Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2341331531113460.0
YER161C (SPT2)3333523378e-37
Scas_576.23493563327e-36
CAGL0L11704g3363402915e-30
AGR161C3373351993e-17
KLLA0F14487g3021411665e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23413
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23413                                                         523   0.0  
YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like c...   134   8e-37
Scas_576.2                                                            132   7e-36
CAGL0L11704g complement(1248417..1249427) similar to sp|P06843 S...   116   5e-30
AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH] (1048663..1...    81   3e-17
KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843 Saccha...    69   5e-13

>Kwal_56.23413
          Length = 315

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/311 (87%), Positives = 271/311 (87%)

Query: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIXX 60
           MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAI  
Sbjct: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIRR 60

Query: 61  XXXXXXXXQLKNAPKNKPAAPSRKRKDENSANTETKFRRKVGESLQSRKPVAPVKRTPLK 120
                   QLKNAPKNKPAAPSRKRKDENSANTETKFRRKVGESLQSRKPVAPVKRTPLK
Sbjct: 61  LKELRRKEQLKNAPKNKPAAPSRKRKDENSANTETKFRRKVGESLQSRKPVAPVKRTPLK 120

Query: 121 KLSFDELMKEAEEKSKNPSTDPIDSTSRSKALQNNPPVRLQRPGFKSAARRDRKPLSTPK 180
           KLSFDELMKEAEEKSKNPSTDPIDSTSRSKALQNNPPVRLQRPGFKSAARRDRKPLSTPK
Sbjct: 121 KLSFDELMKEAEEKSKNPSTDPIDSTSRSKALQNNPPVRLQRPGFKSAARRDRKPLSTPK 180

Query: 181 ITKQKSPVESLQRLPAPRPSIAQPGAKLKRKLENLKKHRQTDRYRSSXXXXXXXXXXXXX 240
           ITKQKSPVESLQRLPAPRPSIAQPGAKLKRKLENLKKHRQTDRYRSS             
Sbjct: 181 ITKQKSPVESLQRLPAPRPSIAQPGAKLKRKLENLKKHRQTDRYRSSEEEDMDDFIEDDE 240

Query: 241 XXQGFNRDEIWAMFNKGKKRRDFENDYESXXXXXXXXXXXXXXXRATKMAKLEDKREEEW 300
             QGFNRDEIWAMFNKGKKRRDFENDYES               RATKMAKLEDKREEEW
Sbjct: 241 EEQGFNRDEIWAMFNKGKKRRDFENDYESDDMEVNEMDIMEEEERATKMAKLEDKREEEW 300

Query: 301 LKKHEQEKRRR 311
           LKKHEQEKRRR
Sbjct: 301 LKKHEQEKRRR 311

>YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like
           chromatin protein that interacts with Snf1p through a
           conserved domain, negative regulator of HO gene
           transcription [1002 bp, 333 aa]
          Length = 333

 Score =  134 bits (337), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 156/352 (44%), Gaps = 65/352 (18%)

Query: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPL----RDESSLLPQKYVREEDP 56
           MSFL+K SQ+RK   A                   +DPL     +E SLLP+ Y+R+EDP
Sbjct: 1   MSFLSKLSQIRKSTTASK--------------AQVQDPLPKKNDEEYSLLPKNYIRDEDP 46

Query: 57  AIXXXXXXXXXXQLKNAPKNKPAAPSRKR-------------KDENSANTETKFRRKVGE 103
           A+           LKN    K +   RKR              D++      +F+R +G 
Sbjct: 47  AVKRLKELRRQELLKNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGA 106

Query: 104 SLQSRKPVAPVKRTPLKKLSFDELMKEAEEKSKNP----STDPIDSTSRSKALQNNPPVR 159
           S    KPV   K  P+KK+SF+ELMK+AE   K P    S++P+         +  P   
Sbjct: 107 SHAPLKPVVRKKPEPIKKMSFEELMKQAENNEKQPPKVKSSEPV--------TKERP--H 156

Query: 160 LQRPGFKSAARRDRKPLSTPKITKQKSPVESLQRLPAPRP--------SIAQPGAKLKRK 211
             +PGFKS+ R  +K      +    S   S++   +P+P          AQP  +LK K
Sbjct: 157 FNKPGFKSSKRPQKKASPGATLRGVSSGGNSIKSSDSPKPVKLNLPTNGFAQPNRRLKEK 216

