQ 466
             + + +  Q    +   T   L F R +   ++  FQ    +     L  E    Q + 
Sbjct: 453 THVKLGVYSQHSQDQLDLTKSPLEFVRDKYSHISHDFQYWRGQLGRYGLTGEGQTSQ-MA 511

Query: 467 HLSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVE 525
            LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I  F         +V 
Sbjct: 512 TLSEGQRSRVVFALLALQAP-NVLLLDEPTNGLDIATIDSLADAINEF----NGGVVVVS 566

Query: 526 HDF 528
           HDF
Sbjct: 567 HDF 569

>Scas_40.1
          Length = 203

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 71/179 (39%), Gaps = 32/179 (17%)

Query: 89  ANSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRY----DDPPEW 140
           +N   +H +    P G ++ +VG +G GK+T L +LA K    L   G Y    D     
Sbjct: 32  SNKTIVHDVSMDLPSGSIMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADGGSRQ 91

Query: 141 QDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQD 200
           QDI           Y  +    + K  ++          +K P Q+   L++        
Sbjct: 92  QDIT--------TAYLAQQDVSSPKLTVRETLSYAADLKLKAPRQERRRLVE-------- 135

Query: 201 DAKYVIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
               +I  L L+      VG      LSGGE +R +IG+  +    +   DEP++ LD 
Sbjct: 136 ---ELIAELGLKECSDTRVGDSEHRGLSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDA 191

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 77/171 (45%), Gaps = 31/171 (18%)

Query: 354 FAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALS---------- 403
            A  S K    D  +++ SGS     I+ ++G +G+GKTTL+ +LA  +S          
Sbjct: 28  IATKSNKTIVHDVSMDLPSGS-----IMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYE 82

Query: 404 --PDDGQKVPKLNVSMKPQK--IAPKFPGTVRQLFFKRIRGQFLNP-QFQTDVVKPLKIE 458
              D G +   +  +   Q+   +PK   TVR+        +   P Q +  +V+ L  E
Sbjct: 83  FVADGGSRQQDITTAYLAQQDVSSPKL--TVRETLSYAADLKLKAPRQERRRLVEELIAE 140

Query: 459 ---------SIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
                     + D E + LSGGE +R++I + +     +  +DEP+  LD+
Sbjct: 141 LGLKECSDTRVGDSEHRGLSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDA 191

>AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -
           SH] complement(994534..997569) [3036 bp, 1011 aa]
          Length = 1011

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 77/184 (41%), Gaps = 24/184 (13%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKF 426
           +LN  SG  S  EIL +MG +G GKT L+ +L       +     K+N     +    K 
Sbjct: 383 ILNSISGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKV 442

Query: 427 PGTVRQ---------LFFKRIRGQFLN-PQFQT---------DVVKPLKIESIIDQEVQH 467
            G V Q         ++   +    L  P+  +          V++ L+I  I D+ + +
Sbjct: 443 VGFVDQDNHLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIRDRLIGN 502

Query: 468 -----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
                +SGGE +RV+I   L     I  +DEP++ LDS       + + R     ++T  
Sbjct: 503 DFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVIECLVRLASQYRRTLV 562

Query: 523 LVEH 526
           L  H
Sbjct: 563 LSIH 566

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 83/216 (38%), Gaps = 35/216 (16%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLE 161
           PG++L ++G +G GK+  L IL  K K   G      +   +               + +
Sbjct: 393 PGEILAVMGGSGAGKTCLLDILGMKNKA--GEVSGTVKINGV--------------PITK 436

Query: 162 DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERS------QDDAKYVIKALDLQHVL 215
             +  ++     DN         + V     LRL RS      Q     V++ L +  + 
Sbjct: 437 HTVSKVVGFVDQDNHLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIR 496

Query: 216 KRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNA 270
            R +G      +SGGE +R +I    V    +   DEP+S LD     NA  VI  L+  
Sbjct: 497 DRLIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSN---NANNVIECLVRL 553

Query: 271 T-----TYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
                 T V+S+    S +  L D + +L     VY
Sbjct: 554 ASQYRRTLVLSIHQPRSNIFRLFDNLVLLNEGEMVY 589

>ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] (623887..628353) [4467 bp, 1488 aa]
          Length = 1488

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 77/179 (43%), Gaps = 17/179 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQK-----PNLGRYDDPPEWQDIIRYFRGSELQNY 155
           RPG+++ ++G  G G ++ LK +AG+            YD  P+ ++++R +R   + N 
Sbjct: 186 RPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQ-REMMRRYRAEVVYN- 243

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVL 215
               ++ +   +   Q +D    A K P  +V  +   R E      +       L+H  
Sbjct: 244 --SEIDVHFPHLTVKQTLD-FALACKTPHMRVNNVS--RAEYITLMRELYATVFGLRHTY 298

Query: 216 KRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLN 269
              VG      +SGGE +R +I  +    A VY +D  +  LD    L  A  +R + N
Sbjct: 299 DTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTN 357

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
           ++ +SGGE +RV+I  AL   A +Y  D  +  LD+   +  ++ +R
Sbjct: 307 IRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMR 353

>YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of
           the ATP-binding cassette (ABC) superfamily of membrane
           transporters, component of the mitochondrial inner
           membrane [2073 bp, 690 aa]
          Length = 690

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 18/156 (11%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           G    +VG++G GKST LK++         R+ DP   + +I    G +++ Y    L  
Sbjct: 462 GWKTAIVGSSGSGKSTILKLVF--------RFYDPESGRILIN---GRDIKEYDIDALRK 510

Query: 163 NIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRLERSQDDAKYVIKAL--DLQHVLKR 217
            I  + +  P + D I   +K G +    E +   +E++Q     +IK L      ++  
Sbjct: 511 VIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQ--LAPLIKKLPQGFDTIVGE 568

Query: 218 DVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
               +SGGE QR AI    ++ A +  FDE +S LD
Sbjct: 569 RGLMISGGEKQRLAIARVLLKNARIMFFDEATSALD 604

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 75/168 (44%), Gaps = 27/168 (16%)

Query: 383 MMGENGTGKTTLIKLLAGALSPD------DGQKVPKLNV-------SMKPQKIAPKFPGT 429
           ++G +G+GK+T++KL+     P+      +G+ + + ++        + PQ   P F  T
Sbjct: 467 IVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQD-TPLFNDT 525

Query: 430 VRQ-LFFKRIRGQFLNPQFQTDVVK----------PLKIESIIDQEVQHLSGGELQRVAI 478
           + + + F RI     + +  T V K          P   ++I+ +    +SGGE QR+AI
Sbjct: 526 IWENVKFGRIDAT--DEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAI 583

Query: 479 VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH 526
              L   A I   DE ++ LD+       + IR       +T+  + H
Sbjct: 584 ARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAH 631

>Scas_108.1
          Length = 335

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 11/131 (8%)

Query: 179 AIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVG-----ALSGGELQRFAIG 233
           A K P ++V  + K    ++  +    I    L+H     VG      +SGGE +R +I 
Sbjct: 1   ACKTPAKRVNNISKAEYVKTTRELYATI--FGLRHTYHTKVGNDFVRGVSGGERKRVSIA 58

Query: 234 MSCVQEADVYMFDEPSSYLDVKQRLNAALVIR---SLLNATTYVISVEHDLSVLDYLSDF 290
            + V    VY +D  +  LD    L  A  IR   +LL +T +V   +   ++ +   D 
Sbjct: 59  EALVANGSVYCWDNATRGLDASTALEYAKAIRIMTNLLESTAFVTIYQASENIYETF-DK 117

Query: 291 VCILYGVPSVY 301
           V +LY    +Y
Sbjct: 118 VTVLYDGRQIY 128

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 522
           V+ +SGGE +RV+I  AL     +Y  D  +  LD+   +  +K IR  I+ N  + TAF
Sbjct: 44  VRGVSGGERKRVSIAEALVANGSVYCWDNATRGLDASTALEYAKAIR--IMTNLLESTAF 101

Query: 523 LV 524
           + 
Sbjct: 102 VT 103

>CAGL0L06402g 718726..723333 highly similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 or sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRI 438
           E+  ++G+ G+GK+  ++ L G L    G      +V+   Q +A    GTVR      +
Sbjct: 676 ELSCIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGSVAYVSQ-VAWIMNGTVRD---NVL 731

Query: 439 RGQFLNPQFQTDVVKPLKI-----------ESIIDQEVQHLSGGELQRVAIVLALGLPAD 487
            G   +P+F    +K   +           ++++ ++   LSGG+  R+++  A+   AD
Sbjct: 732 FGHKYDPEFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARAD 791

Query: 488 IYLIDEPSAYLD 499
            YL+D+P A +D
Sbjct: 792 TYLLDDPLAAVD 803

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 81/187 (43%), Gaps = 41/187 (21%)

Query: 356  YPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTL-------IKLLAGALSPDD-- 406
            Y +  R   D+VL   +      E + ++G  G GK++L       I+  +G +  D   
Sbjct: 1299 YYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGILIDGVH 1358

Query: 407  ----GQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQ---TDVVKPLKIES 459
                G    + ++S+ PQ  +  F GT+R         + ++P  Q    D+ + L++  
Sbjct: 1359 INEIGLHDLRHHLSIIPQD-SQVFEGTIR---------ENIDPTNQFTDADIWRALELSH 1408

Query: 460  IIDQEVQ---------------HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRI 504
            + +  +Q               +LS G+ Q + +  AL +P+ + ++DE +A +D E   
Sbjct: 1409 LKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDK 1468

Query: 505  ICSKVIR 511
            +  + IR
Sbjct: 1469 VIQETIR 1475

>Scas_574.8
          Length = 702

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 32/198 (16%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ---- 408
           +F Y S ++     +LN  S +        ++G +G+GK+T++KL+     P+ G+    
Sbjct: 442 TFGYDSKRK-----ILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILIN 496

Query: 409 --KVPKLNV-------SMKPQKIAPKFPGTVRQ-LFFKRIRGQFLNPQFQTDVVK----- 453
              V + +V        + PQ   P F  T+ + + F RI     + +  T + K     
Sbjct: 497 GVDVKEYDVDSLRRVMGVVPQD-TPLFNDTIWENVKFGRIDAT--DEEVHTVIEKAQLAP 553

Query: 454 -----PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSK 508
                P   E+I+ +    +SGGE QR+AI   L   A I   DE ++ LD+        
Sbjct: 554 LIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLT 613

Query: 509 VIRRFILHNKKTAFLVEH 526
            IR       +T+  + H
Sbjct: 614 TIRANFESGSRTSVYIAH 631

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 84/190 (44%), Gaps = 19/190 (10%)

Query: 83  VTHRYSANSFKLHRLPTPRPGQV-LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQ 141
           VT  Y +    L+      PG +   +VG +G GKST LK++         R+ DP + +
Sbjct: 441 VTFGYDSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVF--------RFYDPEQGR 492

Query: 142 DIIRYFRGSELQNYFTKMLEDNIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRLERS 198
            +I    G +++ Y    L   +  + +  P + D I   +K G +    E +   +E++
Sbjct: 493 ILIN---GVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDATDEEVHTVIEKA 549

Query: 199 QDDAKYVIKAL--DLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQ 256
           Q     +IK L    + ++      +SGGE QR AI    ++ A +  FDE +S LD   
Sbjct: 550 Q--LAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHT 607

Query: 257 RLNAALVIRS 266
                  IR+
Sbjct: 608 EQALLTTIRA 617

>Kwal_26.9480
          Length = 719

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 92/198 (46%), Gaps = 38/198 (19%)

Query: 75  LPTNLEGEVTHRYSANSFKLHRL---------PTPRPGQVLGLVGTNGIGKSTALKILAG 125
           LP N+  E+  +  +  +   RL         PT   G    +VG +G GKST LK++  
Sbjct: 455 LPPNVPSEIVFKNVSFGYDPDRLILKNASFTIPT---GSKTAIVGPSGSGKSTILKLVF- 510

Query: 126 KQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIK--PQYVDNIPRAIK-G 182
                  R+ DP E + ++    G +++    + L  +I  + +  P + ++I   +K G
Sbjct: 511 -------RFYDPIEGRILLD---GKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKFG 560

Query: 183 PVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRD--VG----ALSGGELQRFAIGMSC 236
            +    + ++  ++R+Q      ++AL  Q    RD  VG     +SGGE QR AI    
Sbjct: 561 RIDATDQEIERAIDRAQ------LRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVL 614

Query: 237 VQEADVYMFDEPSSYLDV 254
           +++A +  FDE +S LD 
Sbjct: 615 LKDAPIMFFDEATSALDT 632

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 71/165 (43%), Gaps = 21/165 (12%)

Query: 383 MMGENGTGKTTLIKLLAGALSPD------DGQKVPKLNVSMKPQKIA------PKFPGTV 430
           ++G +G+GK+T++KL+     P       DG+ V +L++    + I       P F  ++
Sbjct: 494 IVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESI 553

Query: 431 R-QLFFKRIRGQFLNPQFQTDVVK--------PLKIESIIDQEVQHLSGGELQRVAIVLA 481
              + F RI       +   D  +        P   ++I+ +    +SGGE QR+AI   
Sbjct: 554 WDNVKFGRIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARV 613

Query: 482 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH 526
           L   A I   DE ++ LD+       + I+       KT+  + H
Sbjct: 614 LLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAH 658

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 83/172 (48%), Gaps = 26/172 (15%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGAL---SPDDGQKVPKLNVSMKPQKIAPK--------- 425
           S ++ ++G  G GK+T++K + G L   S ++    P+  ++       P+         
Sbjct: 645 SSLICVVGRVGAGKSTILKCILGQLPCISGNNDHLSPQFQINATTVAYCPQEAWIMNASV 704

Query: 426 -----FPGTVRQLFFK-RIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIV 479
                F     + F+K  I+   L P  +   V P   E+++ ++   LSGG+  R+++ 
Sbjct: 705 KDNILFGHKYDEAFYKATIKACQLLPDIK---VLPDGDETMVGEKGIVLSGGQKTRLSLA 761

Query: 480 LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
            A+   AD+YL+D+  + +D+E   +C  +I+  +  ++KT  L +   ++A
Sbjct: 762 RAVYSRADLYLLDDILSAVDTE---VCKTIIKEVL--DEKTGLLKDKSIVLA 808

>Scas_710.50
          Length = 602

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 75/166 (45%), Gaps = 22/166 (13%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTK 158
           T +PG +  ++G +G GKST L +++G+ + +              ++     +     +
Sbjct: 25  TFKPGMINAIMGPSGSGKSTLLNLVSGRIESSF-----------FAKFATTGSIMFNDVQ 73

Query: 159 MLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLK-LRLERSQDDAKYV-----IKALDLQ 212
           + E+  K +      D+     K  V++  +    LRL    ++ + +     I+AL L+
Sbjct: 74  ISEEMFKNVCSYVSQDDDHLLAKLTVRETFKFAADLRLHNLTEEQRVIKSDELIRALGLK 133

