Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2341772371235400.0
YER162C (RAD4)75471415680.0
CAGL0L11726g82571815410.0
AGR162C76372214560.0
Scas_576.377972214340.0
KLLA0F14465g76755412901e-168
YDR314C6922751812e-13
CAGL0H07293g6686581676e-12
Sklu_2426.26644041382e-08
ABR193W350118870.018
CAGL0H05753g348121820.072
Kwal_27.12204368116820.088
YPL096W (PNG1)363118760.47
Sklu_2107.4693218740.96
Kwal_27.1226269364703.1
Scas_700.2351121684.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23417
         (712 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23417                                                        1368   0.0  
YER162C (RAD4) [1590] chr5 complement(500625..502889) Component ...   608   0.0  
CAGL0L11726g complement(1249886..1252363) similar to sp|P14736 S...   598   0.0  
AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH] (1049961..1...   565   0.0  
Scas_576.3                                                            556   0.0  
KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736 Saccha...   501   e-168
YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Membe...    74   2e-13
CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces c...    69   6e-12
Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement          58   2e-08
ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH] complement(7...    38   0.018
CAGL0H05753g complement(569862..570908) similar to tr|Q02890 Sac...    36   0.072
Kwal_27.12204                                                          36   0.088
YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase...    34   0.47 
Sklu_2107.4 YPL106C, Contig c2107 4499-6580 reverse complement         33   0.96 
Kwal_27.12262                                                          32   3.1  
Scas_700.2                                                             31   4.0  

>Kwal_56.23417
          Length = 723

 Score = 1368 bits (3540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/712 (94%), Positives = 670/712 (94%)

Query: 1   MGPLPQEYFDLVRQAVKEDKQTPRRKRRRLPKYESNDISRPADVIINLDSDTDNETKFTS 60
           MGPLPQEYFDLVRQAVKEDKQTPRRKRRRLPKYESNDISRPADVIINLDSDTDNETKFTS
Sbjct: 1   MGPLPQEYFDLVRQAVKEDKQTPRRKRRRLPKYESNDISRPADVIINLDSDTDNETKFTS 60

Query: 61  EGLSKSFESQSNRDLDDDNEKXXXXXXXXXXXXXXXXXXXXXXXXXXXADVSEQTSNAEL 120
           EGLSKSFESQSNRDLDDDNEK                           ADVSEQTSNAEL
Sbjct: 61  EGLSKSFESQSNRDLDDDNEKGSNNGGDYDDDDDDDEFNSDDFEDVSDADVSEQTSNAEL 120

Query: 121 SITLNPQKPQKKTGSKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLNDAKLHQKLSK 180
           SITLNPQKPQKKTGSKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLNDAKLHQKLSK
Sbjct: 121 SITLNPQKPQKKTGSKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLNDAKLHQKLSK 180

Query: 181 LVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWETPGLYMLDWDEL 240
           LVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWETPGLYMLDWDEL
Sbjct: 181 LVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWETPGLYMLDWDEL 240

Query: 241 DGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVNARLIMNAQPPDFTNNK 300
           DGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVNARLIMNAQPPDFTNNK
Sbjct: 241 DGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVNARLIMNAQPPDFTNNK 300

Query: 301 VSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEVWDKVSKKWITVDPM 360
           VSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEVWDKVSKKWITVDPM
Sbjct: 301 VSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEVWDKVSKKWITVDPM 360

Query: 361 GQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVTRRYTTHFNSKTRKRRITR 420
           GQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVTRRYTTHFNSKTRKRRITR
Sbjct: 361 GQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVTRRYTTHFNSKTRKRRITR 420

Query: 421 DAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQDLKNHPYYVLQNDFK 480
           DAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQDLKNHPYYVLQNDFK
Sbjct: 421 DAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQDLKNHPYYVLQNDFK 480

Query: 481 WNEVLKSGCKECGFLRTKNNTSLKVYRREDVLVLKTARTWYTEGRVLKPGASALKTTKSR 540
           WNEVLKSGCKECGFLRTKNNTSLKVYRREDVLVLKTARTWYTEGRVLKPGASALKTTKSR
Sbjct: 481 WNEVLKSGCKECGFLRTKNNTSLKVYRREDVLVLKTARTWYTEGRVLKPGASALKTTKSR 540

Query: 541 DFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGNIDIYTSSMIPRGSCLIESPVA 600
           DFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGNIDIYTSSMIPRGSCLIESPVA
Sbjct: 541 DFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGNIDIYTSSMIPRGSCLIESPVA 600

Query: 601 VKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYREAVESMIDGVXXXXXXXXXX 660
           VKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYREAVESMIDGV          
Sbjct: 601 VKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYREAVESMIDGVEYSLEEDERQ 660

Query: 661 XXXXXALQHWNLFLAKLRIKQRLNTTHGKVSSATVSTWDDNEPDQSDTSDGV 712
                ALQHWNLFLAKLRIKQRLNTTHGKVSSATVSTWDDNEPDQSDTSDGV
Sbjct: 661 ERELEALQHWNLFLAKLRIKQRLNTTHGKVSSATVSTWDDNEPDQSDTSDGV 712

