Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2341082581439320.0
YDR089W86987711401e-143
KLLA0F14509g8518759761e-119
AGR160W8368399151e-110
Scas_636.128378679111e-110
CAGL0C03696g8318518611e-102
Kwal_27.1229221734820.062
Sklu_2202.81367111820.13
AGR223W132148770.52
YCR037C (PHO87)92351770.54
Scas_704.3991630760.66
CAGL0J07040g124555741.0
YPL110C122346741.0
YIL047C (SYG1)90230721.8
KLLA0C03454g90032721.9
KLLA0F00660g137436722.2
ADL080W86323712.5
Kwal_23.578585631694.0
Scas_625.1693250678.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23410
         (814 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23410                                                        1519   0.0  
YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing...   443   e-143
KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...   380   e-119
AGR160W [4471] [Homologous to ScYDR089W - SH] complement(1045983...   357   e-110
Scas_636.12                                                           355   e-110
CAGL0C03696g complement(367135..369630) similar to sp|P38966 Sac...   336   e-102
Kwal_27.12292                                                          36   0.062
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           36   0.13 
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    34   0.52 
YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of ...    34   0.54 
Scas_704.39                                                            34   0.66 
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    33   1.0  
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    33   1.0  
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...    32   1.8  
KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces c...    32   1.9  
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    32   2.2  
ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH] complement(...    32   2.5  
Kwal_23.5785                                                           31   4.0  
Scas_625.16                                                            30   8.3  

>Kwal_56.23410
          Length = 825

 Score = 1519 bits (3932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/814 (90%), Positives = 739/814 (90%)

Query: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60
           MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT
Sbjct: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60

Query: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELL 120
           QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELL
Sbjct: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELL 120

Query: 121 RICRFLILQKIAXXXXXXXXXXYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLD 180
           RICRFLILQKIA          YYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLD
Sbjct: 121 RICRFLILQKIALRKLLKKFLKYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLD 180

Query: 181 PYLLEVSLVVDVLQELEQAASGRKGSLTHETMKSEMPGEIEGAHSAPMASHADSDLAFDS 240
           PYLLEVSLVVDVLQELEQAASGRKGSLTHETMKSEMPGEIEGAHSAPMASHADSDLAFDS
Sbjct: 181 PYLLEVSLVVDVLQELEQAASGRKGSLTHETMKSEMPGEIEGAHSAPMASHADSDLAFDS 240

Query: 241 IFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMILVXXXXXXXXXXXXXXANGTS 300
           IFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMILV              ANGTS
Sbjct: 241 IFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMILVSQQSLKDSSSTSLTANGTS 300

Query: 301 GKTPRTVKSFHDLRLASDQNENVALPMISDIRSSQQTEIAMLDSKPVPSFLEDDAINRHP 360
           GKTPRTVKSFHDLRLASDQNENVALPMISDIRSSQQTEIAMLDSKPVPSFLEDDAINRHP
Sbjct: 301 GKTPRTVKSFHDLRLASDQNENVALPMISDIRSSQQTEIAMLDSKPVPSFLEDDAINRHP 360

Query: 361 TIVVNGSRTCKCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLDXXXXXXXXXXXXPIG 420
           TIVVNGSRTCKCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLD            PIG
Sbjct: 361 TIVVNGSRTCKCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLDTLETESETEVTTPIG 420

Query: 421 KLCLEWIKSHSLHQCGPKISTQRTRFTKAVGEPNLTEYLVCVDESIVLAGSKKVPHAVVE 480
           KLCLEWIKSHSLHQCGPKISTQRTRFTKAVGEPNLTEYLVCVDESIVLAGSKKVPHAVVE
Sbjct: 421 KLCLEWIKSHSLHQCGPKISTQRTRFTKAVGEPNLTEYLVCVDESIVLAGSKKVPHAVVE 480

Query: 481 IRSQQSGGMLHRKEGYKDELITTLIEKMYENHISCYPLKEDQTLWKLLYQAANAEDLKSG 540
           IRSQQSGGMLHRKEGYKDELITTLIEKMYENHISCYPLKEDQTLWKLLYQAANAEDLKSG
Sbjct: 481 IRSQQSGGMLHRKEGYKDELITTLIEKMYENHISCYPLKEDQTLWKLLYQAANAEDLKSG 540