Query: 213 HVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           H     +G      +SGGE +R  +G+  + +  + + DEP+S LD
Sbjct: 134 HCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLD 179

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 79/191 (41%), Gaps = 33/191 (17%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLN------------ 414
           +L   + +F    I  +MG +G+GK+TL+ L++G +      K                 
Sbjct: 18  ILQSINATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEE 77

Query: 415 --------VSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKI--------- 457
                   VS     +  K   TVR+ F      +  N   +  V+K  ++         
Sbjct: 78  MFKNVCSYVSQDDDHLLAKL--TVRETFKFAADLRLHNLTEEQRVIKSDELIRALGLKHC 135

Query: 458 -ESIIDQE-VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
             +II  E ++ +SGGE +RV + + L     I L+DEP++ LDS       +++++  +
Sbjct: 136 ENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEILKKLSV 195

Query: 516 HNKKTAFLVEH 526
              KT  +  H
Sbjct: 196 EYGKTIIITIH 206

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 ATP-binding cassette transporter
           family member, hypothetical start
          Length = 706

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 92/206 (44%), Gaps = 27/206 (13%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQ-----DIIRYFRGSELQ 153
           T RPG+ + +VG +G GKST   +L         RY D    +     D IR F   + +
Sbjct: 452 TVRPGEHVCIVGPSGGGKSTVASLLL--------RYYDIGSGEIKLGNDNIRDFNLRKYR 503

Query: 154 NYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQH 213
                + ++ +  +     +DNI  A+  P + V +  + R+ R+   A       +   
Sbjct: 504 RLLGVVQQEPM--LFSGTILDNITYAV--PQELVND--ETRISRAIGQANCTKFLANFPD 557

Query: 214 VLKRDVG----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR--LNAALVIRSL 267
            L+  VG     LSGG+ QR A+  + + +  + + DE +S LD +    +  +L  RS 
Sbjct: 558 GLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSA 617

Query: 268 LNATTYVISVEHDLSVLDYLSDFVCI 293
              TT  IS+ H +S + + S  + +
Sbjct: 618 RGKTT--ISIAHRVSTIQHSSRVIVL 641

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%)

Query: 454 PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
           P  +++ +      LSGG+ QR+A+  A  L   I ++DE ++ LDS+   + ++ +++ 
Sbjct: 556 PDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQR 615

Query: 514 ILHNKKT 520
               K T
Sbjct: 616 SARGKTT 622

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 11/117 (9%)

Query: 173  VDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQ---HVLKRDV------GALS 223
            V+  P+   G V++   +  L+   S  + + V+K++DL      L  D+      G +S
Sbjct: 1114 VEQKPKFFDGTVRE-NLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRVHDGLMS 1172

Query: 224  GGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHD 280
            GG+ QR +I  + +++  + + DE +S LD       A +IR++L   T VI + H 
Sbjct: 1173 GGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLKNVT-VIVITHS 1228

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 85/208 (40%), Gaps = 48/208 (23%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLL-------AGAL--- 402
           SFAYP+      D+VL   S          ++G++G+GK+TL  LL        G +   
Sbjct: 363 SFAYPTRP---DDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTGEIKFG 419

Query: 403 -----SPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLF-----------------FKRIRG 440
                S DD   V   N+++  Q+    F GT++                    F  +  
Sbjct: 420 EYEIDSLDDSWLVE--NITLVEQR-CTLFNGTLKDNLTIVNKYASCTEVKQACQFALLNT 476

Query: 441 QFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 500
             LN         P  I++++ +    LSGG+ QRVA+  A      + ++DE  + LD 
Sbjct: 477 VLLNL--------PNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDI 528

Query: 501 EQRIICSKVIRRFILHNKKTAFLVEHDF 528
             R +  + IR +     KT  ++ H++
Sbjct: 529 MSRELIVEAIRHW--RKGKTTIILTHEY 554

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 133/304 (43%), Gaps = 53/304 (17%)

Query: 261  ALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVT----LPSSVREGINI 316
            A+V++++L      + ++ + SV      F  +L+ + +   ++     +    R    I
Sbjct: 941  AMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAATYI 1000

Query: 317  F--LE--GHI------PSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMKRTQGDF 366
            F  LE  G +      PS+N  F      F     +E ++  + + +F+   M +     
Sbjct: 1001 FKVLEDSGSVDTSKPDPSQNQSF------FSTAGNRETIKISNLSFAFSSAPMNK----- 1049

Query: 367  VLNVESGSFSDSEILVMMGENGTGKTTLI------------KLLAGALSPDDGQKVP-KL 413
            + N  S     +E + ++GE+G+GK+TL             K+  G +  +   +   + 
Sbjct: 1050 IFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRR 1109

Query: 414  NVSMKPQKIAPKF-PGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESII-------DQEV 465
             +S+  QK  PKF  GTVR+     ++    N + ++ V+K + + S +       +  V
Sbjct: 1110 TISIVEQK--PKFFDGTVRENLVYGLKRNVSNSELRS-VLKSVDLLSFVQTLPNDLNTRV 1166

Query: 466  QH--LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFL 523
                +SGG+ QR++I   L     I ++DE ++ LD+      +++IR  +L N  T  +
Sbjct: 1167 HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRT-VLKN-VTVIV 1224

Query: 524  VEHD 527
            + H 
Sbjct: 1225 ITHS 1228

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%)

Query: 214 VLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY 273
           +L R    LSGG+ QR A+  + ++   V + DE  S LD+  R      IR      T 
Sbjct: 488 LLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHWRKGKTT 547

Query: 274 VI 275
           +I
Sbjct: 548 II 549

>ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W
            (PDR15) - NSH] complement(628623..633161) [4539 bp, 1512
            aa]
          Length = 1512

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 102/265 (38%), Gaps = 73/265 (27%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L +LA + +                                
Sbjct: 881  KPGTLTALMGSSGAGKTTLLDVLANRVR-------------------------------- 908

Query: 161  EDNIKAIIKPQYVDNIPRA--------------IKGPVQKVGELLK----LRLERSQDDA 202
               +  +    +VD +PR               + G  Q V + LK    LR  +S  +A
Sbjct: 909  ---VGVVTGDMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEA 965

Query: 203  KY------VIKALDLQHVLKRDVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSY 251
            +       +I+ L+++      VG    G    + +R  IG+  V + ++ +F DEP+S 
Sbjct: 966  EIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSG 1025

Query: 252  LDVKQRLNAALVIRSLLNATTYVISVEHDLS--VLDYLSDFVCILYGVPSVY------GV 303
            LD +   +   ++R L N    V+   H  S  ++      + +  G  +VY      G 
Sbjct: 1026 LDSQTAWSVCQLMRKLANHGQAVLCTIHQPSAILMQEFDRLLLLASGGRTVYFGGLGKGC 1085

Query: 304  VTLPSSV-REGINIFLEGHIPSENM 327
             T+     + G   F EG  P+E M
Sbjct: 1086 ATMVEYFEKHGSQKFPEGCNPAEFM 1110

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [3150 bp, 1049 aa]
          Length = 1049

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 102/246 (41%), Gaps = 47/246 (19%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWQDIIRYFRGSEL 152
           +PGQ+L ++G +G GK+T L ILA K+K           G   D   +  II +    + 
Sbjct: 414 KPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDF 473

Query: 153 QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQ 212
                 + E  + + +       +P+A             L  E  +     V++ L + 
Sbjct: 474 LLPTLTVFETVLNSALL-----RLPKA-------------LSFEAKKARVYKVLEELRII 515

Query: 213 HVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSL 267
            +  R +G      +SGGE +R +I    V    V   DEP+S LD     NA  VI  L
Sbjct: 516 DIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAS---NANNVIECL 572

Query: 268 LNAT-----TYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFL--EG 320
           +  +     T V+S+    S + YL D + +L     VY      S   + ++ FL  EG
Sbjct: 573 VRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVY------SGNAKKVSEFLRNEG 626

Query: 321 HIPSEN 326
           +I  +N
Sbjct: 627 YICPDN 632

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 67/160 (41%), Gaps = 24/160 (15%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKF 426
           VLN  SG     +IL +MG +G GKTTL+ +LA            K+N     +K   K 
Sbjct: 405 VLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKI 464

Query: 427 PGTVRQ---------LFFKRIRGQFLN-PQFQTDVVKPLKIESIIDQEV----------- 465
            G V Q         +F   +    L  P+  +   K  ++  ++++             
Sbjct: 465 IGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGN 524

Query: 466 ---QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQ 502
              + +SGGE +RV+I   L     +  +DEP++ LD+  
Sbjct: 525 EFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASN 564

>Scas_628.13
          Length = 1060

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 73/181 (40%), Gaps = 34/181 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWQDIIRYFRGSEL 152
           +PGQ+  ++G +G GK+T L ILA K+K           G       +  +I +    + 
Sbjct: 425 KPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFV---DQ 481

Query: 153 QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQ 212
            +Y    L   +   +    +  +PR              +  E  Q     +++ L + 
Sbjct: 482 NDYLHPTL--TVYETVLNSALLRLPRT-------------MSFESKQSRVFQILEELRIF 526

Query: 213 HVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSL 267
            +  R +G      +SGGE +R +I    V    +   DEP+S LD     NA  VI SL
Sbjct: 527 DIKDRIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDAN---NANNVITSL 583

Query: 268 L 268
           +
Sbjct: 584 V 584

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 73/191 (38%), Gaps = 38/191 (19%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKF 426
           VL    G     +I  +MG +G GKTTL+ +LA            K+N ++  +K   K 
Sbjct: 416 VLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKL 475

Query: 427 PGTVRQLFFKRIRGQFLNPQFQT--------------------------DVVKPLKIESI 460
            G V Q         +L+P                               +++ L+I  I
Sbjct: 476 IGFVDQ-------NDYLHPTLTVYETVLNSALLRLPRTMSFESKQSRVFQILEELRIFDI 528

Query: 461 IDQEVQH-----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
            D+ + +     +SGGE +RV+I   L     I  +DEP++ LD+         + R   
Sbjct: 529 KDRIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDANNANNVITSLVRLAK 588

Query: 516 HNKKTAFLVEH 526
           +  +T  L  H
Sbjct: 589 NYNRTLILTIH 599

>YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters, represents a half-sized ABC protein [2322
           bp, 773 aa]
          Length = 773

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 127/311 (40%), Gaps = 51/311 (16%)

Query: 224 GGELQRFAIGMSCVQEADVYMFDEPSSYLDVK----QRLNAALVIRSLLNATTYVISVEH 279
           G EL R+ + +      D++   + +++ + K      L   L   ++L   +Y++ ++ 
Sbjct: 327 GNELSRYNVAIR-----DIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLV-LQS 380

Query: 280 DLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGIN----IF-LEGHIPSENMRFRQEAL 334
            LS+ D  +  +   Y   +V+G+ T  S + +G      +F L    PS +     +  
Sbjct: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK 440

Query: 335 QFRMVDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTL 394
             R V     +E +D   SF+YP+    Q    LN +    S    + ++G +G GK+T+
Sbjct: 441 PDRGV-----IEFKDV--SFSYPTRPSVQIFKNLNFKIAPGSS---VCIVGPSGRGKSTI 490

Query: 395 IKLLAGALSPD------DGQKVPKLNVSMKPQKIA------PKFPGTVRQLF-------- 434
             LL    +P       D Q + KLN     + I           GT+R           
Sbjct: 491 ALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550

Query: 435 ----FKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYL 490
                + +  Q     F T    P   +++I      LSGG+ QR+AI  AL     I +
Sbjct: 551 TKEEIRSVAKQCFCHNFITKF--PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608

Query: 491 IDEPSAYLDSE 501
           +DE ++ LD E
Sbjct: 609 LDEATSALDVE 619

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY-VISVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+           L+ + +  ++S+ H 
Sbjct: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645

Query: 281 LSVL 284
           LS +
Sbjct: 646 LSTI 649

>Kwal_56.22329
          Length = 776

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 82/196 (41%), Gaps = 25/196 (12%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ-KVP 411
           SF+YP+     G+ + N  + +      + ++G +G GK+T+  LL    +P  GQ  + 
Sbjct: 494 SFSYPTRP---GNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITID 550

Query: 412 KLNVSMKPQKIAPKFPGTVRQ---LFFKRIRGQF---LNPQFQTDVVK------------ 453
             ++S    K   +  G V+Q   L    I+      L  +   D ++            
Sbjct: 551 DQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFV 610

Query: 454 ---PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 510
              P   ++II      LSGG+ QR+AI  AL     I ++DE ++ LD E     +  +
Sbjct: 611 TKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTL 670

Query: 511 RRFILHNKKTAFLVEH 526
            + +   + T   + H
Sbjct: 671 GKLMKSKELTIISIAH 686

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 82/200 (41%), Gaps = 34/200 (17%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRY--DDPPEWQDIIRYFRGSELQNYF 156
           T  PG  + +VG +G GKST   +L     P+ G+   DD    QDI R           
Sbjct: 512 TIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDD----QDISRLS--------- 558

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKAL------- 209
            K L  ++        V   P  + G + K      L+ E S D+ + V K         
Sbjct: 559 CKSLRRHLGV------VQQEPMLMSGSI-KYNLTYGLQSEVSMDEIRSVAKKCFCHGFVT 611

Query: 210 ----DLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIR 265
                   ++     +LSGG+ QR AI  + +++  + + DE +S LDV+        + 
Sbjct: 612 KFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLG 671

Query: 266 SLLNATTY-VISVEHDLSVL 284
            L+ +    +IS+ H LS +
Sbjct: 672 KLMKSKELTIISIAHRLSTI 691

>CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 or sp|Q04182 Saccharomyces
            cerevisiae YDR406w PDR15 or sp|P51533 Saccharomyces
            cerevisiae YOR328w, hypothetical start
          Length = 1499

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 29/201 (14%)

Query: 344  QLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA---- 399
            Q EA    R+  Y    + +   +LN   G      +  +MG +G GKTTL+  LA    
Sbjct: 852  QSEAIFHWRNLCYDVQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVT 911

Query: 400  -----GALSPDDGQKVPKLNVSM---KPQKIAPKFPGTVRQLFFKRIRGQFLNP------ 445
                 G +S D  Q+      S+   + Q +  K   TVR+    R       P      
Sbjct: 912  MGVITGEVSVDGKQRDDSFARSIGYCQQQDLHLK-TSTVRESL--RFSAYLRQPADVSIE 968

Query: 446  ---QFQTDVVKPLKIESIIDQEV----QHLSGGELQRVAIVLALGL-PADIYLIDEPSAY 497
               Q+  DV+K L++E   D  V    + L+  + +R+ I + L   P  +  +DEP++ 
Sbjct: 969  EKNQYVEDVIKILEMEQYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSG 1028