>YER162C (RAD4) [1590] chr5 complement(500625..502889) Component of
           the nucleotide excision repairosome, homolog of human
           XPC xeroderma pigmentosum gene product [2265 bp, 754 aa]
          Length = 754

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/714 (45%), Positives = 442/714 (61%), Gaps = 74/714 (10%)

Query: 4   LPQEYFDLVRQAV--KEDKQTP-------RRKRRRLP----KYES--NDISRPADVIINL 48
           LP+EYF+L+R+A+  KE ++ P       RRK + LP    K+++  N++ R + V +NL
Sbjct: 5   LPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVVTVNL 64

Query: 49  DSDTDNETKFTSEGLSKSFESQSNRDLDDDNEKXXXXXXXXXXXXXXXXXXXXXXXXXXX 108
           DS  D      ++    S E   + + D D+E+                           
Sbjct: 65  DSSDDGVVTVPTDD---SVEEIQSSEEDYDSEEFEDV----------------------- 98

Query: 109 ADVSEQTSNAELSITLNPQKPQKKTG---SKNLVSNEERKYRRYFHLLQLVTLMVHGYVR 165
            D +E     ++S+ + P   +       S+N+ SNEERK R+YFH+L LV LMVHG++R
Sbjct: 99  TDGNEVAGVEDISVEIKPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIR 158

Query: 166 NQWLNDAKLHQKLSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQIT 225
           N+W+N  +L +KLS LVP+ VFELLHP++D+ELPLRSTRKLLDGLK+CME+W KH+    
Sbjct: 159 NEWINSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITK 218

Query: 226 RWETPGLYMLDWDELDGPWEQPTRYMSQKL--FNKKVAHGKGSSEIAAQGFVAMLRACGV 283
           +++  GLYM  W E++       ++ + K   F + V+ G G  +I+ QGFVAMLRAC V
Sbjct: 219 KYDNEGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNV 278

Query: 284 NARLIMNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFW 343
           NARLIM+ QPPDFTN K+    SL     Y D                      ++ +FW
Sbjct: 279 NARLIMSCQPPDFTNMKIDT--SLNGNNAYKDMV--------------------KYPIFW 316

Query: 344 CEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAK-RNNLFRYIIAYDRKLGCRDVT 402
           CEVWDK SKKWITVDP+  +TIEQ+R  + L P+G A    N+ RY+IAYDRK GCRDVT
Sbjct: 317 CEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVT 376

Query: 403 RRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPD 462
           RRY    NSK RKRRIT+D  GEKW ++V+  LH RKRT+ DD+ED YF QRDE+EGIPD
Sbjct: 377 RRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIPD 436

Query: 463 NMQDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKNNTS--LKVYRREDVLVLKTARTW 520
           ++QDLKNHPYYVL+ D K  +++K GCKECG+L+        LKVY + D+  LK+AR W
Sbjct: 437 SVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYLKVHGKVGKVLKVYAKRDIADLKSARQW 496

Query: 521 YTEGRVLKPGA---SALKTTKSRDFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVY 577
           Y  GR+LK G+     +K T  R     E  +ERLY+F++TEL+IP     + E+  N +
Sbjct: 497 YMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTF 556

Query: 578 GNIDIYTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQ 637
           GNI+++  +MIP   CL+E+PVA+KAA  LG+EFA AVT FKFE+    KP ++GIVV++
Sbjct: 557 GNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAK 616

Query: 638 EYREAVESMIDGVXXXXXXXXXXXXXXXALQHWNLFLAKLRIKQRLNTTHGKVS 691
             REA+E+ IDG+               AL+ WN  L KLRI+ +LN+T+GK++
Sbjct: 617 WLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRSKLNSTYGKIA 670

>CAGL0L11726g complement(1249886..1252363) similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein, start by similarity
          Length = 825

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/718 (43%), Positives = 436/718 (60%), Gaps = 60/718 (8%)

Query: 4   LPQEYFDLVRQAVKEDKQTPRRK-----------RRRLPKYESNDISRPADVIINLDSDT 52
           +P EYFDL+R  +K      + +              L     N     A +++NLDSD 
Sbjct: 6   IPSEYFDLIRDVLKNKGDATQERPLKRRKRRRAVTSELESGYENPQPTEAKIVVNLDSDP 65

Query: 53  DNETKFTSE---GLSKSFESQSNRDLDDDNEKXXXXXXXXXXXXXXXXXXXXXXXXXXXA 109
           + E K  +     L    E Q     +D  E                             
Sbjct: 66  ELEDKLGASNTISLVSDGEVQHTEASEDGAESDEAYESEEFEDVSAD------------- 112