Query: 541 LFSAACPSLTSFNSESIFEIGESELSRMIAAKGEQRRASFAGKKPKSRKTKEQLISPQAN 600
           LFSAACPSLTSFNSESIFEIGESELSRMIAAKGEQRRASFAGKKPKSRKTKEQLISPQAN
Sbjct: 541 LFSAACPSLTSFNSESIFEIGESELSRMIAAKGEQRRASFAGKKPKSRKTKEQLISPQAN 600

Query: 601 SKPPIRYWNEFDNGEEAGNESFYRDTEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRF 660
           SKPPIRYWNEFDNGEEAGNESFYRDTEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRF
Sbjct: 601 SKPPIRYWNEFDNGEEAGNESFYRDTEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRF 660

Query: 661 LTLSSDEPEKRPLLTDSQHRQXXXXXXXXXXXXXXXXAERDYNRYINYTIEQEDSQSVYE 720
           LTLSSDEPEKRPLLTDSQHRQ                AERDYNRYINYTIEQEDSQSVYE
Sbjct: 661 LTLSSDEPEKRPLLTDSQHRQSINSFTTSSSLNTTSSAERDYNRYINYTIEQEDSQSVYE 720

Query: 721 FKHDQVVTFFYLSSLLVSCITSGISLGIVASLFRELNDDIVFGAGPGXXXXXXXXXXXXX 780
           FKHDQVVTFFYLSSLLVSCITSGISLGIVASLFRELNDDIVFGAGPG             
Sbjct: 721 FKHDQVVTFFYLSSLLVSCITSGISLGIVASLFRELNDDIVFGAGPGLLTVIIATLLTSL 780

Query: 781 XXXXXXXXXXFSRFKFAPWWHYVGCFLIFLVVAC 814
                     FSRFKFAPWWHYVGCFLIFLVVAC
Sbjct: 781 ILSCASLLLLFSRFKFAPWWHYVGCFLIFLVVAC 814

>YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing a
           SYG1, Pho81 and XPR1 (SPX) N-terminal domain, which may
           be involved in G protein associated signal transduction,
           has weak similarity to uncharacterized C. albicans
           Orf6.8826p [2610 bp, 869 aa]
          Length = 869

 Score =  443 bits (1140), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 298/877 (33%), Positives = 434/877 (49%), Gaps = 84/877 (9%)

Query: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60
           MKF  +I  KS+PEW+  NI+Y+ LK A+K VT +  +    S +  +  L     AF  
Sbjct: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGM--EKLLNQCSVAFDQ 58

Query: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNK--RRQLALISSHLDHCNME 118
           +F+NVN FV +KIKE STR++SVESSII   + + +  RN+   R+L +I++H+D CN E
Sbjct: 59  EFQNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFE 118

Query: 119 LLRICRFLILQKIAXXXXXXXXXXYYPYDKA---VAEKFVEQITNCPELRGDQENGLSFT 175
           L  + RFLI+Q+IA           +P D      A ++V  I N   LR   E G+SF 
Sbjct: 119 LQLLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHE-GISFM 177

Query: 176 KLDLDPYLLEVSLVVDVLQELE------------QAASGRKGSLTH-----ETMKSEMPG 218
           KLDLDPYLLEVSL+VDVL +LE            Q +  R     H     E   S +P 
Sbjct: 178 KLDLDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPA 237

Query: 219 EIEGAHSAPMASHA------DSDLAFDSIFLGKASRLQAFLVADESISQMKFLLLQLGFH 272
                 S P+ S+       DS L FD+  + KA  L  FL++ E I  +KF+LL +GF 
Sbjct: 238 ---SPRSIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFR 294

Query: 273 VVDDDMILVXXXXXXXXXXXXXXANGTSGKTPRTVKSFHDLR--LASDQNENVALPMISD 330
           ++DD +I                 N    K+ R+ KSF+DL+  L+  + +N+ LP  S 
Sbjct: 295 IIDDSII----STSKEILDTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNI-LP--SA 347