Query: 498  LDSEQRIICSKVIRRFILHNK 518
            LDS+      +++++   H +
Sbjct: 1029 LDSQTAWSICQLMKKLANHGQ 1049

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVS-MKPQKIAPK 425
           +L    G+ +  E+LV++G  G+G TTL+K ++      +  K   ++ S M P  I   
Sbjct: 164 ILKSMEGAVNPGELLVVLGRPGSGCTTLLKSISSNTHGFNIAKESTISYSGMTPNDIRKH 223

Query: 426 FPGTV 430
           F G V
Sbjct: 224 FRGEV 228

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
           cassette transporter protein, mitochondrial,
           hypothetical start
          Length = 720

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 74/168 (44%), Gaps = 27/168 (16%)

Query: 383 MMGENGTGKTTLIKLLAGALSPD------DGQKVPKLN-------VSMKPQKIAPKFPGT 429
           ++G +G+GK+T+++L+     P       DG+ + +L+       V + PQ   P F  T
Sbjct: 487 IVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQD-TPLFNDT 545

Query: 430 VRQ-LFFKRIRGQFLNPQFQTDVVK----------PLKIESIIDQEVQHLSGGELQRVAI 478
           + + + F RI     + +  T + K          P   E+I+ +    +SGGE QR+AI
Sbjct: 546 IWENVKFGRINAT--DNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAI 603

Query: 479 VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH 526
              L     I   DE ++ LD+       K I+       KT+  + H
Sbjct: 604 ARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAH 651

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 72/165 (43%), Gaps = 26/165 (15%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTK 158
           T  PG+   +VG +G GKST L+++     P  GR     + +DI R     EL+     
Sbjct: 478 TIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRI--LLDGKDI-RELDLDELRRIVGV 534

Query: 159 MLEDNIKAIIKPQYVDNIPRAIK-GPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKR 217
           + +D       P + D I   +K G +      +   +E++Q          DL H L +
Sbjct: 535 VPQDT------PLFNDTIWENVKFGRINATDNEIVTAIEKAQLS--------DLIHKLPK 580

Query: 218 D----VG----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
                VG     +SGGE QR AI    +++  +  FDE +S LD 
Sbjct: 581 GTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDT 625

>Scas_587.8
          Length = 715

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 31/183 (16%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLL-------AGALSPD 405
           SFAYP+ + T    +LN  S S    E + ++G +G+GK+T+  LL        G++   
Sbjct: 449 SFAYPT-RPTHS--ILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKI- 504

Query: 406 DGQKVPKLNVSMKP------QKIAPKFPGTV-RQLFFKRIRGQFLNPQF--------QTD 450
           DGQ + + N+          Q+    F GT+   + +  +  + L            Q +
Sbjct: 505 DGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQAN 564

Query: 451 VVKPLK-----IESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRII 505
             K LK     + +++      LSGG+ QR+A+  A  L   + ++DE ++ LDS+   I
Sbjct: 565 CTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEI 624

Query: 506 CSK 508
            +K
Sbjct: 625 VAK 627

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 34/72 (47%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDL 281
           LSGG+ QR A+  + +    + + DE +S LD +     A  +   +      IS+ H L
Sbjct: 587 LSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVELGLTTISIAHRL 646

Query: 282 SVLDYLSDFVCI 293
           S + + +  + +
Sbjct: 647 STIKHSTRVIVL 658

>Scas_693.42
          Length = 1512

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRI 438
           E+  ++G+ G+GK+ +I+ + G L    G      NV+   Q +A    GTV++     +
Sbjct: 654 ELTCIVGKVGSGKSAMIQSILGDLFRVKGFATIHGNVAYVSQ-VAWIMNGTVKE---NIL 709

Query: 439 RGQFLNPQFQTDVVKPLKI-----------ESIIDQEVQHLSGGELQRVAIVLALGLPAD 487
            G   +  F    +K   +           ++++ ++   LSGG+  R+++  A+   AD
Sbjct: 710 FGHKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRAD 769

Query: 488 IYLIDEPSAYLD 499
            YL+D+P A +D
Sbjct: 770 TYLLDDPLAAVD 781

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD---VKQRLNAALVIRSLLNATTYVISV 277
           +LSGG+  R ++  +    AD Y+ D+P + +D    +  +   L    LL+  T V++ 
Sbjct: 749 SLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLAT 808

Query: 278 EHDLSVLDYLSDFVCIL 294
            + +SVL  ++D V +L
Sbjct: 809 -NKVSVLS-IADSVSLL 823

>Sklu_2343.3 YPL270W, Contig c2343 2058-4382
          Length = 774

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 75/173 (43%), Gaps = 29/173 (16%)

Query: 353 SFAYPSMKRTQ--GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ-K 409
           SF+YP+    Q   +    ++SGS      + ++G +G GK+T+  LL    +P  G+  
Sbjct: 479 SFSYPTRSANQIFNNLNFTIDSGSN-----VCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533

Query: 410 VPKLNVSMKPQKIAPKFPGTVRQ---LFFKRIRGQFLNPQFQTDVVKPLK---------- 456
           +   ++S    K   +  G V+Q   L    IR         T  +  ++          
Sbjct: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHN 593

Query: 457 --------IESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 501
                    E++I  +   LSGG+ QR+AI  AL    +I ++DE ++ LD E
Sbjct: 594 FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNA-TTYVISVEHD 280
           LSGG+ QR AI  + +++ ++ + DE +S LDV+        +  L+ +    +IS+ H 
Sbjct: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672

Query: 281 LSVL 284
           LS +
Sbjct: 673 LSTI 676

>YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the
           ATP-binding cassette (ABC) superfamily, equivalent to a
           "half-sized" ABC protein with one ATP-binding domain and
           one transmembrane domain, involved in release of
           peptides from mitochondria [2088 bp, 695 aa]
          Length = 695

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 93/231 (40%), Gaps = 36/231 (15%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPE---------WQDIIRYFRG 149
           T +PG+ +  VG +G GKST   +L      N G  +   E         ++ +I Y + 
Sbjct: 456 TIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQ 515

Query: 150 SELQNYFTKMLEDNIKAIIKPQYV---DNIPRAIKGPVQKVGELLKLRLERSQDDAKYVI 206
             L   F   + DNI   I P+     D I RAI                   +  K++ 
Sbjct: 516 EPL--LFNGTILDNILYCIPPEIAEQDDRIRRAIG----------------KANCTKFLA 557

Query: 207 KALD-LQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIR 265
              D LQ ++      LSGG+ QR A+  + + +  V + DE +S LD +     A  ++
Sbjct: 558 NFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQ 617

Query: 266 SLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINI 316
             +      IS+ H LS + + +  + +       +G V    S R+ I I
Sbjct: 618 RRVERGFTTISIAHRLSTIKHSTRVIVL-----GKHGSVVETGSFRDLIAI 663

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%)

Query: 454 PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRR 512
           P  +++++      LSGG+ QR+A+  A  L   + ++DE ++ LDS+   I +K ++R
Sbjct: 560 PDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQR 618

>Kwal_56.23844
          Length = 1494

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQ--LFFK 436
           E+  ++G+ G+GK+ LI+ + G L    G      +++   Q +     GTV++  LF  
Sbjct: 642 ELTCIVGKVGSGKSALIQGILGDLFRVKGFASVHGSIAYVSQ-VPWIMNGTVKENILFGH 700

Query: 437 RIRGQFLNPQFQT-----DV-VKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYL 490
           +    F +   +      D+ + P   E+++ ++   LSGG+  R+++  A+   AD YL
Sbjct: 701 KYDADFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYL 760

Query: 491 IDEPSAYLD 499
           +D+P A +D
Sbjct: 761 LDDPLAAVD 769

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 69/150 (46%), Gaps = 21/150 (14%)

Query: 383  MMGENGTGKTTLIKLLAGALSPDDGQ----KVPKLNVSMKPQK----IAPK----FPGTV 430
            ++G  G GK++L   L   +   +G+     VP  ++ ++  +    I P+    F GTV
Sbjct: 1284 IVGRTGAGKSSLTLALFRIIEAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTV 1343

Query: 431  RQ------LFFKRIRGQFLNPQFQTDVVKPL---KIESIIDQEVQHLSGGELQRVAIVLA 481
            R+       +        L      D +K L   ++ES++ +   +LS G+ Q + +  A
Sbjct: 1344 RENIDPTNEYTDEEIWHALELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARA 1403

Query: 482  LGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
            L +P  I ++DE +A +D E   +  + IR
Sbjct: 1404 LLIPTRILVLDEATAAVDVETDQVIQETIR 1433

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD---VKQRLNAALVIRSLLNATTYVISV 277
           +LSGG+  R ++  +    AD Y+ D+P + +D    K  +   L  + LL++   V++ 
Sbjct: 737 SLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLAT 796

Query: 278 E--HDLSVLDYLS 288
                LS+ D++S
Sbjct: 797 NKISVLSIADHIS 809

>Scas_468.1
          Length = 691

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 129/296 (43%), Gaps = 50/296 (16%)

Query: 241 DVYMFDEPSSYLDVKQRLNAALV----IRSLLNATTYVISVEHDLSVLDYLSDFVCILYG 296
           +++   + S++++ K   + +LV      ++L   +Y++ +   L++ D  +  +   Y 
Sbjct: 283 NIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV-LHGSLTIGDLTAFMLYTEYT 341

Query: 297 VPSVYGVVTLPSSVREGIN----IF-LEGHIPSENMRFRQEALQFRMVDAQEQLEAEDAT 351
             S++G+ T  S + +G      +F L  ++P       +  L    +  + ++E ++  
Sbjct: 342 GNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE-----IRPTLGKTYLPGKGEIEFKNV- 395

Query: 352 RSFAYPSMKRTQ--GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD---- 405
            SF+YP+  + Q   +    +E GS      + ++G +G GK+T+  LL    +P     
Sbjct: 396 -SFSYPTRPQNQIFKNLNFKIEPGSN-----VCIVGPSGKGKSTIALLLLHYYNPTSGQI 449

Query: 406 --DGQKVPKLNVSMKPQKIA------PKFPGTVRQLF------------FKRIRGQFLNP 445
             DGQ + K+N     +K+           G++R                +++  Q    
Sbjct: 450 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 509

Query: 446 QFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 501
            F T    P   ++ I      LSGG+ QR+AI  AL    +I ++DE ++ LD E
Sbjct: 510 NFITKF--PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 563

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY-VISVEHD 280
           LSGG+ QR AI  + +++ ++ + DE +S LDV+           L+   +  ++S+ H 
Sbjct: 530 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 589

Query: 281 LSVL 284
           LS +
Sbjct: 590 LSTI 593

>KLLA0D02156g complement(184520..186085) similar to sgd|S0002468
           Saccharomyces cerevisiae YDR061w, start by similarity
          Length = 521

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 41/74 (55%)

Query: 440 GQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLD 499
            ++++P+  T ++K LK+  I D+    LS G+++R  +  +L    D+ +ID+P   LD
Sbjct: 131 NRYVDPELLTYLLKELKLIDIKDRWAMGLSNGQMRRTRLARSLLKEPDLTIIDDPFLGLD 190

Query: 500 SEQRIICSKVIRRF 513
                I SK + ++
Sbjct: 191 PSACSIISKFLSKY 204

>KLLA0F20075g complement(1868786..1873336) similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 glutathione
           S-conjugate transporter, vacuolar, start by similarity
          Length = 1516

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRI 438
           E+  ++G+ G+GK+ LI+ L G L    G      +V+   Q +     GTV+      +
Sbjct: 654 ELTCIVGKVGSGKSALIQSLLGDLIRVKGFATVHGDVANVSQ-VPWIMNGTVKD---NIL 709

Query: 439 RGQFLNPQFQTDVVKPLKI-----------ESIIDQEVQHLSGGELQRVAIVLALGLPAD 487
            G   +P+F    +K   +           ++++ ++   LSGG+  R+++  A+   AD
Sbjct: 710 FGHKYDPEFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRAD 769

Query: 488 IYLIDEPSAYLD 499
            YL+D+P A +D
Sbjct: 770 TYLLDDPLAAVD 781

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD---VKQRLNAALVIRSLLNATTYVIS 276
           +LSGG+  R ++  +    AD Y+ D+P + +D    K  +   L    LL++ T V++
Sbjct: 749 SLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLA 807

>Kwal_56.22747
          Length = 1538

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 78/187 (41%), Gaps = 32/187 (17%)

Query: 356  YPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD------DGQK 409
            Y +  R   D VL          E + ++G  G GK+TL   L   L P       DG  
Sbjct: 1294 YSTRYRANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDIDGVD 1353

Query: 410  VPKL-------NVSMKPQKIAPKFPGTVR-----------QLFFKRIRGQFLNP---QFQ 448
            + K+       N+S+ PQ  A  F GTVR           +  +K +    L P   +  
Sbjct: 1354 ISKIGLKDLRSNLSIIPQD-AQAFEGTVRTNLDPFEQYSDEEIWKALELSHLKPHILKMA 1412

Query: 449  TDVVKPLKIESIIDQEVQ----HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRI 504
             D   P K E ++  ++     +LS G+ Q + +  AL   + I ++DE +A +DSE   
Sbjct: 1413 KDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDR 1472

Query: 505  ICSKVIR 511
            +  + IR
Sbjct: 1473 LIQETIR 1479

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 44/74 (59%), Gaps = 5/74 (6%)

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           E+++ ++   LSGG+  R+++  A+   +D+YL+D+  + +D+E   +C ++I + +  +
Sbjct: 749 ETLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAE---VCKRIIEQVL--S 803

Query: 518 KKTAFLVEHDFIMA 531
           KKT  L     I+ 
Sbjct: 804 KKTGLLKNKTVILT 817

>KLLA0D04059g complement(338422..343128) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, start by
           similarity
          Length = 1568

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 76/161 (47%), Gaps = 25/161 (15%)

Query: 369 NVESGSFSDSEILVMMGENGTGKTTLIKLLAGAL---SPDDGQKV-PKLNVSMKPQKIAP 424
           ++E+ S   +++  ++G  G+GK+T ++ + G L   S D    V PK+ +        P
Sbjct: 644 SIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQLPCVSSDSASGVKPKVVIRADNLAYCP 703

Query: 425 KFPGTV---------------RQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLS 469
           + P  +                 ++ K I+   L P  +   + P   ++++ ++   LS
Sbjct: 704 QQPWIMNASLKDNILFGYKYDEAMYKKTIKACQLLPDLE---ILPDGDQTLVGEKGISLS 760

Query: 470 GGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 510
           GG+  R+++  A+   AD+YL+D+  + +DS    +C  +I
Sbjct: 761 GGQKARLSLARAVYSRADLYLLDDVLSAVDSH---VCKSII 798

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 67/161 (41%), Gaps = 33/161 (20%)