Query: 110 DVSEQTSNAELSITLNPQKPQKKTGS----KNLVSNEERKYRRYFHLLQLVTLMVHGYVR 165
           ++   + N  ++I +N +  Q K  S    KN+ SNE+RK+R + H L L+ LM HG++ 
Sbjct: 113 EMQMPSDNLSVTINVNKKDSQSKKESSKIQKNMCSNEDRKFRTHMHCLYLLCLMCHGHII 172

Query: 166 NQWLNDAKLHQKLSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQIT 225
           N WLN++K+++KLS ++P+ VF++LHP++D+ELPLRSTRKLLDGLK+ MEIW KH+  + 
Sbjct: 173 NHWLNNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRIMQ 232

Query: 226 RWETPGLYMLDWDELDGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVNA 285
           R++    YM  WDEL    ++  + +++  F K +  G G  ++A QGFVA+LR+C VNA
Sbjct: 233 RYKGVNCYMRYWDELQ-ICDKSRKTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNA 291

Query: 286 RLIMNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCE 345
           RL+M+ QPPDFTN K S     K   E                      D  ++ +FWCE
Sbjct: 292 RLVMSCQPPDFTNLKKSYGTEKKVSYE----------------------DMTKYPVFWCE 329

Query: 346 VWDKVSKKWITVDPMGQRTIEQIRYKTALDPQG-SAKRNNLFRYIIAYDRKLGCRDVTRR 404
           VWDK SKKWIT+DP  ++TIEQ+R  +  +P+G S  + N  RY+I +DRK GCRD+TRR
Sbjct: 330 VWDKFSKKWITIDPFCKKTIEQVRLSSKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRR 389

Query: 405 YTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNM 464
           Y   FNSKTRK+RIT++A GE+W +RVLA LH+RKRT+ DD+EDAYF QR++ EG+PDNM
Sbjct: 390 YCQWFNSKTRKKRITKEAFGERWYERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNM 449

Query: 465 QDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKNNTS--LKVYRREDVLVLKTARTWYT 522
           QD K HPYYVL+ D + N+VLKSGCKECG+L+  N T+  LKVY ++D++ LK+A+ WY 
Sbjct: 450 QDFKGHPYYVLEKDIRQNQVLKSGCKECGYLKLHNKTNQVLKVYSKKDIIDLKSAKQWYM 509

Query: 523 EGRVLKPGASALKTT---KSRDFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGN 579
           EGR+LK GA ALKT    + R     E  EERLY FD+TEL++      + E+ TN +GN
Sbjct: 510 EGRILKTGARALKTVEKKRGRFTDPEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGN 569

Query: 580 IDIYTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEY 639
           I+++  SMIP   CL+ESPVA+KAA+ + I+FAKAVT FKFEK R  KP ITG+VV+  +
Sbjct: 570 IEVFVPSMIPANCCLVESPVAIKAASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWF 629

Query: 640 REAVESMIDGVXXXXXXXXXXXXXXXALQHWNLFLAKLRIKQRLNTTHGKVSSATVST 697
           R+A+ + IDG+               AL +W+  + KLRIK +LN+ +GKV+    ST
Sbjct: 630 RDALVAAIDGITQANAEEKHIEHELEALSYWHNLITKLRIKNKLNSEYGKVNEEESST 687

>AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH]
           (1049961..1052252) [2292 bp, 763 aa]
          Length = 763

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/722 (41%), Positives = 422/722 (58%), Gaps = 81/722 (11%)

Query: 2   GPLPQEYFDLVRQAVKED---KQTPRRKRRRLPKYESNDISRPADVIINLDSDTDNETKF 58
           G LP+ YF+LVR+AV  +   +  P+R RR      +   + P  V  + +    +E ++
Sbjct: 52  GKLPEHYFELVREAVAAEPAARHGPKR-RRTAAGVAAAQSAGPGSVASDDEGSAQSEEEY 110

Query: 59  TSEGLSKSFESQSNRDLDDDNEKXXXXXXXXXXXXXXXXXXXXXXXXXXXADVSEQTSNA 118
            SE     FE                                         DV  +T  A
Sbjct: 111 DSE----DFE-----------------------------------------DVEAETDAA 125

Query: 119 -ELSITLNPQKPQKKTGSKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLNDAKLHQK 177
            ++S+TL     + +     +V +E R +RR FH+L +  L+ H +VRN WLND +L  +
Sbjct: 126 GDVSVTL--AASRARPARAKVVDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRLQSR 183

Query: 178 LSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWETPGLYMLDW 237
           L+ LVPD V+  +HP+RD++LPLRSTRKLLD L++CM++W KH  +I   +  GLYM  W
Sbjct: 184 LAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDG-GLYMRPW 242

Query: 238 DELDGPWEQPTRYMSQKLFNKKVAHGKG-SSEIAAQGFVAMLRACGVNARLIMNAQPPDF 296
            +L   +      +++K FN+ +  G      +A +GFVA+LR CG+NARL+ + QPPD 
Sbjct: 243 AQLGQRYSSGAALLTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPPDL 302

Query: 297 TNNKVS--ARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEVWDKVSKKW 354
           T+ K +  ARGS   PG+  D TD                      L WCEVWD+ SK W
Sbjct: 303 TDMKPAGDARGS-DPPGDSEDDTD-----------------KYEFPLVWCEVWDRYSKAW 344