Query: 212 LENLK-KHRQTDRY----------RSSXXXXXXXXXXXXXXXQGFNRDEIWAMFNKGKKR 260
           LE+ K K R  D Y                             G++RDEIWAMFN+GKKR
Sbjct: 217 LESRKQKSRYQDDYDEEDNDMDDFIEDDEDEGYHSKSKHSNGPGYDRDEIWAMFNRGKKR 276

Query: 261 -RDFENDYESXXXXXXXXXXXXXXXRATKMAKLEDKREEEWLKKHEQEKRRR 311
                ++ E                 A KMA+LEDKREE WLKKHE+EKRRR
Sbjct: 277 SEYDYDELEDDDMEANEMEILEEEEMARKMARLEDKREEAWLKKHEEEKRRR 328

>Scas_576.2
          Length = 349

 Score =  132 bits (332), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 116/356 (32%), Positives = 176/356 (49%), Gaps = 55/356 (15%)

Query: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIXX 60
           MSFL+K SQL+K        + + ++   +    +ED      SLLP  Y+R+EDPA+  
Sbjct: 1   MSFLSKLSQLKKASTTNTSMKNTSKESIPRKKSIEEDI----PSLLPTNYIRDEDPAVRR 56

Query: 61  XXXXXXXXQLKN---APKNKPAAPSR------KRKDEN-SANTETKFRRKVGESLQSRKP 110
                   Q+KN   A K+K   PS       K+ D+N +A+  ++F++K+G +     P
Sbjct: 57  LKELRRKEQIKNGEFAKKHKKTNPSTTTKRKSKKDDDNLAADGYSRFKKKLGSTHTRPTP 116

Query: 111 VAPVKR--TPLKKLSFDELMKEAEEKSKNPSTDPIDSTSRSKALQNNPPVRLQRPGFKSA 168
           V  + R   P+KK+SFDELMK+AE  +   S +  +  S+ ++   + P  L +PGF+SA
Sbjct: 117 VRTLTRKMEPIKKISFDELMKQAENNAS--SKESSEGISKKESPSASRP-HLHKPGFRSA 173

Query: 169 ARRDRKPLSTP-----KITKQKSPVESLQRLPAPRPS--------IAQPGAKLKRKLENL 215
             RDR  +S P      + ++K  +  ++  P  R +        +AQP  +LK++LE+ 
Sbjct: 174 --RDRNRVSKPVKHQTTLPRKKMSLSPIRNRPGSRDATPIKISLPVAQPNQRLKQRLES- 230

Query: 216 KKHRQT--DRY------------------RSSXXXXXXXXXXXXXXXQGFNRDEIWAMFN 255
           K+ R +  DRY                                     G++RDEIWAMFN
Sbjct: 231 KRQRPSGRDRYGRPEYDYDDEDDMDDFIEDDEEDSEVHRRMKLHRDDPGYDRDEIWAMFN 290

Query: 256 KGKKRRDFENDYESXXXXXXXXXXXXXXXRATKMAKLEDKREEEWLKKHEQEKRRR 311
           KG+KR ++  D E                RA +MA+LEDKRE  WLKKHE+EKRR+
Sbjct: 291 KGRKRSEYAYDEEEDDMEANEMEILEEEERAEEMARLEDKREAAWLKKHEEEKRRK 346

>CAGL0L11704g complement(1248417..1249427) similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein, start by similarity
          Length = 336

 Score =  116 bits (291), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 157/340 (46%), Gaps = 62/340 (18%)

Query: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIXX 60
           MSFL+K S+L+K             K ++ ++  Q+   ++E SLLP+ YVREEDPA+  
Sbjct: 1   MSFLSKLSELKK------------TKPKTVISPPQKANKQEEISLLPKNYVREEDPAVTR 48

Query: 61  XXXXXXXXQLKN-------------APKNKPAAPSRKRKDENSANTETKFRRKVGESLQS 107
                    LKN              P +  A+  +K K+ +     ++F+RKVG    S
Sbjct: 49  LKELRRQELLKNPELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVG----S 104

Query: 108 RKPVAPV----KRTPLKKLSFDELMKEAEEKSKNPSTDPI--DSTSRSKALQNNPPVRLQ 161
            KP  P+    K  P+KKLSF+ELMK+AE    N  T P+  D+ S     +     +L 
Sbjct: 105 DKPAVPIQVKKKPQPIKKLSFEELMKQAE----NNQTIPVSKDTQSNGAGEKIKGSAKLN 160