Query: 331 IRSSQQ-TEIAMLDS---KPVPSFLEDDAINRHPTIVVNGSRTCKCLVMCHVGGLRNHIV 386
           ++S+++   I++LD+   +  P  L DD IN+HP ++V+ +    C+VMCHVGGLRNH+V
Sbjct: 348 VQSNEKYVSISILDTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVV 407

Query: 387 SENV----SKKKLASVLSNKSLDXXXXXXXXXXXXPIGKLCLEWIKSHSLHQCGPKISTQ 442
           + ++     K  L+++ S                 PI K+ LEWI+SH L    PK+  +
Sbjct: 408 TNDLLLRDVKNILSAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFK 467

Query: 443 RTRFTKAVGEPNLTEYLVCVDESIVLAGSKKVPHAVVEIRSQQSGGMLHRKEGYKDELIT 502
           RTRF  A    N   YL+ +DESI +     +P  ++EI+       L +    +D    
Sbjct: 468 RTRFISA---DNGDIYLIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINEDNKFK 524

Query: 503 TLIEKMYENHISCYPLKEDQTLWKLLYQAANAEDLKSGLFSAACPSLTSFNSES------ 556
            L++ +  N   C  +  D T WK+  +  ++ +L++ LF          NS+       
Sbjct: 525 QLMKSVVTNEFQCSLIPPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDE 584

Query: 557 IFEIGESELSRMIAAKG---EQRRASFAGKKPKSRKTKEQLISPQANSKPPIRYWNEFDN 613
            F++G+  L       G     + +  +G++ +  K  +Q  S     K PIRYWNEFD 
Sbjct: 585 FFQLGKDRLEEEFDLTGPINNSQGSVDSGRRVRIHKKSKQ--SDNETKKKPIRYWNEFDE 642

Query: 614 GEEAG-NESFYRDTEA-----------MPFEGEMDNGFIVFNRNFINATYNFSESLRRFL 661
            EE   + +FY DT             +      D GFI+F+RNFIN TY+F E LR  +
Sbjct: 643 QEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNLI 702

Query: 662 TLSSDEPEKRPLLTDSQHRQXXXXXXXXXXXXXXXXAERDYN---RYINYTIEQ-EDSQS 717
               D+     L  +S+H                      Y+   RY+ Y  +  EDSQS
Sbjct: 703 --RHDKKTSPDLFQNSKHPHCSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDSQS 760

Query: 718 VYEFKHDQVVTFFYLSSLLVSCITSGISLGIVASLFR-ELNDDIVFGAGPGXXXXXXXXX 776
           +YE++HD+VVTF YLS+LL SCI + + LGIV SLFR + N++I                
Sbjct: 761 IYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRGQSNNEIDLEIQNILIAIIIISL 820

Query: 777 XXXXXXXXXXXXXXFSRFKFAPWWHYVGCFLIFLVVA 813
                         FSRF  AP WHYVGCF +F  V 
Sbjct: 821 LVSLILICACLLLLFSRFTLAPIWHYVGCFTMFFSVT 857

>KLLA0F14509g complement(1345334..1347889) weakly similar to
           sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
           start by similarity
          Length = 851

 Score =  380 bits (976), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 276/875 (31%), Positives = 427/875 (48%), Gaps = 118/875 (13%)

Query: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFK----PEKQPASSVNEDAELMWLYR 56
           MKFG+QI +KSVPEW+L+NIDY+ LK  ++  TT +    PE +P +S+ +D EL  L +
Sbjct: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRP-NSIEDDPELRSLKK 59

Query: 57  AFQTQFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCN 116
            F++QF  +N F+ MK+KE STR+VS+E+ + +L   + +    K R++ LI+ HLD CN
Sbjct: 60  LFRSQFEMINVFISMKLKECSTRIVSIENYLTQLH--LIKDENKKLRRIKLINQHLDRCN 117