Query: 383  MMGENGTGKTTLIKLLAGALSP------DDGQKVPKL-------NVSMKPQKIAPKFPGT 429
            ++G  G GK+TL   L   L P       DG  +  L       ++S+ PQ  A  F GT
Sbjct: 1347 VVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQD-AQAFEGT 1405

Query: 430  VRQLF-----------FKRIRGQFLNPQFQ-------TDVVKPLK-IESIIDQEVQHLSG 470
            VR              +K +    L P  +        D  KP   +++ I     +LS 
Sbjct: 1406 VRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSELPDDENKPTDLLDTQISDNGNNLSM 1465

Query: 471  GELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
            G+ Q + +  AL  P+ I ++DE +A +D E   I  + IR
Sbjct: 1466 GQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIR 1506

>KLLA0B09702g complement(842245..846801) highly similar to sp|Q02785
           Saccharomyces cerevisiae YPL058c PDR12 multidrug
           resistance transporter, start by similarity
          Length = 1518

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 94/225 (41%), Gaps = 31/225 (13%)

Query: 95  HRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RYDDPPEWQDIIRYFRG 149
           H +     G++L +VG  G G ST LK ++G+    +       YD   +  +++  F+G
Sbjct: 167 HCVGVVESGEMLFVVGRPGAGCSTLLKCVSGETSELVEVTGDFSYDGLSQ-AEMMEKFKG 225

Query: 150 S-----ELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKY 204
                 EL  +F K+    +K  I      +     K P  ++  L + +   +  D   
Sbjct: 226 YVIYCPELDFHFPKI---TVKETI------DFALKCKTPRVRIDHLSRNQYVDNMRDLWC 276

Query: 205 VIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
            +    L+H    +VG      +SGGE +R ++  +    A +Y +D  +  LD    L 
Sbjct: 277 TV--FGLRHTYATNVGNDVVRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALE 334

Query: 260 AALVIRS---LLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
            A  IR+   L+N +  V   +   ++ + L D   +LY    VY
Sbjct: 335 FAQAIRTATNLMNNSAIVAIYQAGENIYE-LFDKTTVLYNGKQVY 378

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V AL + A IY  D  +  LD+   +  ++ IR
Sbjct: 294 VRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEFAQAIR 340

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALS 403
           ++  +MGE+G GKTTL+ +LA  +S
Sbjct: 873 KMTALMGESGAGKTTLLNVLAQRIS 897

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
           sterol uptake and anaerobic growth, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4185 bp, 1394 aa]
          Length = 1394

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 205 VIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           +++   L HVLK  VG      +SGGE +R +I  + +    VY++D  +  LD    L+
Sbjct: 150 LLREFGLSHVLKTIVGNDFFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALD 209

Query: 260 AALVIRSLLNAT 271
              ++R +  AT
Sbjct: 210 FLEILRKMAKAT 221

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLA 399
           ++N  SG F  S +  +MGE+G GKTTL+ +L+
Sbjct: 765 LINNASG-FISSGLTALMGESGAGKTTLLNVLS 796

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
           glutathione S-conjugate transporter, member of the
           ATP-binding cassette (ABC) superfamily [4548 bp, 1515
           aa]
          Length = 1515

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 62/125 (49%), Gaps = 9/125 (7%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQ--LFFKRIRG 440
           ++G+ G+GKT L+  + G L    G      +V+   Q +     GTV++  LF  R   
Sbjct: 661 IVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQ-VPWIMNGTVKENILFGHRYDA 719

Query: 441 QFLNPQFQT-DVVKPLKI-----ESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEP 494
           +F     +   +   L I     ++++ ++   LSGG+  R+++  A+   AD YL+D+P
Sbjct: 720 EFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDP 779

Query: 495 SAYLD 499
            A +D
Sbjct: 780 LAAVD 784

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 12/92 (13%)

Query: 172 YVDNIPRAIKGPVQK---VGELLKLRLERSQDDAKYVIKALDLQHVLKRD---VG----A 221
           YV  +P  + G V++    G   +   E  +   K     +DL  ++  D   VG    +
Sbjct: 695 YVSQVPWIMNGTVKENILFGH--RYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGIS 752

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           LSGG+  R ++  +    AD Y+ D+P + +D
Sbjct: 753 LSGGQKARLSLARAVYARADTYLLDDPLAAVD 784

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
            Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 24/188 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
            +PG++  L+G +G GK+T L +LA  Q+ N+G                G  L N  +   
Sbjct: 872  KPGKMTALMGESGAGKTTLLNVLA--QRINMG-------------VITGDMLVNSQSLPA 916

Query: 161  EDNIKAIIKPQYVDNIPR-AIKGPVQKVGELLKLR---LERSQDDAKYVIKALDLQHVLK 216
              N       Q  +++   +++  ++   EL + R   LE   +  + +I  L +Q+  +
Sbjct: 917  SFNRSCGYVAQADNHMAELSVRESLRFAAELRQPRSVPLEEKYEYVEKIIALLGMQNYAE 976

Query: 217  RDVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIRSLLNAT 271
              VG    G    + ++ +IG+  V +  + +F DEP+S LD +   +    +R+L ++ 
Sbjct: 977  ALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSG 1036

Query: 272  TYVISVEH 279
              ++   H
Sbjct: 1037 QSILCTIH 1044

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 92/215 (42%), Gaps = 27/215 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYD-DPPEWQDIIRYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G +  D  + +++++ ++G      EL 
Sbjct: 177 GEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMMKNYKGYVIYCPELD 236

Query: 154 NYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQH 213
            +F K+    +K  I      +     K P  ++  + + +   +  D    +    L+H
Sbjct: 237 FHFPKI---TVKETI------DFALKCKTPRVRIDRMTRKQYVDNIRDMWCTV--FGLRH 285

Query: 214 VLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL 268
                VG      +SGGE +R ++  +    A +Y +D  +  LD    L  A  IR+  
Sbjct: 286 TYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIRTAT 345

Query: 269 NA--TTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
           N    + ++++      +  L D   +LY    +Y
Sbjct: 346 NMMNNSAIVAIYQAGENIYELFDKTTVLYNGKQIY 380

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 296 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

>CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 801

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 112/267 (41%), Gaps = 46/267 (17%)

Query: 266 SLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGIN----IF-LEG 320
           ++L   +Y++ +++ L++ D  +  +   Y   S++G+ T  S + +G      +F L  
Sbjct: 391 TVLGFGSYLV-LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD 449

Query: 321 HIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMKRTQ--GDFVLNVESGSFSDS 378
            +PS +     + ++++  +     E E    SFAYP+        +    +E+GS    
Sbjct: 450 RVPSIST---TKGVKYKPGNG----EIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSN--- 499

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPD------DGQKVPKLNVSMKPQKIAPK------F 426
             + ++G +G GK+T+  LL     P       DGQ +  LN     + I          
Sbjct: 500 --VCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM 557

Query: 427 PGTVRQLF------------FKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQ 474
            GT+R                +++  Q     F T        +++I      LSGG+ Q
Sbjct: 558 SGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQS--SYDTVIGPHGTLLSGGQKQ 615

Query: 475 RVAIVLALGLPADIYLIDEPSAYLDSE 501
           R+AI  AL     I ++DE ++ LD E
Sbjct: 616 RIAIARALIKKPRILILDEATSALDVE 642

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTY-VISVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+           L+      ++S+ H 
Sbjct: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668

Query: 281 LSVL 284
           LS +
Sbjct: 669 LSTI 672

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
           complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 82/196 (41%), Gaps = 28/196 (14%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVP- 411
           +F Y   +R   +    + +G  +      ++G +G+GK+T++KL+     P+ G+ +  
Sbjct: 441 TFGYDPERRILNNVSFTIPAGMKT-----AIVGPSGSGKSTILKLVFRFYEPEQGRILVG 495

Query: 412 ------------KLNVSMKPQKIAPKFPGTVRQ-LFFKRIRG---QFLNPQFQTDVVK-- 453
                       +  + + PQ   P F  T+ + + F  I     + L    +  + K  
Sbjct: 496 GTDIRDLDLLSLRKAIGVVPQD-TPLFNDTIWENVKFGNISSSDDEILRAIEKAQLTKLL 554

Query: 454 ---PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 510
              P    +++ +    +SGGE QR+AI   L   A +   DE ++ LD+         I
Sbjct: 555 QNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTI 614

Query: 511 RRFILHNKKTAFLVEH 526
           ++    N KT+  V H
Sbjct: 615 QQNFSSNSKTSVYVAH 630

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 87/204 (42%), Gaps = 24/204 (11%)

Query: 60  ICVKKCPFDAIQIINLPTNLEGE-VTHRYSANSFKLHRLPTPRP-GQVLGLVGTNGIGKS 117
           + +K  P      I+ P ++  E VT  Y      L+ +    P G    +VG +G GKS
Sbjct: 416 VTIKNSPNAQNLPIHKPLDIRFENVTFGYDPERRILNNVSFTIPAGMKTAIVGPSGSGKS 475

Query: 118 TALKILAGKQKPNLGR-YDDPPEWQDI----IRYFRGSELQN--YFTKMLEDNIKAIIKP 170
           T LK++    +P  GR      + +D+    +R   G   Q+   F   + +N+K     
Sbjct: 476 TILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFGNIS 535

Query: 171 QYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRF 230
              D I RAI+       +L KL L+     A  V+    L          +SGGE QR 
Sbjct: 536 SSDDEILRAIEK-----AQLTKL-LQNLPKGASTVVGERGLM---------ISGGEKQRL 580

Query: 231 AIGMSCVQEADVYMFDEPSSYLDV 254
           AI    +++A +  FDE +S LD 
Sbjct: 581 AIARVLLKDAPLMFFDEATSALDT 604

>Sklu_1870.3 YFL028C, Contig c1870 3336-4133
          Length = 265

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 43/186 (23%)

Query: 345 LEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAG---- 400
           +E  D T SF + + K +  +  LN+   + +     +++G NG GK+TL+KLL+G    
Sbjct: 5   VEVNDLTYSFPHTT-KPSLANITLNIPWNTRT-----LVVGSNGAGKSTLLKLLSGKHLC 58

Query: 401 --------ALSP----------DDGQKVPKLNVSMKPQKIAPKFPGTVRQLF-----FKR 437
                    L P          +D Q    L        I  +  G +  L        R
Sbjct: 59  LNGRILVNGLDPFSPTSMQKDAEDCQITTYLGTEWCHMSIINRDIGILELLNSIGFEHYR 118

Query: 438 IRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAY 497
            RG+        +++  L I+  ++  +  LS G+ +RV + + L  P  + L+DE +  
Sbjct: 119 ERGE--------ELISILDID--LEWRMHRLSDGQKRRVQLTMGLLKPWKVLLLDEVTVD 168

Query: 498 LDSEQR 503
           LD   R
Sbjct: 169 LDVVAR 174

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 72/158 (45%), Gaps = 28/158 (17%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRY----DDPPEWQDIIRYFRGSELQNYFTKMLED- 162
           +VG+NG GKST LK+L+GK     GR      DP         F  + +Q    K  ED 
Sbjct: 37  VVGSNGAGKSTLLKLLSGKHLCLNGRILVNGLDP---------FSPTSMQ----KDAEDC 83

Query: 163 NIKAIIKPQY--VDNIPRAIKGPVQKVGELLK-LRLERSQDDAKYVIKALDLQHVLKRDV 219
            I   +  ++  +  I R I      + ELL  +  E  ++  + +I  LD+   L+  +
Sbjct: 84  QITTYLGTEWCHMSIINRDI-----GILELLNSIGFEHYRERGEELISILDID--LEWRM 136

Query: 220 GALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
             LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 137 HRLSDGQKRRVQLTMGLLKPWKVLLLDEVTVDLDVVAR 174

>YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the
           ATP-binding cassette (ABC) superfamily [921 bp, 306 aa]
          Length = 306

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 89/208 (42%), Gaps = 34/208 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
           + G  +G+VG  G GKS+   I+A      + R  D   W++        ++++   + L
Sbjct: 58  KAGTKVGIVGRTGAGKSS---IIAA-----IYRLSD---WENGTITIDNKDIKHIPLERL 106

Query: 161 EDNIKAIIK-PQYVDNIPRA------------IKGPVQKVG-----ELLKLRLERSQ--- 199
            ++I  I + P   D   R+            I G + KVG     + L L  E+ Q   
Sbjct: 107 RNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNF 166

Query: 200 DDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
              K   + +DL  V+K     LS G+ Q   +  S +   ++ + DE ++ +D      
Sbjct: 167 SSHKLRNRFIDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAK 226

Query: 260 AALVIRSLLNATTYVISVEHDL-SVLDY 286
               IR  +  TT ++++ H L SV+DY
Sbjct: 227 IQKTIRETMKNTT-ILTIAHRLRSVIDY 253

>YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporter
           of the ATP-binding cassette (ABC) superfamily, mediates
           transport of glutathione conjugates into the vacuole
           [4680 bp, 1559 aa]
          Length = 1559

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 83/178 (46%), Gaps = 20/178 (11%)

Query: 369 NVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQK---VPKLNVSMKPQKIAPK 425
           N++       +++ ++G  G GK+T +K + G L    G +    PKL +         +
Sbjct: 656 NIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQ 715

Query: 426 ----FPGTVRQ--LFFKRIRGQFLNPQFQTDVVKP-LKI-----ESIIDQEVQHLSGGEL 473
                  +VR+  LF  +    + +   +   + P LKI     E+++ ++   LSGG+ 
Sbjct: 716 ESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQK 775

Query: 474 QRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMA 531
            R+++  A+   ADIYL+D+  + +D+E     SK I  ++L   KTA L     I+ 
Sbjct: 776 ARLSLARAVYSRADIYLLDDILSAVDAE----VSKNIIEYVLIG-KTALLKNKTIILT 828

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV---KQRLNAALVIRSLLNATTYVISV 277
           +LSGG+  R ++  +    AD+Y+ D+  S +D    K  +   L+ ++ L     +I  
Sbjct: 769 SLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILT 828

Query: 278 EHDLSVLDY 286
            + +S+L +
Sbjct: 829 TNTVSILKH 837

>KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces
           cerevisiae YGR281w YOR1 ATP-binding cassette transporter
           protein, start by similarity
          Length = 1454

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 76/167 (45%), Gaps = 29/167 (17%)

Query: 377 DSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFP----GTVR- 431
           ++E +++ G  GTGK++L+  LAG +    G      ++++K   +   +P     TV+ 
Sbjct: 601 ENEFIIITGPIGTGKSSLLNALAGFMRRSSG------SMTIKGDLLLCGYPWVQNATVKD 654

Query: 432 QLFFKRIRGQFLNPQFQTDV----------VKPLKIESIIDQEVQHLSGGELQRVAIVLA 481
            + F      F  P++Q  +          + P    + I +    LSGG+  R+A+  +
Sbjct: 655 NILFG---SPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERGITLSGGQKARIALARS 711

Query: 482 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILH--NKKTAFLVEH 526
           +    DIYL D+  + +DS    +C  ++   ++    +KT  L  H
Sbjct: 712 VYKDMDIYLFDDVLSAVDSR---VCKHIVDECMMGYLKQKTRILATH 755

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 108/263 (41%), Gaps = 65/263 (24%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPE-------WQDIIRYFRGSELQ 153
           +  + + + G  G GKS+ L  LAG  + + G      +       W           +Q
Sbjct: 600 KENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKGDLLLCGYPW-----------VQ 648

Query: 154 NYFTKMLEDNI---KAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALD 210
           N     ++DNI       KP+Y            QKV E+  L+ +        ++ A D
Sbjct: 649 N---ATVKDNILFGSPFDKPKY------------QKVIEICSLQADLD------ILPAGD 687

Query: 211 LQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALV---IRSL 267
              + +R +  LSGG+  R A+  S  ++ D+Y+FD+  S +D   R+   +V   +   
Sbjct: 688 RTEIGERGI-TLSGGQKARIALARSVYKDMDIYLFDDVLSAVD--SRVCKHIVDECMMGY 744

Query: 268 LNATTYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENM 327
           L   T +++  H LS++D  S    I  G+   + + T+P  ++            S+ M
Sbjct: 745 LKQKTRILAT-HQLSLIDKASR--VIFLGLDGSFDIGTVPELLKRNTGF-------SDLM 794

Query: 328 RFRQEALQFRMVDAQEQLEAEDA 350
           +F+  A         E+LE +D 
Sbjct: 795 QFQNSA-------PAEELEDDDT 810

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L +    PA  YL DE  A LD + RI  ++ I+  
Sbjct: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL 1225

>Scas_552.4
          Length = 720

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 84/199 (42%), Gaps = 17/199 (8%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPPEWQDIIRYFRGSELQNYF 156
           T  P   +G+VG  G GKST +  L     P  G  + D+       I     ++L+   
Sbjct: 474 TVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNID-----ITSINLNKLRRSI 528

Query: 157 TKMLED------NIKAIIKP--QYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKA 208
             + +D       IK+ + P  +Y D         V  V E +   +E     ++ V K 
Sbjct: 529 NIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKF 588

Query: 209 LDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL 268
           L+L + +      LS G+ Q   +  S ++   + + DE ++ +D          IR   
Sbjct: 589 LNLNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEF 648

Query: 269 NATTYVISVEHDL-SVLDY 286
           N++T ++++ H L SV+DY
Sbjct: 649 NSST-ILTIAHRLRSVIDY 666

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 73/181 (40%), Gaps = 42/181 (23%)

Query: 383 MMGENGTGKTTLIKLLAGALSPDDGQ-KVPKLNVSM-------KPQKIAPK----FPGTV 430
           ++G  G GK+T+I  L   L P+ G  K+  ++++        +   I P+    F GT+
Sbjct: 483 IVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTI 542

Query: 431 R-----------QLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQ------------- 466
           +           +  F  +R   L P+   DV   ++ ESI  Q V              
Sbjct: 543 KSNLDPYGEYSDEDMFTALRRVNLVPE---DVSSNIETESISSQNVNKFLNLNNEISEGG 599

Query: 467 -HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVE 525
            +LS G+ Q V +  +L     I L+DE +A +D        + IR+    N  T   + 
Sbjct: 600 SNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIA 657

Query: 526 H 526
           H
Sbjct: 658 H 658

>ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH]
           complement(395427..397691) [2265 bp, 754 aa]
          Length = 754

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNAT-TYVISVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+        +  L+ +    ++S+ H 
Sbjct: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656

Query: 281 LSVLDYLSDFVCI 293
           LS +    + V +
Sbjct: 657 LSTIRRSENIVVL 669

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 82/203 (40%), Gaps = 39/203 (19%)

Query: 353 SFAYPSMKRTQ--GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPD----- 405
           SF+YP+   +Q      L +  GS      + ++G +G GK+T+  LL      +     
Sbjct: 463 SFSYPTRPTSQIFKKLRLTITPGSN-----VCIVGPSGRGKSTIASLLLRFYDANSGTIL 517

Query: 406 -DGQKVPKLNVSMKPQKIAPKFPGTVRQ---LFFKRIR-----GQFLNPQFQT--DVVK- 453
            DGQ + K  VS K  +   K  G V+Q   L    IR     G    P       V K 
Sbjct: 518 IDGQDISK--VSAKSLR---KHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572

Query: 454 ----------PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQR 503
                     P   +++I      LSGG+ QR+AI  AL     I ++DE ++ LD E  
Sbjct: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632

Query: 504 IICSKVIRRFILHNKKTAFLVEH 526
              +  + R +   + T   + H
Sbjct: 633 GAINYTLGRLMRSKEITIVSIAH 655

>KLLA0E19074g complement(1691643..1692623) highly similar to
           sp|P52920 Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 326

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRI 438
           +IL++ G+ G GK+T   +L+ ALS D+  +V  +++ +    + P   G VR+   +  
Sbjct: 72  KILILSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCVRETIHESN 130

Query: 439 RGQFLNPQFQTDVVKPLKIESII 461
            G    P + TD +  + I+ ++
Sbjct: 131 TG--WTPVYVTDNLATMSIQYML 151

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
            (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 36/199 (18%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L +LA + +                    G    N F    
Sbjct: 869  KPGTLTALMGYSGAGKTTLLDVLANRVRV-------------------GVVTGNIFVDGH 909

Query: 161  EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKL--------RLERSQDDAKY--VIKALD 210
              +     K  Y     + + G  Q V + LK          + R++ +A    +IK L 
Sbjct: 910  LRDTSFQRKTGYCQQ--QDLHGRTQTVRDALKFSAYLRQPQSISRAEKNAYVEDIIKLLG 967

Query: 211  LQHVLKRDVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIR 265
            ++      VG    G    + +R  IG+  V + ++ +F DEP+S LD +   +   +I+
Sbjct: 968  MEAYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIK 1027

Query: 266  SLLNATTYVISVEHDLSVL 284
             L+N    ++   H  S +
Sbjct: 1028 KLVNHGQAILCTIHQPSAI 1046

>Kwal_14.2052
          Length = 523

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 95/236 (40%), Gaps = 22/236 (9%)

Query: 197 RSQDDAKY--VIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV 254
           R  DD  Y  +++ L L+H+  R    LS G+++R  +  S +++ D  + ++P   LD 
Sbjct: 130 RHIDDQLYDCLLRTLKLKHLENRWAMGLSNGQMRRARLARSLLKDPDFTLIEDPFLGLDP 189

Query: 255 KQRLNAALVIRSLLNATT---YVISVEHDLSVLDYLSDFVCILYGVPSVYG----VVTLP 307
                A  +I   L   T    VI + +   + ++ +   C+     S  G    V  L 
Sbjct: 190 ----TATGIISEFLGNYTRCSIVIGLRYQDPIPEWCTHVCCVDADGISFQGEKSAVQKLI 245

Query: 308 SSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK----RTQ 363
             VR   N  ++  +P   +    + +    + A   L   D  +      ++    R +
Sbjct: 246 DQVRNDFNQQIDS-MPVSRISV-DDLISMHPLSA---LSVHDIVKMPDVIELRGLSVRYK 300

Query: 364 GDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKP 419
           G+ + +    S S      + G+NGTGK+TL  L+          +V +  V  KP
Sbjct: 301 GEPIFDNLCWSVSPKTTWHIRGDNGTGKSTLFSLITADHPQSWNSRVVENGVPRKP 356

>YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative
           nucleotide-binding protein, has similarity to bacterial
           partitioning ATPases [987 bp, 328 aa]
          Length = 328

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 365 DFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAP 424
           D  L  ++ S  + +ILV+ G+ G GK+T   +L+ ALS D+  +V  +++ +    + P
Sbjct: 60  DIPLITDNLSGIEHKILVLSGKGGVGKSTFAAMLSWALSADEDLQVGAMDLDICGPSL-P 118

Query: 425 KFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQE 464
              G +++   +   G    P + TD +  + I+ ++ ++
Sbjct: 119 HMLGCIKETVHESNSG--WTPVYVTDNLATMSIQYMLPED 156

>CAGL0H03091g complement(292976..293980) highly similar to sp|P52920
           Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 334

 Score = 35.4 bits (80), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 339 VDAQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLL 398
            DA +  E +D   S      K    D  L  E+ S    +ILV+ G+ G GK+T   +L
Sbjct: 44  ADACQTCENKDICESLP----KGPDPDIPLITENLSGIKHKILVLSGKGGVGKSTFTTML 99

Query: 399 AGALSPDDGQKVPKLNVSM 417
           + ALS DD  +V  +++ +
Sbjct: 100 SWALSADDNLQVGAMDLDI 118

>AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH]
           (1697345..1699378) [2034 bp, 677 aa]
          Length = 677

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 80/197 (40%), Gaps = 15/197 (7%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQ-----DIIRYFRGSELQNYF 156
           PG+ + +VG +G GKST   +L         R+ DP         + IR F  S+ +   
Sbjct: 455 PGEHVCIVGPSGGGKSTVASLLL--------RFYDPISGSITIGGEDIRLFNLSKYRRMM 506

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK 216
             + ++ +  +     ++NI  A+   + K    +   L  S   A        LQ  + 
Sbjct: 507 GIVQQEPV--LFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTAVG 564

Query: 217 RDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVIS 276
                LSGG+ QR A+  + +Q+  + + DE +S LD K     A  +          IS
Sbjct: 565 PRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKITIS 624

Query: 277 VEHDLSVLDYLSDFVCI 293
           + H  S + + +  + +
Sbjct: 625 IAHRKSTIQHSTRVIVL 641

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 454 PLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE-QRIICSKVIRR 512
           P  +++ +      LSGG+ QRVA+  A      I ++DE ++ LDS+ + I+ S +++R
Sbjct: 556 PEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQR 615

>Scas_711.39
          Length = 1227

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +I++ 
Sbjct: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQL 1172

>Kwal_14.2435
          Length = 1247

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRFILH 516
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  I+    H
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAH 1195

>Kwal_27.11147
          Length = 323

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 365 DFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAP 424
           D  L  E+ S  D ++LV+ G+ G GK+T   LL  ALS D+  +V  +++ +    + P
Sbjct: 55  DIPLITENLSQIDHKVLVLSGKGGVGKSTFTSLLCWALSSDEDLQVGAMDLDICGPSL-P 113

Query: 425 KFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQE 464
           +  G   +   +   G    P +  D +  + I+ ++ ++
Sbjct: 114 RMLGCANESVHESNTG--WTPVYVADNLATMSIQYMLPED 151

>Sklu_2062.2 YGL091C, Contig c2062 3197-4183
          Length = 328

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 58/115 (50%), Gaps = 3/115 (2%)

Query: 365 DFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAP 424
           D  L  E+ S    ++LV+ G+ G GK+T   +L+ ALS D+  +V  +++ +    + P
Sbjct: 60  DIPLITENLSQIKHKVLVLSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-P 118

Query: 425 KFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIV 479
           +  G V++   +   G    P +  D +  + I+ ++ ++   +    L++ A++
Sbjct: 119 RMLGCVKETVHESNTG--WTPVYVADNLATMSIQFMLPEDDSAIIWRGLKKNALI 171

>Scas_472.1*
          Length = 393

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 455 LKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRR 512
           L  E +    ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ 
Sbjct: 233 LDAELVSHSRIRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKA 290

Query: 513 F 513
           F
Sbjct: 291 F 291

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 353 SFAYPSMKRTQGDFVLNVESGSF--SDSEILVMMGENGTGKTTLIKLLAGALSPDDGQ 408
           +F YP   + Q      +   SF  S S  + ++G NG GK+TLI +L G L P  G+
Sbjct: 22  TFQYPGTTKPQ------ISDVSFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGE 73

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 195 LERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           L R + +    +  LD + V    +  LSGG+  +  +     Q   + + DEP++YLD
Sbjct: 219 LTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD 277

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
           required for weak organic acid resistance, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4536 bp, 1511 aa]
          Length = 1511

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 25/181 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYD-DPPEWQDIIRYFRGS-----ELQ 153
           G++L +VG  G G ST LK L+G+    +   G +  D  +  +++  ++G      EL 
Sbjct: 174 GEMLFVVGRPGAGCSTFLKCLSGETSELVDVQGEFSYDGLDQSEMMSKYKGYVIYCPELD 233

Query: 154 NYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQH 213
            +F K+    +K  I      +     K P  ++ ++ + +   +  D    +    L+H
Sbjct: 234 FHFPKI---TVKETI------DFALKCKTPRVRIDKMTRKQYVDNIRDMWCTV--FGLRH 282

Query: 214 VLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL 268
                VG      +SGGE +R ++  +    A +Y +D  +  LD    L  A  IR+  
Sbjct: 283 TYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIRTAT 342

Query: 269 N 269
           N
Sbjct: 343 N 343

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 84/188 (44%), Gaps = 24/188 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
            +PG++  L+G +G GK+T L +LA  Q+ N+G                G  L N      
Sbjct: 869  KPGKMTALMGESGAGKTTLLNVLA--QRINMG-------------VITGDMLVNAKPLPA 913

Query: 161  EDNIKAIIKPQYVDNIPR-AIKGPVQKVGELLK---LRLERSQDDAKYVIKALDLQHVLK 216
              N       Q  +++   +++  ++   EL +   + LE   +  + +I  L +Q+  +
Sbjct: 914  SFNRSCGYVAQADNHMAELSVRESLRFAAELRQQSSVPLEEKYEYVEKIITLLGMQNYAE 973

Query: 217  RDVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIRSLLNAT 271
              VG    G    + ++ +IG+  V +  + +F DEP+S LD +   +    +R+L ++ 
Sbjct: 974  ALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSG 1033

Query: 272  TYVISVEH 279
              ++   H
Sbjct: 1034 QSILCTIH 1041

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 293 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 339

>YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resistance
           factor, member of the ATP-binding cassette (ABC)
           superfamily [4434 bp, 1477 aa]
          Length = 1477

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 64/137 (46%), Gaps = 24/137 (17%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFP----GTVRQLF 434
           E +++ G  GTGK++L+  +AG++   DG+      V +    +   +P     +VR   
Sbjct: 615 EFIMITGPIGTGKSSLLNAMAGSMRKTDGK------VEVNGDLLMCGYPWIQNASVRD-- 666

Query: 435 FKRIRGQFLNPQFQTDVVKPLKIESIID-------QEVQH----LSGGELQRVAIVLALG 483
              I G   N +   +VV+   +++ +D        E+      LSGG+  R+ +  ++ 
Sbjct: 667 -NIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVY 725