Query: 355 ITVDPMGQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVTRRYTTHFNSKTR 414
           ITVDP+ ++ +EQ+R K+ L+P G   R N  RY++ +DRK+GCRD+TRRY   +N+K R
Sbjct: 345 ITVDPLCKQLVEQVRNKSKLEPTGKFARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVR 404

Query: 415 KRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQDLKNHPYYV 474
           +RRITRD  G  W   +L  LHQRKR +TDD+ED YF +RDE EGIP+NM DL+NHP+YV
Sbjct: 405 RRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYV 464

Query: 475 LQNDFKWNEVLKSGCKECGFLRTKN-----NTSLKVYRREDVLVLKTARTWYTEGRVLKP 529
           L+ D + +E+L+   ++CG++R K       ++LKV+RR D++   + R W+ +G+VL+ 
Sbjct: 465 LEKDLRQHEILRPATEQCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRK 524

Query: 530 GASALKTTKSRDFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGNIDIYTSSMIP 589
              A KT   +D +TGE+ EERLY   ETE ++P  + P+  +PTN +GNIDIY  SMIP
Sbjct: 525 NCRAAKTVIVKDHRTGESEEERLYPESETEPYVPPPVAPDGTIPTNSFGNIDIYKPSMIP 584

Query: 590 RGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYREAVESMIDG 649
            G  LIE+P AV+AAA +G+ FAKAVTGF FE+ R  KP+ +G+VV   YR+AV +MIDG
Sbjct: 585 AGCVLIENPNAVRAAAFIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDG 644

Query: 650 VXXXXXXXXXXXXXXXALQHWNLFLAKLRIKQRLNTTHGKVSSATVSTWDDNEPDQSDTS 709
           +               ALQ W L LA+LR+KQRL   HG VS  T  +  D+EP+ SDT 
Sbjct: 645 IETIGDEARMQERELGALQSWALLLAQLRVKQRLIDRHGAVSEHTSDS--DSEPEASDTE 702

Query: 710 DG 711
            G
Sbjct: 703 AG 704

>Scas_576.3
          Length = 779

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/722 (42%), Positives = 434/722 (60%), Gaps = 66/722 (9%)

Query: 4   LPQEYFDLVRQAVKEDKQTPRRKRRRLPKYESNDISRPADVIINLDSDTDNETKFTSEGL 63
           LP+EYF+L+R A++  K  P+ +R+ L K +    +    V        +   + T+  L
Sbjct: 5   LPKEYFELIRTALRNKKDEPQEERQ-LKKRKRRTRTTATSV-------PEKHEEQTTLDL 56

Query: 64  SKSFESQSNRDLDDDNEKXXXXXXXXXXXXXXXXXXXXXXXXXXXADVSEQTSNA----- 118
           S   +  SN  L     K                            D  + T N      
Sbjct: 57  SSPIDKYSNTQLKSPERKEEHAGEASNSSNTEIQDEDDDDENYNSDDFEDVTENNSTDEN 116

Query: 119 --ELSITL-NPQKPQKKTG----SKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLND 171
             ++SIT+ +P K  +  G    ++N+ S E+R  R  FH+  L+ LMVHGY+RN+WLN 
Sbjct: 117 INDISITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNS 176

Query: 172 AKLHQKLSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWETPG 231
           +K   KLSKLVP+ VF+LLHP +D+ELPLRSTRKLLDGLK+ ME+W KH+  + ++E   
Sbjct: 177 SKFIVKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVA 236

Query: 232 LYMLDWDEL------DGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVNA 285
            YM  WDE+      + P+     ++S+K F ++V  G+G  +IAAQG+VA+LRAC VNA
Sbjct: 237 CYMKSWDEITTSTKPNSPF-----FLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNA 291

Query: 286 RLIMNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCE 345
           RLIM+ QPPD T+ K   +     P + +D  DM                  ++ +FWCE
Sbjct: 292 RLIMSCQPPDITDLKEKCK-----PID-IDYDDM-----------------VKYPIFWCE 328

Query: 346 VWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSA--KRNNLFRYIIAYDRKLGCRDVTR 403
           VWDK +KKWIT+D M    IEQ+++++ L+P G A  KRNNL RY+I YDRK GCRDVTR
Sbjct: 329 VWDKFAKKWITIDCMNFHIIEQVKHRSKLEPHGVACCKRNNL-RYVIGYDRKNGCRDVTR 387

Query: 404 RYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDN 463
           RY   +N+KTRK+RIT++ +GE+W  +VL  LH+RKRT+ DD+EDAY  QRD  E +PDN
Sbjct: 388 RYAEWYNAKTRKKRITKEPKGEEWFNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDN 447

Query: 464 MQDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKN------NTSLKVYRREDVLVLKTA 517
           +QDLKNHPYY+L+ D + N+VLK G KE G+L  +       N  LKVY R+++L LK+A
Sbjct: 448 LQDLKNHPYYILETDLRRNQVLKPGSKESGYLHLQGSKSKNKNKLLKVYERKNILDLKSA 507