Query: 162 RPGFKSAARRDRKPLSTPKIT---KQKSPV----ESLQRLPAPRPSIAQPGAKLKRKLEN 214
           +PGFK++  +   P +    T   K KS      E + ++  P+   AQP  +LK+KLE 
Sbjct: 161 KPGFKTSRPKSLSPTTHINKTDHGKDKSTAKEKSEPVVKIGIPK--FAQPNERLKKKLEM 218

Query: 215 LKKHRQTDRY---------RSSXXXXXXXXXXXXXXXQGFNRDEIWAMFNKGKKR----- 260
            ++  ++ RY                            G++RDEIWAMFNKG+KR     
Sbjct: 219 RQRVNKSRRYEDEEDDMDDFIEDDEEEYSSYRTTSKDPGYDRDEIWAMFNKGRKRSYNEY 278

Query: 261 RDFENDYESXXXXXXXXXXXXXXXRATKMAKLEDKREEEW 300
            D+E + +                 A +MA+LEDKREE W
Sbjct: 279 MDYEEEDDFDAMEANEMEILEEEEEAARMARLEDKREEAW 318

>AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH]
           (1048663..1049676) [1014 bp, 337 aa]
          Length = 337

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 152/335 (45%), Gaps = 46/335 (13%)

Query: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRD-ESSLLPQKYVREEDPAIX 59
           MSFLAK SQL+K          ++    SK  + +++P  D +S +LP+ YVR+EDPAI 
Sbjct: 1   MSFLAKLSQLKKS-----TTSSTDTGSGSKATKKEDNPSLDFKSPILPEYYVRKEDPAIR 55

Query: 60  XXXXXXXXXQLKNAPKNKPAAPSRKRKDENSANTETKFRRKVGES-LQSRKPVAPV---- 114
                    QL+     K  A S++R   N     +   R+ G +  +  +P + V    
Sbjct: 56  RLKEKRRQEQLRKGTLKK--ASSQRRSKANGGEVASGGVRQEGSTRWKLPRPKSTVVAAA 113

Query: 115 -KRTPLKKLSFDELMKEAEEKSKNPSTDPIDSTSRSKALQNNPPVRLQRPGFK-----SA 168
               PLKKLSF+ELMK+AEEK+K+P+     S  R+     + P  + +PGFK      A
Sbjct: 114 APAPPLKKLSFEELMKQAEEKAKSPAA----SGKRTAPAGPSAPA-VSKPGFKPRSNSGA 168

Query: 169 ARRDRKPLSTPKITKQKSP------------VESLQRLPAPRPS---IAQPGAKLKRKLE 213
           A    K     K  +                +++ Q +    PS   +A+P  KL+R LE
Sbjct: 169 AVVGGKVAGADKGARNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKPNEKLRRILE 228

Query: 214 NL-KKHRQTDRYRSSXXXXXXXXXXXXXXXQG----FNRDEIWAMFNKGKKR--RDFEND 266
              ++ R    Y                  +G    ++++EIW++FNKG++R  ++ +++
Sbjct: 229 KQERRKRSAGEYEEDDSDLDDFIADDDGEEEGGSYGYDKEEIWSIFNKGRRRLYQEDDDN 288

Query: 267 YESXXXXXXXXXXXXXXXRATKMAKLEDKREEEWL 301
                              ++KMA+ EDK EEEW+
Sbjct: 289 DFDDDMEANEMEILEEEDYSSKMARREDKMEEEWI 323

>KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein singleton, start by
           similarity
          Length = 302

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 75/141 (53%), Gaps = 18/141 (12%)

Query: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIXX 60
           MSFLAK  QL K+    N+   S        N+++   L+ E  LLP+ YVRE DPAI  
Sbjct: 1   MSFLAKLQQL-KQTTKINEPNHS-------ANQNKAKSLQSEEKLLPKDYVREVDPAIQR 52

Query: 61  XXXXXXXXQLKNAPKNKPAAPSRKR----KDENSANTETKFRRKVGESLQSRK-PVAPVK 115
                   Q  ++   KPAA +R +    KDE        +++K G +  S K PV   K
Sbjct: 53  LKEARRLKQGISSTSTKPAAKARHKASSPKDEAPI-----YKKKPGVNTTSGKYPVVVPK 107

Query: 116 RTPLKKLSFDELMKEAEEKSK 136
           R P+KKLSFDELMK AE+KS+
Sbjct: 108 REPIKKLSFDELMKRAEQKSR 128

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.125    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,523,495
Number of extensions: 388425
Number of successful extensions: 1864
Number of sequences better than 10.0: 112
Number of HSP's gapped: 1814
Number of HSP's successfully gapped: 121
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 61 (28.1 bits)