Query: 484 LPADIYLIDEPSAYLDS 500
              DIYL D+  + +DS
Sbjct: 726 KKKDIYLFDDVLSAVDS 742

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 85/195 (43%), Gaps = 27/195 (13%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
           + G+ + + G  G GKS+ L  +AG  +   G+ +             G  L   +  + 
Sbjct: 612 KKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVE-----------VNGDLLMCGYPWIQ 660

Query: 161 EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVG 220
             +++        DNI        +K  E++++   ++  D   ++ A D+  + +R + 
Sbjct: 661 NASVR--------DNIIFGSPFNKEKYDEVVRVCSLKADLD---ILPAGDMTEIGERGI- 708

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD--VKQRLNAALVIRSLLNATTYVISVE 278
            LSGG+  R  +  S  ++ D+Y+FD+  S +D  V + +    +   L N T   I   
Sbjct: 709 TLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTR--ILAT 766

Query: 279 HDLSVLDYLSDFVCI 293
           H LS+++  S  + +
Sbjct: 767 HQLSLIERASRVIVL 781

>Scas_586.3
          Length = 1531

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 80/170 (47%), Gaps = 25/170 (14%)

Query: 367  VLNVESGSFSDSEILVMMGENGTGKTTLIKLLA-----GALSPD---DG----QKVPKLN 414
            +LN   G      +  +MG +G GKTTL+  LA     G ++ D   +G    +  P+  
Sbjct: 885  ILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNGCLRDESFPRSI 944

Query: 415  VSMKPQKIAPKFPGTVRQ--LFFKRIRGQFLNP-----QFQTDVVKPLKIESIIDQEV-- 465
               + Q +  K   TVR+   F   +R  F  P     ++  +++K L++E+  D  V  
Sbjct: 945  GYCQQQDLHLK-TSTVRESLRFSAYLRQPFDVPVEEKNKYVEEIIKTLEMETYADAVVGV 1003

Query: 466  --QHLSGGELQRVAIVLALGL-PADIYLIDEPSAYLDSEQRIICSKVIRR 512
              + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++
Sbjct: 1004 PGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKK 1053

>CAGL0G05093g complement(483230..484864) similar to sp|Q12298
           Saccharomyces cerevisiae YDR061w, hypothetical start
          Length = 544

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%)

Query: 451 VVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 510
           +V+ LK+E + ++    LS G+++R  +  +L    D+ L+D+P   LD     I SK +
Sbjct: 142 LVRELKLEELQNRWAMGLSNGQMRRARLARSLLKQPDLILVDDPFLGLDPTATAIISKFL 201

Query: 511 RRFILHNKKTAF 522
             +    K+ ++
Sbjct: 202 SNWGGAGKENSY 213

>Scas_643.1
          Length = 1289

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 83/176 (47%), Gaps = 23/176 (13%)

Query: 355 AYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLN 414
           ++ ++  T GD  L      F  S +  +MGE+G GKTTL+ +LA  +  + G    +L 
Sbjct: 746 SWKNINYTIGDKKLINNVSGFIGSGLTALMGESGAGKTTLLNVLAQRI--ESGVVTGELL 803

Query: 415 VSMKPQKIAPKFP---GTVRQ-------LFFK-------RIRGQFLNPQFQTDVVKPLKI 457
           +  KP      F    G V+Q       L  K       R+RG   + ++   +   LK+
Sbjct: 804 IDGKPLTNENAFRRSIGFVQQQDLHLDLLTVKESLEISCRLRGD-GDMKYLETISSLLKL 862

Query: 458 ESIIDQEVQHLSGGELQRVAIVLALGL-PADIYLIDEPSAYLDSEQRIICSKVIRR 512
              +++ V  LS  + + ++I + L   P+ +  +DEP++ LDSE  +   K +++
Sbjct: 863 P--MNKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLKK 916

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 205 VIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           +++   L HV+   VG      +SGGE +R +I  + +    VY++D  +  LD    L+
Sbjct: 161 LLREFGLSHVMDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALD 220

Query: 260 AALVIRSLLNAT 271
              +++ +  AT
Sbjct: 221 FLSILKKMTEAT 232

>YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane
           transporter of the ATP-binding cassette (ABC)
           superfamily, plays a role in sterol uptake and anaerobic
           growth [4236 bp, 1411 aa]
          Length = 1411

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%)

Query: 341 AQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA 399
            +E +  E      ++ ++  T GD  L  ++  +  S +  +MGE+G GKTTL+ +L+
Sbjct: 738 TKESVAMETQKHVISWKNINYTIGDKKLINDASGYISSGLTALMGESGAGKTTLLNVLS 796

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 205 VIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           ++K   L HV K  VG      +SGGE +R +I  + +    VY++D  +  LD    L 
Sbjct: 150 LLKEFGLSHVKKTYVGNDYVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALE 209

Query: 260 AALVIRSLLNAT 271
              + + +  AT
Sbjct: 210 FLSITQKMAKAT 221

>Scas_567.1
          Length = 810

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 76/181 (41%), Gaps = 25/181 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYD-DPPEWQDIIRYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G +  D  +  +++  ++G      EL 
Sbjct: 180 GEMLFVVGRPGAGCSTLLKTISGETSDMVEVQGDFSYDGLDQAEMMSKYKGYVVYCPELD 239

Query: 154 NYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQH 213
            +F K+    +K  I      +     K P  ++  + +     S  D    +    L+H
Sbjct: 240 FHFPKI---TVKETI------DFALKCKTPRTRIDNMSRAEYVDSLRDMWCTV--FGLRH 288

Query: 214 VLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL 268
                VG      +SGGE +R ++  +    A +Y +D  +  LD    L  A  IR+  
Sbjct: 289 TYATKVGNDFVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIRTAT 348

Query: 269 N 269
           N
Sbjct: 349 N 349

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 299 VRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIR 345

>KLLA0F21692g complement(2014152..2018729)
            gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces lactis
            multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 100/246 (40%), Gaps = 35/246 (14%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L  LA +    +   D          +  G    N F + +
Sbjct: 887  KPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGD---------MFVNGHLRDNSFPRSI 937

Query: 161  EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLK---LRLERSQDDAKYVIKALDLQHVLKR 217
                    + Q +      ++  ++    L +   + +E   +  + VI  L++Q     
Sbjct: 938  -----GYCQQQDLHLSTSTVRESLRFSAYLRQPSSVSIEEKNNYVEDVINILEMQQYADA 992

Query: 218  DVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIRSLLNATT 272
             VG    G    + +R  IG+    +  + +F DEP+S LD +   +   ++R L +   
Sbjct: 993  VVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

Query: 273  YVISVEHDLSVLDYLSDFVCILY---GVPSVYGVVTLPSSVREGINIFL--------EGH 321
             ++   H  S L  + +F  +L+   G  +VY    L    +E IN F         EG 
Sbjct: 1053 AILCTIHQPSAL-LMQEFDILLFLQKGGKTVY-FGNLGEGCQEMINYFEKHGASKCPEGA 1110

Query: 322  IPSENM 327
             P+E M
Sbjct: 1111 NPAEWM 1116

>Scas_627.18
          Length = 533

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%)

Query: 443 LNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQ 502
           +N +    ++K LK+  + D+    LS G+++R  +   L    D+ L+D+P   LD   
Sbjct: 132 VNMELYNKLIKSLKLVELQDRYAMGLSNGQMRRARLTHTLLKEPDLLLVDDPFLGLDPTA 191

Query: 503 RIICSKVIRRF 513
             I SK +  +
Sbjct: 192 TSIISKFLATY 202

>YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein with
            similarity to mammalian ATP-dependent bile acid
            transporter, member of the ATP-binding cassette (ABC)
            superfamily [4986 bp, 1661 aa]
          Length = 1661

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 16/195 (8%)

Query: 106  LGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPP-EWQDIIRYFRGSELQNYFTKMLED 162
            +G+VG  G GKST +  L    +P  G  + D+      D+ R  R   +      +   
Sbjct: 1411 IGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSG 1470

Query: 163  NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRL----------ERSQDDAKYVIKALDLQ 212
             IK  + P Y +   R I   +++V  + + +L          E S  +++ V K LDL 
Sbjct: 1471 TIKTNLDP-YDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDLS 1529

Query: 213  HVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNATT 272
              +      LS G+ Q   +  S ++   + + DE ++ +D          IR     +T
Sbjct: 1530 SEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGST 1589

Query: 273  YVISVEHDL-SVLDY 286
             ++++ H L SV+DY
Sbjct: 1590 -ILTIAHRLRSVIDY 1603

>Kwal_23.5161
          Length = 1489

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 81/171 (47%), Gaps = 28/171 (16%)

Query: 367  VLNVESGSFSDSEILVMMGENGTGKTTLIKLLA----GALSPD---DGQKV----PKLNV 415
            +L+  SG  +   +  +MGE+G GKTTL+  LA    G ++ D   +G+ +     +   
Sbjct: 863  LLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPIDASFERRTG 922

Query: 416  SMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQ---------FQTDVVKPLKIESIIDQEVQ 466
             ++ Q +  K   TVR+ F  +   +   PQ         +   +++ L +E   +  + 
Sbjct: 923  YVQQQDVHVK-EMTVRESF--QFAARMRRPQSIPESEKLAYVEKIIEILDMEDYAEALIG 979

Query: 467  HLSGG----ELQRVAIVLALGLPADIYL-IDEPSAYLDSEQRIICSKVIRR 512
             +  G    + ++V+I + L    D+ L +DEP++ LDS+      +++RR
Sbjct: 980  DVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMRR 1030

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 465 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR
Sbjct: 296 VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIR 342

>Scas_716.82
          Length = 675

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 80/186 (43%), Gaps = 23/186 (12%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLE 161
           PG +  ++G +G GK+T L  LA +   N+G         D++    G  +   F +   
Sbjct: 56  PGTMTAVMGESGAGKTTLLNTLAQR---NVGIITG-----DML--INGRPIDASFERR-- 103

Query: 162 DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYV---IKALDLQHVLKRD 218
                 ++ Q V      ++  +Q    + + +    ++   YV   I  LD+Q   +  
Sbjct: 104 ---TGYVQQQDVHIAELTVRESLQFSARMRRAQAIPDEEKMAYVEKIIHVLDMQEYAEAL 160

Query: 219 VGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIRSLLNATTY 273
           VG +  G    + ++ +IG+  V + D+ +F DEP+S LD +       ++R L  A   
Sbjct: 161 VGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLAQAGQS 220

Query: 274 VISVEH 279
           ++   H
Sbjct: 221 ILCTIH 226

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 10/66 (15%)

Query: 340 DAQEQLEAE------DATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTT 393
           DA E+LE++      D   +  Y + +R   D V    SG      +  +MGE+G GKTT
Sbjct: 17  DAFEKLESKGVXIWRDVCYTIPYDAGQRMLLDHV----SGYCIPGTMTAVMGESGAGKTT 72

Query: 394 LIKLLA 399
           L+  LA
Sbjct: 73  LLNTLA 78

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +++  
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL 1175

>KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces
           cerevisiae YOR153w PDR5 pleiotropic drug resistance
           protein, start by similarity
          Length = 1560

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 90/218 (41%), Gaps = 30/218 (13%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQ-----KP-NLGRYDDPPEWQDIIRYFRG-----S 150
           PG++  ++G  G G ST LK ++ +      +P ++  YD   +  DI +++RG     +
Sbjct: 218 PGRLCTVLGRPGAGCSTLLKTVSARTYGFTVRPESVISYDGISQ-HDIEKHYRGDVIYSA 276

Query: 151 ELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALD 210
           E+  +F  +   N+   ++       P A    V         R E  +  A  V+    
Sbjct: 277 EMDYHFANL---NVGYTLEFAARCRCPSARPQGVS--------REEYYKHYAAVVMATYG 325

Query: 211 LQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN--AALV 263
           L H     VG      +SGGE +R +I    +  A V  +D  +  LD    L    AL 
Sbjct: 326 LSHTYSTKVGDDYVRGVSGGERKRVSIAEVTLAGAKVQCWDNATRGLDSATALEFVRALK 385

Query: 264 IRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSVY 301
             + ++ TT ++++         L D V +LY    +Y
Sbjct: 386 TNATISRTTPLLAIYQCSQDAYDLFDDVLVLYEGRQIY 423

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 84/195 (43%), Gaps = 33/195 (16%)

Query: 352  RSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALS-------- 403
            ++  Y    +T+   +L+   G      +  +MG +G GKTTL+  LA  +S        
Sbjct: 897  KNICYDVQIKTETRRILDNVDGWVKPGTLTALMGSSGAGKTTLLDALADRISTGVITGDV 956

Query: 404  -----PDDGQ--------KVPKLNVSMKPQKIAPKFPGTVRQLF--FKRIRGQFLNPQFQ 448
                 P D          +   L+   +  + A  F   +RQ +   K+ + +++     
Sbjct: 957  LVNGRPTDASFQRSTGYCQQQDLHGRTQTVREALTFSAYLRQPYNVSKKEKDEYVET--- 1013

Query: 449  TDVVKPLKIESIIDQEV----QHLSGGELQRVAIVLAL-GLPADIYLIDEPSAYLDSEQR 503
              +++ L++E+  D  V    + L+  + +R+ I + L   P  +  +DEP++ LDS+  
Sbjct: 1014 --IIRLLEMETYADALVGVTGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTA 1071

Query: 504  IICSKVIRRFILHNK 518
                +++R+   H +
Sbjct: 1072 WSVCQLMRKLANHGQ 1086

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 80/198 (40%), Gaps = 34/198 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWQDIIRYFRGSEL 152
            +PG +  L+G++G GK+T L  LA +    +        GR  D   +Q    Y +  +L
Sbjct: 921  KPGTLTALMGSSGAGKTTLLDALADRISTGVITGDVLVNGRPTDA-SFQRSTGYCQQQDL 979

Query: 153  QNYFTKMLED-NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDL 211
                  + E     A ++  Y  N+ +  K                  +  + +I+ L++
Sbjct: 980  HGRTQTVREALTFSAYLRQPY--NVSKKEK-----------------DEYVETIIRLLEM 1020

Query: 212  QHVLKRDVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIRS 266
            +      VG    G    + +R  IG+  V +  + +F DEP+S LD +   +   ++R 
Sbjct: 1021 ETYADALVGVTGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSVCQLMRK 1080

Query: 267  LLNATTYVISVEHDLSVL 284
            L N    ++   H  S +
Sbjct: 1081 LANHGQAILCTIHQPSAI 1098

>YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidrug
           resistance protein of the ATP-binding cassette (ABC)
           family, has similarity to Snq2p, Pdr5p and Candida
           albicans Cdr1p [4002 bp, 1333 aa]
          Length = 1333

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 11/83 (13%)

Query: 429 TVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPADI 488
           T  + F+ +I G  L   F T V             +  +SGGE +RV+I  AL     I
Sbjct: 152 TANREFYAKIFG--LTHTFDTKVGNDF---------ISGVSGGERKRVSIAEALAAKGSI 200