Query: 518 RTWYTEGRVLKPGASALKTTKSRDFKTG---EATEERLYAFDETELFIPEDLGPNNEVPT 574
           R WY EGRVLK G+ +LKT K R  +     E  EERLY+ D+T L++P     + E+  
Sbjct: 508 RQWYMEGRVLKTGSRSLKTVKRRAMRPSLDDEEDEERLYSIDDTVLYVPPLATSDGEITP 567

Query: 575 NVYGNIDIYTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIV 634
           N YGNI+++  +MIP   CLIESP A+KAA  L I + +AVTGFKFE+ R +KP I G+V
Sbjct: 568 NAYGNIEVFVPTMIPGNCCLIESPYAIKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVV 627

Query: 635 VSQEYREAVESMIDGVXXXXXXXXXXXXXXXALQHWNLFLAKLRIKQRLNTTHGKVSSAT 694
           V+  YR+AV+S IDG+               +L+ W+  L+KLRIK++L+  +G V    
Sbjct: 628 VANWYRDAVKSCIDGIEYSVDNDKKLEEELESLRCWHTLLSKLRIKKKLDVIYGTVGEEN 687

Query: 695 VS 696
           ++
Sbjct: 688 LN 689

>KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein singleton, start by similarity
          Length = 767

 Score =  501 bits (1290), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 252/554 (45%), Positives = 354/554 (63%), Gaps = 32/554 (5%)

Query: 144 RKYRRYFHLLQLVTLMVHGYVRNQWLNDAKLHQKLSKLVPDNVFELLHPKRDDELPLRST 203
           +++R+  H+  L+TL+ H Y RN+W ND KL +KL+KLV D++F  LHP++DDE+PLRST
Sbjct: 127 KEFRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLHPQKDDEMPLRST 186

Query: 204 RKLLDGLKRCMEIWWKHF--DQITRWETPGLYMLDWDELDGPWEQPTRYMSQKLFNKKVA 261
           RKLLD L+  M+ W K F  +  + +E   LYM+ WD +    +     ++ K F K   
Sbjct: 187 RKLLDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSV---LKHKCESVTFKTFKKFFT 243

Query: 262 HGKGSSEIAAQGFVAMLRACGVNARLIMNAQPPDFTNNKV-SARGSLKTPGEYLDKTDMR 320
             +G + I+ QGFV MLR CG+NARLI + QPPDFT++K+ + R       E L      
Sbjct: 244 RMRGPANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSKIYNKRVVWSLENECL------ 297

Query: 321 PKRRKKAKGGQRDPDAKRHVLFWCEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSA 380
                            ++ +FWCEVWDK +K+WIT+D +GQ  IEQ+RYK+ L+P G  
Sbjct: 298 -----------------KYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRI 340

Query: 381 KRN-NLFRYIIAYDRKLGCRDVTRRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRK 439
               N+ RY+IA+DRK GC+DV+RRY  H  +K RK+RITR+A+  +W   ++  L++R 
Sbjct: 341 NSAFNMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRN 400

Query: 440 RTRTDDFEDAYFRQRDETEGIPDNMQDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKN 499
           R R DD+ED YF  R+E EGIPD++QD+KNHP+YVL+ D + N+VLK G ++CGFLR +N
Sbjct: 401 RNRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRN 460

Query: 500 --NTSLKVYRREDVLVLKTARTWYTEGRVLKPGASALKTTKSRDFKTGEATEERLYAFDE 557
             N+ LKV+ R+DV+   +AR WY +GR LK GA  L T K ++    +  EERLY   +
Sbjct: 461 KSNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLTHKIKNPVEEDEDEERLYPIGQ 520

Query: 558 TELFIPEDLGPNNEVPTNVYGNIDIYTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTG 617
           TE  IP+ +  + ++PTN YGNIDIY   MIP G CL+E+P ++KAA+ L + FAKAVTG
Sbjct: 521 TEYVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTG 580

Query: 618 FKFEKKRVAKPQITGIVVSQEYREAVESMIDGVXXXXXXXXXXXXXXXALQHWNLFLAKL 677
           FKFE  R  KP++TG+VV  EY +A+ ++I+ +               AL  W+L L KL
Sbjct: 581 FKFESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKL 640

Query: 678 RIKQRLNTTHGKVS 691
           RIK RL   HG V+
Sbjct: 641 RIKSRLVEEHGAVA 654

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 2  GPLPQEYFDLVRQAVKEDKQT-------PRRKRR-RLPKYESNDISRPADVIINLDSDTD 53
          G L +EYFDL++ A++E+++T       PR++R+ R  + E    S    V+I ++SD +
Sbjct: 4  GRLSREYFDLIKDALQEEEKTGGSGSSSPRKRRKLRSLQKEPELESESNRVVITIESDDE 63

Query: 54 NETKF 58
           +  +
Sbjct: 64 EQNNY 68

>YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Member
           of the DNA repair protein Rad4 family, has low
           similarity to uncharacterized C. albicans Orf6.3103p
           [2079 bp, 692 aa]
          Length = 692

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 117/275 (42%), Gaps = 49/275 (17%)

Query: 460 IPDNMQDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKNNTSLKVYRREDVLVLKTART 519
           +P ++ ++K    +V+ +  K NEVLK+  K+       +N+   ++ R DV+ LK+ + 
Sbjct: 434 LPKSVTEIKRTDNFVIPSLLKSNEVLKACAKQAATFTKGDNSQEPIFWRRDVIQLKSKQH 493

Query: 520 WYTEGRVLKPGASALKTTKSRDFKTGEATEERLYAFDETELFIPEDLGPNNEVPT----- 574
           W   GR + P A  LK  K    +  E     L  +   ELF  E    + + P+     
Sbjct: 494 WAILGRSILPNAQPLKRKKYLPMR--ERMVRNLDKYVIKELFSYEQTMKSPKYPSTYCDH 551

Query: 575 --------------NVYGNIDIYTSSMIPRGSCLIESPVAVKA-AACL------------ 607
                         N +GNI+IY+    P G  LI  P++ +    CL            
Sbjct: 552 LGQEHVITDLSHYKNKFGNIEIYSKETKPDGFELI--PLSKEVDIKCLIKEYNKGKRKMQ 609

Query: 608 GIEFAKAVTGFKF-EKKRVAKPQITGIVVSQEYREAVESMIDGVXXXXXXXXXXXXXXXA 666
            I++   V+GF F +KK  A P+I  I+V +   +AV+ +                    
Sbjct: 610 KIKYLDVVSGFDFKQKKGHAIPKIESILVKETDYKAVQLL-----------KQQTKVLLG 658

Query: 667 LQHWNLFLAKLRIKQRLNTTHGKVSSATVSTWDDN 701
           L  W++ L KLR+  RLN  +G V +    T DD+
Sbjct: 659 LSFWDILLRKLRVNDRLNAEYGNVGNNE-ETLDDH 692

>CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces
           cerevisiae YDR314c, hypothetical start
          Length = 668

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 135/658 (20%), Positives = 254/658 (38%), Gaps = 128/658 (19%)

Query: 118 AELSITLNPQKPQKKTGSKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLNDAKLHQK 177
            ++++ L     Q  T  +    N   + R   H++ +  L+     R  W  D +L ++
Sbjct: 54  GDITVKLKAPLHQNATNKRRRKDNFYHRLRYGLHIIAIPILVATLIKRTNWTQDERLRRR 113

Query: 178 LSKLVPDNVFELLH--PKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITR-------WE 228
           L + VP  + + +    K   ++ + S R LL GL     +W++   QI         + 
Sbjct: 114 LKRSVPKQITKKVKNWSKSSQDIRISSIRTLLLGL----VMWFRANYQINSNGFRQNFYR 169

Query: 229 TPGLYMLDWDELDGPWEQPTRYMSQKLFNKK-------------VAHGKGSSEIAAQGFV 275
              ++ LD   +  P+ +       K + ++             V + K + +     F+
Sbjct: 170 LHYIFRLDDGNVMKPYREACLRDQHKYYGERPDIAGNIEDIRTFVRNKKANRDYLTLFFI 229

Query: 276 AMLRACGVNARL----------IMNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRPKRRK 325
            +LR      ++          + N Q       K+++R + K P  + D   ++P    
Sbjct: 230 TILREILPADQIKSLRLCFSLPLHNFQISPRNITKLASRDAGKVPNRF-DTDLLQP---- 284

Query: 326 KAKGGQRDPDAKRHVLFWCEV--WDKVSKKWITVDPMGQRTIEQIRYKTALD-------- 375
                           FW E+   D+  K ++ +DP+       I  K  +D        
Sbjct: 285 ---------------YFWIELHTIDEPDKLYV-IDPVVHIEEGNIVKKYNIDEPVDIFEP 328

Query: 376 -PQGSAKRNNLFRYIIAYDRK-LGCRDVTRRYT--THFNSKTRKR----RITRDAEGEKW 427
               +   N  F+Y+I+ D K +  RDV+ RY    ++    R R      TR ++   +
Sbjct: 329 IKDLNLNVNQWFQYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETTRQSKSHHF 388

Query: 428 MKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQDLKNHPYYVLQNDFKWNEVLKS 487
             RVL    + +   T   +        +   +P ++ +LK  P +      K +E + S
Sbjct: 389 FMRVLKSTSRYRNDNTVLMKTI----AAKNYKLPKSISELKRSPNFKGLRILKQSETVSS 444

Query: 488 GCKECGFLRTKNNTSLKVYRREDVLVLKTARTWYTEGRVLKPGASAL--KTTKSRDFKTG 545
             K  G ++       K+YR  D+L LKT + WY  GR +K  A  +  KT   R     
Sbjct: 445 KAKPVGKVQYGGKKD-KIYRISDILPLKTRQHWYLLGRTVKEDAKPIRTKTIPLRKRNAI 503