Query: 489 YLIDEPSAYLDSEQRIICSKVIR 511
           Y  D  +  LDS   +  ++ IR
Sbjct: 201 YCWDNATRGLDSSTALEFARAIR 223

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 80/184 (43%), Gaps = 48/184 (26%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLA----GALSPD---DGQKVPKLNVSMKP 419
           +L+  SG      +  ++GE+G GKTTL+  LA    G ++ D   DG  +P ++ S K 
Sbjct: 747 LLDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTITGDMLVDG--LP-MDASFKR 803

Query: 420 QKIAPKFPGTVRQ--------------LFFKRIRGQFLNPQFQTDVVKPLKIESIID--- 462
           +       G V+Q               F  R+R     PQ   D  K   +E II    
Sbjct: 804 RT------GYVQQQDLHVAELTVKESLQFSARMR----RPQSIPDAEKMEYVEKIISILE 853

Query: 463 -QEVQHLSGGEL---------QRVAIVLAL-GLPADIYLIDEPSAYLDSEQRIICSKVIR 511
            QE      GE+         ++++I + L G P  +  +DEP++ LDS+      K+++
Sbjct: 854 MQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVVKMLK 913

Query: 512 RFIL 515
           R  L
Sbjct: 914 RLAL 917

>Scas_612.11*
          Length = 1506

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 84/196 (42%), Gaps = 29/196 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
           + G+ + +VG  G GK++ L   AG      GR               G  L   +  + 
Sbjct: 657 KKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQ-----------INGDLLLCGYPWIQ 705

Query: 161 EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVG 220
             ++K        DNI         K  E++++   +S  D   ++ A DL  + +R + 
Sbjct: 706 NASVK--------DNIIFGSPYNKAKYDEVIRVCSLKSDLD---ILPAGDLTEIGERGI- 753

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALV---IRSLLNATTYVISV 277
            LSGG+  R  +  S  ++ D+Y+FD+  S +D   R+   ++      LL   T +++ 
Sbjct: 754 TLSGGQKARINLARSVYKQKDIYLFDDVLSAVD--SRVGKHIMDECFLGLLKDKTRILAT 811

Query: 278 EHDLSVLDYLSDFVCI 293
            H LS+L+  S  + +
Sbjct: 812 -HQLSLLERASRVIVL 826

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 62/137 (45%), Gaps = 24/137 (17%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFP----GTVRQLF 434
           E ++M+G  GTGKT+L+   AG ++   G+      + +    +   +P     +V+   
Sbjct: 660 EFIIMVGPIGTGKTSLLNAFAGFMNKVSGR------IQINGDLLLCGYPWIQNASVKD-- 711

Query: 435 FKRIRGQFLNPQFQTDVVKPLKIESIID-------QEVQH----LSGGELQRVAIVLALG 483
              I G   N     +V++   ++S +D        E+      LSGG+  R+ +  ++ 
Sbjct: 712 -NIIFGSPYNKAKYDEVIRVCSLKSDLDILPAGDLTEIGERGITLSGGQKARINLARSVY 770

Query: 484 LPADIYLIDEPSAYLDS 500
              DIYL D+  + +DS
Sbjct: 771 KQKDIYLFDDVLSAVDS 787

>Scas_707.8
          Length = 294

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 96  RLPTPRPGQVLGLVGTNGIGKSTALKILAGKQ 127
           +L  P   + L +VG NG GKST LK+LAGK 
Sbjct: 27  KLQVPWHTRTL-VVGANGAGKSTLLKLLAGKH 57

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 74/193 (38%), Gaps = 50/193 (25%)

Query: 341 AQEQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAG 400
           A+  +E +D T  FA  S + +  D  L V   + +     +++G NG GK+TL+KLLAG
Sbjct: 2   AEYAVEVDDLTYKFA-ESTEPSVVDIKLQVPWHTRT-----LVVGANGAGKSTLLKLLAG 55

Query: 401 ------------ALSP-----------------DDGQKVPKLNVSMKPQKIAPKFPGTVR 431
                        L P                  D Q    L        I  +  G + 
Sbjct: 56  KHLCLNGKILVNGLDPFSPLSMYQDNDKTTAEDKDWQVTTYLGTEWCHMSIINRDIGVLE 115

Query: 432 -----QLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVLALGLPA 486
                 L   R RG  L        ++ L I   I+  +  LS G+ +RV + + L  P 
Sbjct: 116 LLESIGLAHYRDRGNKL--------IEILDIN--INWRMHRLSDGQKRRVQLAMGLLKPW 165

Query: 487 DIYLIDEPSAYLD 499
            + L+DE +  LD
Sbjct: 166 RVLLLDEVTVDLD 178

>YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump
            involved in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4536 bp, 1511 aa]
          Length = 1511

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 29/199 (14%)

Query: 346  EAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLA-----G 400
            EA    R+  Y    + +   +LN   G      +  +MG +G GKTTL+  LA     G
Sbjct: 866  EAIFHWRNLCYEVQIKAETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 925

Query: 401  ALSPD---DG----QKVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNP-------- 445
             ++ D   +G    +  P+     + Q +  K   TVR+    R       P        
Sbjct: 926  VITGDILVNGIPRDKSFPRSIGYCQQQDLHLK-TATVRESL--RFSAYLRQPAEVSIEEK 982

Query: 446  -QFQTDVVKPLKIESIIDQEV----QHLSGGELQRVAIVLAL-GLPADIYLIDEPSAYLD 499
             ++  +V+K L++E   D  V    + L+  + +R+ I + L   P  +  +DEP++ LD
Sbjct: 983  NRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLD 1042

Query: 500  SEQRIICSKVIRRFILHNK 518
            S+      +++++   H +
Sbjct: 1043 SQTAWSICQLMKKLANHGQ 1061

>Kwal_27.9666
          Length = 1474

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 76/177 (42%), Gaps = 27/177 (15%)

Query: 367  VLNVESGSFSDSEILVMMGENGTGKTTLIKLLA-----GALSPD---DGQKVPKL---NV 415
            +L+   G      +  +MG +G GKTTL+  LA     G ++ D   +G K       ++
Sbjct: 845  ILDHVDGWVKPGTLTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRDASFARSI 904

Query: 416  SMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQ---------FQTDVVKPLKIESIIDQEV- 465
                Q+       TVR+    R       PQ         +  +V+K L++E   D  V 
Sbjct: 905  GYCQQQDLHLQTATVRESL--RFAAHLRQPQSVPSSEKDKYVDEVIKILEMEKYADAVVG 962

Query: 466  ---QHLSGGELQRVAIVLALGL-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 963  VAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHGQ 1019

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 79/192 (41%), Gaps = 22/192 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA +    +          DI+    G++    F + +
Sbjct: 854  KPGTLTALMGASGAGKTTLLDCLASRVTTGVVT-------GDIL--INGNKRDASFARSI 904

Query: 161  EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYV---IKALDLQHVLKR 217
                    + Q +      ++  ++    L + +   S +  KYV   IK L+++     
Sbjct: 905  -----GYCQQQDLHLQTATVRESLRFAAHLRQPQSVPSSEKDKYVDEVIKILEMEKYADA 959

Query: 218  DVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALVIRSLLNATT 272
             VG    G    + +R  IG+       + +F DEP+S LD +   +   ++R L N   
Sbjct: 960  VVGVAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHGQ 1019

Query: 273  YVISVEHDLSVL 284
             ++   H  S L
Sbjct: 1020 AILCTIHQPSAL 1031

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  +++ 
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQL 1175

>YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of the
            ATP-binding cassette (ABC) superfamily [4779 bp, 1592 aa]
          Length = 1592

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 75/179 (41%), Gaps = 37/179 (20%)

Query: 383  MMGENGTGKTTLIKLLAGALSPD------DGQKVPKLNVSM--KPQKIAPK----FPGTV 430
            ++G  G GK+T+I  L   L P       DGQ + K+++    +   I P+    F GT+
Sbjct: 1355 IVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTI 1414

Query: 431  R-----------QLFFKRIRG----------QFLNPQ--FQTDVVKPLKIESIIDQEVQH 467
            +           +  FK +            + LN +  F +   K L + + I +   +
Sbjct: 1415 KSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLN 1474

Query: 468  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEH 526
            LS GE Q + I  +L     I L+DE ++ +D +   +   +IR     NK T   + H
Sbjct: 1475 LSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRS--EFNKSTILTIAH 1531

>YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein that
           associates with Ccr4p, member of the non-transporter
           group of the ATP-binding cassette (ABC) superfamily [870
           bp, 289 aa]
          Length = 289

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 38/167 (22%)

Query: 108 LVGTNGIGKSTALKILAGKQ---------------KP-NLGRYDDPPEWQDIIRYFRGSE 151
           +VG NG GKST LK+L+GK                 P ++ + DD    +D   Y   + 
Sbjct: 39  VVGANGAGKSTLLKLLSGKHLCLDGKILVNGLDPFSPLSMNQVDDDESVEDSTNYQTTTY 98

Query: 152 LQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLK-LRLERSQDDAKYVIKALD 210
           L   +  M      +II         R I      V ELLK +  +  ++  + +++ LD
Sbjct: 99  LGTEWCHM------SIIN--------RDI-----GVLELLKSIGFDHFRERGERLVRILD 139

Query: 211 LQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           +   ++  +  LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 140 ID--VRWRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIAR 184

>Scas_167.1*
          Length = 279

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 75/165 (45%), Gaps = 33/165 (20%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLE 161
           PG +  L+G +G GK+T L  LA +   N+G         D++    G  +   F +   
Sbjct: 125 PGTLTALMGESGAGKTTLLNTLAQR---NVGIITG-----DML--INGHPIDASFERR-- 172

Query: 162 DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQ---DDAKY-----VIKALDLQH 213
                 ++ Q +      ++  +Q        R+ R+Q   D+ K      +I+ LD+++
Sbjct: 173 ---TGYVQQQDIHIAELTVRESLQ-----FSARMRRAQAIPDEEKMAYVEKIIQVLDMEY 224

Query: 214 VLKRDVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLD 253
             +  VG +  G    + ++ +IG+  V + D+ +F DEP+S LD
Sbjct: 225 YAEALVGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLD 269

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   ++ I + 
Sbjct: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164

>Kwal_56.23638
          Length = 4922

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 31/43 (72%), Gaps = 4/43 (9%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420
           SE ++++GE GTGKTT+++ +A A++    Q++  +NVS + +
Sbjct: 649 SEPVLLVGETGTGKTTVVQQVAKAVN----QRLTVINVSQQTE 687

>Scas_720.7
          Length = 332

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRI 438
           +ILV+ G+ G GK+T   +L+ ALS D+  +V  +++ +    + P   G   ++  +  
Sbjct: 78  KILVLSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCTAEVVHESN 136

Query: 439 RGQFLNPQFQTDVVKPLKIESIIDQE 464
            G    P +  D +  + I+ ++ ++
Sbjct: 137 SG--WTPVYVADNLAAMSIQFMLPED 160

>CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter,
            hypothetical start
          Length = 1648

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 85/197 (43%), Gaps = 11/197 (5%)

Query: 99   TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPPEWQ-DIIRYFRGSELQNY 155
            T  P + +G+VG  G GKST +  L    + + G  + D       D+ R  R   +   
Sbjct: 1395 TIEPLEKVGIVGRTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQ 1454

Query: 156  FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERS-----QDDAKYVIKALD 210
               +   +I++ + P Y +     I   +++V  +    +E S      + +K V K L+
Sbjct: 1455 DPTLFAGSIRSNLDP-YDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLN 1513

Query: 211  LQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNA 270
            L+  +       S G+ Q   +  S ++   V + DE ++ +D          IR   N 
Sbjct: 1514 LESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNN 1573

Query: 271  TTYVISVEHDL-SVLDY 286
            +T V+++ H L S++DY
Sbjct: 1574 ST-VLTIAHRLRSIVDY 1589

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 97/225 (43%), Gaps = 29/225 (12%)

Query: 331 QEALQFRMVDAQEQLEAEDATRSFAYPSMK-RTQGD---FVLNVESGSFSDSEILVMMGE 386
           Q  L+    D  +QL  +   +  A+ ++  R   D   FVL      F   ++ V++G 
Sbjct: 683 QRFLETEETDKYDQLTVDKNGKRLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGA 742

Query: 387 NGTGKTTLIKLLAGALSPDDGQ-KVPKLNVSMKPQKIAPKFPGTV------RQLFFKRIR 439
            G+GKT+++  L G +   +G+  VP L+   + Q  A     ++        L    +R
Sbjct: 743 TGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVR 802

Query: 440 GQFL-NPQF---QTDVV-------KPLKI-----ESIIDQEVQHLSGGELQRVAIVLALG 483
              L N  F   + D V       +  +I      + I ++   LSGG+ QRV++  AL 
Sbjct: 803 NNILFNAPFDQARYDAVVEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALY 862

Query: 484 LPADIYLIDEPSAYLDSEQRI-ICSKVIRRFILHNKKTAFLVEHD 527
             A   L+D+  + +DS   + I  K I   ++   +T  LV H+
Sbjct: 863 SSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEG-RTCILVTHN 906

>CAGL0G00242g complement(20428..24861) highly similar to sp|P53049
           Saccharomyces cerevisiae YGR281w YOR1 ATP-binding
           cassette transporter protein, hypothetical start
          Length = 1477

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 90/212 (42%), Gaps = 34/212 (16%)

Query: 77  TNLEGEVTH-RYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYD 135
           +N EG  T  ++S  +F++ +      G+ + + G  G GKS+ L  +AG      G  D
Sbjct: 606 SNGEGTKTFTKFSNLNFEIKK------GEFIMITGPIGTGKSSLLNAMAGFMPQTTGELD 659

Query: 136 DPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRL 195
                        G         ML      I      DNI        +K  E++++  
Sbjct: 660 -----------ING--------HMLLCGYPWIQNATVRDNIIFGSPYDREKYKEVIRVCS 700

Query: 196 ERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD-- 253
            ++  D   ++ A D+  + +R +  LSGG+  R  +  S  +  D+Y+FD+  S +D  
Sbjct: 701 LQADID---ILPAGDMTEIGERGI-TLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSR 756

Query: 254 VKQRLNAALVIRSLLNATTYVISVEHDLSVLD 285
           V + +     +++L + T   I   H LS+++
Sbjct: 757 VGKHIMDECFLQTLQSKTR--ILATHQLSLIE 786

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 85/207 (41%), Gaps = 41/207 (19%)

Query: 74   NLPTNLEGEVTHRYSANSFKLHRLPTPRP--------GQVLGLVGTNGIGKSTALKILA- 124
            N PTN  GEV     + +++   LPT           G+ +G+ G  G GKST +  L  
Sbjct: 1207 NWPTN--GEVIFEDVSFAYR-PGLPTVLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYR 1263