Query: 546 EATEE-----RLYAFDETEL-----------FIPEDLGPNNEVPTNVYGNIDIYTSSMIP 589
            + +E      L+++++T+L           +    +  + +   N Y N++IY+ S+IP
Sbjct: 504 SSAQELNFARELFSYEQTDLTPKYPSSYKDVYGIYHVVCDVDFYKNKYKNVEIYSKSVIP 563

Query: 590 RGSCLIES----------PVAVKAAACLG------IEFAKAVTGFKFEKKRVAKPQITGI 633
            G  L+ +           +   A    G      I++   V+GF F K + A P  T I
Sbjct: 564 TGFRLMRTFDKDYKFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFRKGQ-ATPIKTHI 622

Query: 634 VVS-QEYREAVESMIDGVXXXXXXXXXXXXXXXALQHWNLFLAKLRIKQRLNTTHGKV 690
           +V+  +YR+ +    D +                L+ W+ F+ +L+IK  L   +GK+
Sbjct: 623 LVNYMDYRKILSLQKDYIELLR------------LESWSNFITRLKIKCELEDKYGKL 668

>Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement
          Length = 664

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/404 (21%), Positives = 153/404 (37%), Gaps = 73/404 (18%)

Query: 342 FWCEVWDKVSKKWITVDPM----GQRTIEQIR---YKTALDPQGSAKRN--NLFRYIIAY 392
           FW E   KV      +DP+     +R + + R   Y   + P    K N    F YI++ 
Sbjct: 274 FWIEC--KVRDDLYIIDPIVNVDQKRIVMKARADEYVPHIKPLDDLKINYTQRFHYIVSI 331

Query: 393 DRKLGCRDVTRRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFR 452
              +   DV+ RY  +   +      T  +  +     +L R   RK    +  ++ Y  
Sbjct: 332 ANDMHMMDVSPRYLDNICYRYFNTPSTVFSSSKPLKSSILFRKFLRKYGTIEKSKE-YNS 390

Query: 453 QRD---ETEGIPDNMQDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKNNTSLKVYRRE 509
             D   +   IP  +  +K    + + +  K NEV+ +  +  G       T   VY ++
Sbjct: 391 LVDLALQNYKIPKTLIGMKRSDNFTMPSLLKANEVISASTRPVGTFCRGQQTEEYVYWKK 450

Query: 510 DVLVLKTARTWYTEGRVLKPGASALKTTKSRDFKTGEATEERLYAFDETELFIPEDLGP- 568
           D+L LK+ + W   GR +K  A  +K+ K    K     E+RLY ++  EL+  E     
Sbjct: 451 DILRLKSRQHWALLGRTVKMDAVPMKSKKVHTMKMRR--EKRLYMYEIRELYAFEQTIAT 508

Query: 569 ---NNEVPT---------------NVYGNIDIYTSSMIP--------------------- 589
              NN   T               N +G+++IY +++ P                     
Sbjct: 509 PKMNNTYLTSVGGRGLITDVYHFKNAHGHVEIYNANLKPDGFEMFAATKETKLLIRQYNR 568

Query: 590 ---RGSCLIESPVAVKAAACL-GIEFAKAVTGFKFEKK-RVAKPQITGIVVSQEYREAVE 644
              +G   ++    V    CL  ++F   V+GF F++    A P +  I+V+      +E
Sbjct: 569 DIRKGIGFLKDKYVVPKLQCLEPLKFLDVVSGFDFKQTPGYAVPVLNQILVNHNDFCRLE 628

Query: 645 SMIDGVXXXXXXXXXXXXXXXALQHWNLFLAKLRIKQRLNTTHG 688
            +I                   L +W   L  L++K+R++  +G
Sbjct: 629 LLIG-----------QNRELQNLNYWQNLLQALQVKRRIDKQYG 661

>ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH]
           complement(768355..769407) [1053 bp, 350 aa]
          Length = 350

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 49/118 (41%), Gaps = 16/118 (13%)

Query: 343 WCEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVT 402
           WCEV+    K+W+ VD   +   E   Y        S   N    Y+IA+  +   +DV+
Sbjct: 212 WCEVYSNALKRWVHVDSCEKSFDEPHIY--------SVNWNKAMSYVIAFSNR-SVKDVS 262

Query: 403 RRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGI 460
           RRY         + R+ RD   E  ++ +   L +  R +  D E      RDE E I
Sbjct: 263 RRYIV-------RNRLPRDQIDEDDLQFLTKYLTKLLRLQLPDEERYLLHCRDELEAI 313

>CAGL0H05753g complement(569862..570908) similar to tr|Q02890
           Saccharomyces cerevisiae YPL096w PNG1, hypothetical
           start
          Length = 348

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 48/121 (39%), Gaps = 16/121 (13%)