Query: 125  ------------GKQKPNLGRYDDPPEWQDIIR---YFRGSELQNY--FTKMLEDNIKAI 167
                        G     LG YD   +   I +    FRG+  +N   F +  +D++   
Sbjct: 1264 LNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNS 1323

Query: 168  IKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKY-VIKALDLQHVLKRDVGALSGGE 226
            +           I+G   +  +L  ++ ++   +  Y  +    L  +++ D    S GE
Sbjct: 1324 L-----------IRGGAIEKDDLEDIKHQKPDKNGSYNNMHKFHLDQIVEEDGANFSLGE 1372

Query: 227  LQRFAIGMSCVQEADVYMFDEPSSYLD 253
             Q  A+  + V+++ + + DE +S +D
Sbjct: 1373 RQVLALTRALVRQSKILILDEATSSVD 1399

>Kwal_14.1242
          Length = 269

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           ++G+NG GKST LK+L+GK 
Sbjct: 37  IIGSNGAGKSTLLKLLSGKH 56

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 382 VMMGENGTGKTTLIKLLAG 400
           +++G NG GK+TL+KLL+G
Sbjct: 36  LIIGSNGAGKSTLLKLLSG 54

>Kwal_26.9532
          Length = 1471

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 23/153 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLED 162
           G+++ + G+ G GKS+ L  ++G  K   G         DI  Y  GS L   +  +   
Sbjct: 604 GELVIVTGSVGTGKSSLLAAMSGFMKKKSG---------DI--YKNGSLLLCGYPWIQNT 652

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGAL 222
            +K        DNI      P  +      +R+   Q D   ++ A D   + +R +  L
Sbjct: 653 TVK--------DNI--LFGSPFDEARYKETIRVCSLQADLD-LLPAGDKTEIGERGI-TL 700

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           SGG+  R  +  S  ++ D+Y+FD+  S +D +
Sbjct: 701 SGGQKARINLARSVYKKKDIYLFDDVLSAVDAR 733

>Scas_717.6*
          Length = 1400

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 205 VIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           ++    L HV+   VG      +SGGE +R +I  + +    VY++D  +  LD    L 
Sbjct: 156 LLNGFGLSHVVDTFVGNDYVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALE 215

Query: 260 AALVIRSLLNAT 271
              +++++   T
Sbjct: 216 FLSILQTMARTT 227

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 81/174 (46%), Gaps = 23/174 (13%)

Query: 363 QGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKI 422
           +GD  L  +   F  S +  +MGE+G GKTTL+ +L+  ++   G+   +L +  +P   
Sbjct: 757 EGDKQLINDCSGFISSGLTALMGESGAGKTTLLNVLSQRVT--SGEVTGELLIDGQPLTN 814

Query: 423 APKFP---GTVRQ-------LFFKR-------IRGQFLNPQFQTDVVKPLKIESIIDQEV 465
              F    G V+Q       L  K        +RG   +  +   V K LK+ +  +  V
Sbjct: 815 IAAFRRSIGFVQQQDVHLDLLTVKESLEISCILRGD-GDRDYLGTVAKLLKLPA--NTLV 871

Query: 466 QHLSGGELQRVAIVLALGL-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
             L+  E + ++I + L   P+ +  +DEP++ LD+E  +   + +++  L  +
Sbjct: 872 ADLTPTEKKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 925

>AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH]
           (710017..710829) [813 bp, 270 aa]
          Length = 270

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           L G+NG GKST LK+L+GK 
Sbjct: 39  LCGSNGAGKSTLLKLLSGKH 58

>Kwal_26.6702
          Length = 617

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 205 VIKALDLQHVLKRDVGALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLN 259
           VIK L++Q      VG    G    + +R  IG+    +  + +F DEP+S LD +   +
Sbjct: 86  VIKILEMQKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWS 145

Query: 260 AALVIRSLLNATTYVISVEHDLSVL 284
              ++R L N    ++   H  S L
Sbjct: 146 ICQLMRRLANHGQAILCTIHQPSAL 170

>CAGL0F01419g complement(142623..146819) highly similar to tr|Q08409
           Saccharomyces cerevisiae YOR011w AUS1, start by
           similarity
          Length = 1398

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 80/167 (47%), Gaps = 18/167 (10%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKF 426
           ++N  SG +  S +  +MGE+G GKTTL+ +L+     + G    ++ +  KP      F
Sbjct: 770 LINNVSG-YIGSGLTALMGESGAGKTTLLNVLSQ--RTESGVVSGEILIDGKPLTNENAF 826

Query: 427 PGTVRQLFFKRIRGQFLNPQFQTDVVKPLK-------IESI-------IDQEVQHLSGGE 472
             ++  +  + I  + L  +   ++   L+       +ESI       +D  V+ L+  +
Sbjct: 827 RRSIGFVQQQDIHLELLTVKESLEISSELRGDGDMEYVESISELLKLPLDSLVRELNPTQ 886

Query: 473 LQRVAIVLALGL-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            + ++I + L   P+ +  +DEP++ LD+E  +   + +++  L  +
Sbjct: 887 RKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 933

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 205 VIKALDLQHVLKRDVG-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           +++   L HV    VG      +SGGE +R +I  + +    VY++D  +  LD    L+
Sbjct: 159 LLREFGLSHVGDTIVGNDYFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALD 218

Query: 260 AALVIRSLLNAT 271
              +++ +   T
Sbjct: 219 FLTILQKMARTT 230

>YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear
           protein that may act as a chaperone [14733 bp, 4910 aa]
          Length = 4910

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 30/43 (69%), Gaps = 4/43 (9%)

Query: 378 SEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420
           +E ++++GE GTGKTT+++ LA  L+    +K+  +NVS + +
Sbjct: 646 TEPVLLVGETGTGKTTVVQQLAKMLA----KKLTVINVSQQTE 684

>Scas_455.1
          Length = 925

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 88/211 (41%), Gaps = 34/211 (16%)

Query: 343 EQLEAEDATRSFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGAL 402
           +QLE ++ T S+       +  DF L   +  F   ++ V++G  G+GKT+L+  L G +
Sbjct: 710 DQLEFKNTTVSW-----DSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEM 764

Query: 403 SPDDGQ-KVPKLNVSMKPQKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVV-----KPLK 456
              +G+  VP L+     + +     GT   + +       LN   + +++        +
Sbjct: 765 KIMEGEIIVPSLD---PREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEAR 821

Query: 457 IESII-------DQEVQH-------------LSGGELQRVAIVLALGLPADIYLIDEPSA 496
             S+I       D E+               LSGG+ QRV++  A+   +   L+D+  +
Sbjct: 822 YTSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLS 881

Query: 497 YLDSEQRIICSKVIRRFILHNKKTAFLVEHD 527
            +DS   +          L + +T  LV H+
Sbjct: 882 AVDSHTALWIYDNCITGPLMDGRTCILVSHN 912

>Scas_622.9
          Length = 1657

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 86/197 (43%), Gaps = 19/197 (9%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPPEWQDIIRYFRGSELQNYFTKM 159
            P   +G+VG  G GKST +  +     P  G  + DD       I     ++L+   T +
Sbjct: 1412 PKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVN-----IASINLTKLRRSITII 1466

Query: 160  LED------NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERS---QDDAKYVIKALD 210
             +D       IK  + P Y +    AI   +++V  + +  L+ +      ++   K L+
Sbjct: 1467 PQDPTLFTGTIKLNLDP-YNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLN 1525

Query: 211  LQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLLNA 270
            L++ +      LS G+ Q   +  S ++   + + DE ++ +D          IR   + 
Sbjct: 1526 LENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQ 1585

Query: 271  TTYVISVEHDL-SVLDY 286
            +T ++++ H L SV+DY
Sbjct: 1586 ST-ILTIAHRLRSVIDY 1601

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 94/229 (41%), Gaps = 37/229 (16%)

Query: 331 QEALQFRMVDAQEQLEAEDATRSFAYPSMKRT----QGDFVLNVESGSFSDSEILVMMGE 386
           Q+ L  +  D   QL  +      A+ ++  T    + DF L   +  F    + V++G 
Sbjct: 688 QDFLGEQDTDKYNQLTIDKLGNRIAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGP 747

Query: 387 NGTGKTTLIKLLAGALSPDDGQ-KVPKLNVSMKPQK--IAPKFPGTVRQLFFKRIRGQFL 443
            G+GKT+L+  L G +  + G+  VP LN    P++  +  KF G    + +       L
Sbjct: 748 TGSGKTSLLLALLGEMCLEKGEIIVPALN----PRQDLVIDKF-GLTNSIAYCSQAAWLL 802

Query: 444 NPQFQTDV-----------------------VKPLKIESI--IDQEVQHLSGGELQRVAI 478
           N   + ++                       +K LK   +  I ++   LSGG+ QRV++
Sbjct: 803 NETVRNNILFNSPYNEERYNAVIDACGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSL 862

Query: 479 VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHD 527
             AL   +   L+D+  + +DS   +          L + +T  LV H+
Sbjct: 863 ARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLMSGRTCILVSHN 911

>CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter, start by
            similarity
          Length = 1659

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 205  VIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVI 264
            V K L+L++ +      LS G+ Q   +  + ++   V + DE ++ +D          I
Sbjct: 1522 VNKFLNLENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTI 1581

Query: 265  RSLLNATTYVISVEHDL-SVLDY 286
            R++ + +T V+++ H L SV+DY
Sbjct: 1582 RNVFDKST-VLTIAHRLRSVIDY 1603

>AFL060W [3133] [Homologous to ScYGL091C (NBP35) - SH]
           complement(319832..321421) [1590 bp, 529 aa]
          Length = 529

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 379 EILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQKIAPKFPGTVRQLFFKRI 438
           ++LV+ G+ G GK+T   +L  ALS D+  +V  +++ +    + P   G V +   +  
Sbjct: 275 KVLVLSGKGGVGKSTFSAMLGWALSADEALQVGVMDLDICGPSL-PHMLGCVNETVHESS 333

Query: 439 RGQFLNPQFQTDVVKPLKIESIIDQE 464
            G    P +  D +  + I+ ++ ++
Sbjct: 334 VG--WTPVYVADNLAAMSIQFMLPED 357

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member, start by similarity
          Length = 294

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 38  VVGANGAGKSTLLKLLSGKH 57

>Sklu_2140.2 YER173W, Contig c2140 1850-3868
          Length = 672

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (65%)

Query: 376 SDSEILVMMGENGTGKTTLIKLLAGALSP 404
           SD  IL++ G  G  K+TLIKLLA  L P
Sbjct: 112 SDCRILLLTGPAGCSKSTLIKLLAEELIP 140

>Sklu_2035.3 YBR186W, Contig c2035 2344-3764 reverse complement
          Length = 474

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 343 EQLEAEDATR----SFAYPSMKRTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLL 398
           E L  ED  +    S+A  S+K +Q     ++ S   +++++L++ G  GTGKTT+ K L
Sbjct: 212 ESLYFEDNVKQKLFSYATISLKMSQMS-TKSISSTLIANNKLLLVHGPPGTGKTTVCKAL 270

Query: 399 AGALSPDDGQKVPKLNVSMKPQKI 422
              L+    + +  L  +  P  I
Sbjct: 271 CQKLAIRQNESIDSLKTNCHPTII 294

>YHR107C (CDC12) [2395] chr8 complement(326815..328038) Septin,
           component of 10 nm filaments of mother-bud neck;
           involved in cytokinesis [1224 bp, 407 aa]
          Length = 407

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 367 VLNVESGSFSDSEILVMMGENGTGKTTLIK-LLAGALSPDDGQK 409
           ++N E G+F+    +++ GE+G GKTT I  L    L   DGQ+
Sbjct: 27  IVNEEGGTFT----VMLCGESGLGKTTFINTLFQTVLKRADGQQ 66

>KLLA0F14575g complement(1351796..1354351) some similarities with
           sp|P47068 Saccharomyces cerevisiae YJL020c singleton,
           hypothetical start
          Length = 851

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 410 VPKLNVSMKP--QKIAPKF-PGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQE 464
            P++  S +P  +    KF PGT+ +L F +    +L    Q D VKP K++ I + +
Sbjct: 592 APQIPASFQPLRRTTTAKFEPGTIPELEFSKQSTWWLTKTVQADTVKPSKVKYIWESQ 649

>KLLA0B02563g complement(222951..225377) similar to sp|P34230
           Saccharomyces cerevisiae YKL188c PXA2 ABC transporter,
           peroxisomal, start by similarity
          Length = 808

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 15/84 (17%)

Query: 57  GCGICVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRP-GQVL--------- 106
           G  + + K   +   IIN P   +  V   Y  N  +   +P   P GQVL         
Sbjct: 469 GVSLRLNKFNDELDNIINAPKERDDTVPVEYDDNVIEFQNVPLITPTGQVLISELTFKLE 528

Query: 107 -----GLVGTNGIGKSTALKILAG 125
                 ++G NG GKS+  ++L G
Sbjct: 529 RFNHLLIIGPNGCGKSSLFRVLGG 552

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
            Saccharomyces cerevisiae YLL048c YBT1 yeast bile
            transporter, start by similarity
          Length = 1650

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 207  KALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRS 266
            K LDL++ +      LS G+ Q   +  S ++   V + DE ++ +D          IR 
Sbjct: 1515 KFLDLENEVSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIRE 1574

Query: 267  LLNATTYVISVEHDL-SVLDY 286
              + +T ++++ H L S++DY
Sbjct: 1575 EFSNST-ILTIAHRLRSIIDY 1594

>Scas_664.8*
          Length = 562

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 343 EQLEAEDATRS--FAYPSMKRTQGDFVL----NVESGS-FSDSEILVMMGENGTGKTTLI 395
           E L+ ED T+   F+Y +M             N++  S  S +++L++ G  GTGKT++ 
Sbjct: 259 ESLQFEDGTKKKIFSYATMSLKMSSLSRKLQKNIKDNSILSSNKLLLVYGPPGTGKTSIC 318

Query: 396 KLLAGALS 403
           + L   LS
Sbjct: 319 RALCQKLS 326

>Kwal_14.1591
          Length = 640

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 10/66 (15%)

Query: 67  FDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQV----LGLVGTNGIGKSTALKI 122
            D IQI+ +   LE     +  AN      L  P PGQ     +GLVG   +GKS+ +  
Sbjct: 304 LDKIQILKI-DQLEELFLSKAPANP-----LQAPLPGQSPIIQIGLVGYPNVGKSSTINA 357

Query: 123 LAGKQK 128
           L G +K
Sbjct: 358 LVGSKK 363

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,290,137
Number of extensions: 769437
Number of successful extensions: 3328
Number of sequences better than 10.0: 176
Number of HSP's gapped: 3222
Number of HSP's successfully gapped: 437
Length of query: 531
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 425
Effective length of database: 12,926,601
Effective search space: 5493805425
Effective search space used: 5493805425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)