Query: 343 WCEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVT 402
           WCE +    K+WI VD   Q   E   Y        S   N    Y I + R  G  DV+
Sbjct: 206 WCEYYSPYLKRWIHVDSCEQSFDEPFIY--------SKNWNKSMSYCIGFWR-YGVVDVS 256

Query: 403 RRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPD 462
           +RY         + ++ RD   E  ++ +   L +R RT   D E      RD+ E +  
Sbjct: 257 KRYIL-------QNQLPRDIIKEDDLQFLCHALTKRLRTGLSDDESYKMYCRDDLEQLEL 309

Query: 463 N 463
           N
Sbjct: 310 N 310

>Kwal_27.12204
          Length = 368

 Score = 36.2 bits (82), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 16/116 (13%)

Query: 343 WCEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVT 402
           WCE +    K+W+ VD   Q   E   Y        S   N    Y+IA++    C DV+
Sbjct: 226 WCEFYSTFLKRWVHVDACEQSFDEPHIY--------SVNWNKKMSYVIAFE-PYSCVDVS 276

Query: 403 RRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETE 458
           +RY         + ++ RD   E  ++ +L  + +R+R    D E      RDE E
Sbjct: 277 KRYII-------QNQLPRDQIKEDDLQFLLDMITRRQRMLLTDDEVYVQACRDEQE 325

>YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase
           enzyme, may be involved in degradation of misfolded
           glycoproteins [1092 bp, 363 aa]
          Length = 363

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 47/118 (39%), Gaps = 16/118 (13%)

Query: 343 WCEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVT 402
           WCE +     +W+ VD   Q   +   Y        S   N    Y IA+ +  G  DV+
Sbjct: 220 WCEYFSNFLNRWVHVDSCEQSFDQPYIY--------SINWNKKMSYCIAFGKD-GVVDVS 270

Query: 403 RRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGI 460
           +RY         +  + RD   E+ +K +   + +R R   +D E      RDE E I
Sbjct: 271 KRYIL-------QNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQI 321

>Sklu_2107.4 YPL106C, Contig c2107 4499-6580 reverse complement
          Length = 693

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 78/218 (35%), Gaps = 25/218 (11%)

Query: 235 LDWDELDGPWEQPTRYMSQKLFNKKVAHGKGSSEIAAQGFVAMLRACGVNARLIMNAQPP 294
           LD+D  D  +EQ ++Y S KL   K+  GK  +++   G      A  + A  I      
Sbjct: 74  LDYDHPD--FEQESKYFSSKLV--KLDDGKVGAQVRFAGKQQTFSATQLAAMYI------ 123

Query: 295 DFTNNKVSARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEVWDKVSKKW 354
               NKV      +T G   D     P    + +       AK   L    + + V+   
Sbjct: 124 ----NKVKTTAVQETKGNITDVAIAVPAWYTEEQRYSIGDAAKIAGLNPVRIVNDVTAAA 179

Query: 355 ITVD------PMGQR-----TIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVTR 403
           ++        P G+          I + T      + K+  L     AYD+  G RD  R
Sbjct: 180 VSYGVFKTDLPEGEEKPRVVAFVDIGHSTYTCTIAAFKKGELKVLATAYDKHFGGRDFDR 239

Query: 404 RYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKRT 441
             T HF  + + +      E  K   R+LA   + K+ 
Sbjct: 240 AITEHFADEFKTKYKIDIRENPKAYSRILAAAEKLKKV 277

>Kwal_27.12262
          Length = 693

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%)

Query: 378 GSAKRNNLFRYIIAYDRKLGCRDVTRRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQ 437
           G+ KR  L     AYD+  G RD  R  T HF  + + +      E  K   RVL    +
Sbjct: 214 GAFKRGELKILGTAYDKHFGGRDFDRAITEHFADEFKTKYKIDIRENAKAYNRVLTGAER 273

Query: 438 RKRT 441
            K+ 
Sbjct: 274 LKKV 277

>Scas_700.2
          Length = 351

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 50/121 (41%), Gaps = 20/121 (16%)

Query: 339 HVLFWCEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGC 398
           HV  WCE +     +W+ VD   Q   +   Y        S   N    Y IA+ +    
Sbjct: 208 HV--WCEYYSPYLNRWVHVDSCEQSFDQPYIY--------SINWNKSMSYCIAFSKD-DV 256

Query: 399 RDVTRRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQR-KRTRTDDFEDAYFRQRDET 457
            DV++RY         K  + RD   E  ++ +   L +R +R RTDD     F+ RDE 
Sbjct: 257 TDVSKRYIL-------KNELPRDQISELDLQFICTYLTKRLRRQRTDDELFELFK-RDER 308

Query: 458 E 458
           E
Sbjct: 309 E 309

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,318,296
Number of extensions: 1010272
Number of successful extensions: 3324
Number of sequences better than 10.0: 23
Number of HSP's gapped: 3388
Number of HSP's successfully gapped: 29
Length of query: 712
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 603
Effective length of database: 12,822,747
Effective search space: 7732116441
Effective search space used: 7732116441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)