Query: 117 MELLRICRFLILQKIAXXXXXXXXXXYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTK 176
           +EL ++ R+LILQKIA          +YPY   +A++F+  + NCPE +   E G+S   
Sbjct: 118 LELQKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHE-GVSMLT 176

Query: 177 LDLDPYLLEVSLVVDVLQELEQAA------SG--RKGSLTHETMKSEMPGEIEGAHSAP- 227
           +DLDPYLLE+SL+VD+L E+EQ A      SG  + G+ ++    S + G   G  +AP 
Sbjct: 177 VDLDPYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNTSNSRANSNV-GITSG--TAPS 233

Query: 228 --------MASHADSDLAFDSIFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMI 279
                    +   DS L FD  FL K + L +FL++ ES  ++KFLL+ LGF + DD +I
Sbjct: 234 SRKSSVVSSSHVIDSTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVI 293

Query: 280 LVXXXXXXXXXXXXXXANGTSGKTPRTVKSFHDLRLASDQNENVALPMISDIRSSQQTEI 339
                            +    K   ++KS    R A  Q E  A        SSQ+ + 
Sbjct: 294 --------ATSKKILSGDALLSKRKGSIKSLRMFRDA--QREEAA-------SSSQRRDT 336

Query: 340 AMLDSKPVPSFLEDDAINRH-------------------------------------PTI 362
               S PV S   D   NR                                      P +
Sbjct: 337 E--SSPPVGSPESDPGSNRSQQLSNSSSSAHNILFEPLAKPGADVTNLYNSTEENLFPNL 394

Query: 363 VVNGSRTCKCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLDXXXXXXXXXXXXPIGKL 422
           +V+   +   +++CHVGGLRNHI ++ +    + +VL+                  + + 
Sbjct: 395 LVSYPSSNDSILLCHVGGLRNHISTDTIEYTDIKAVLNG------CEPSLMPVSNRLDEF 448

Query: 423 CLEWIKSHSLHQCGPKISTQRTRF--TKAVGEPNLTEYLVCVDESIVLAGSKKVPHAVVE 480
           C +W  SH+L      I  +R+RF  + +  E N  +YL+C+D++I +    K+P AV+E
Sbjct: 449 CRDWCYSHNLKTTDLVIKCRRSRFIISHSSIETN-NDYLICIDDNIEI-NDNKLPFAVLE 506

Query: 481 IR---SQQSGGMLHRKEGYK--DELITTLIEKMYENHISCYPLKEDQTLWKLLYQAANAE 535
           ++   +  S  + ++    K  D ++  L EK+  +++S YP   + TLW++      A 
Sbjct: 507 VKILEATSSSSVPNKTYSKKHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEM------AG 560

Query: 536 DLKSGLFSAACPSLTSFNSESIFEIGESELSRMIAAKGEQRRASFAGK-----KPKSRKT 590
            +  G    AC    + N ES+ E+  +     +  K   R  S            S + 
Sbjct: 561 KIAGGSNPLACLD-GNLNFESVEEMFGA--GNALLKKTHDRYQSLLNPPTIEFSQSSSQN 617

Query: 591 KEQLISPQAN--SKPPIRYWNEFDNGEEAGNESFYRDTEAMPFEGEMDNGFIVFNRNFIN 648
               ISP      KP IRYWNEFD+GEEA ++ FY   +    E   D G I FN +FI 
Sbjct: 618 TAVNISPTVTEREKPRIRYWNEFDDGEEAMDQDFYSCLDEDDDEYTHDTGLIRFNPSFII 677

Query: 649 ATYNFSESLRRFLTLSSDEPEKRPLLTDSQHRQXXXXXXXXXXXXXXXXAERDYNRYINY 708
           A Y+     +    +  D   ++ LL D+  +                    D N++  +
Sbjct: 678 AIYHLLSKFQIAFGIIDDVQARKSLLRDAG-KSYNSIDTDTSILTSSSSERNDVNKF--W 734

Query: 709 TIEQEDSQSVYEFKHDQVVTFFYLSSLLVSCITSGISLGIVASLFRELNDDIVFGAGPGX 768
            +E+++S+S+YEF+HDQV++FFY+SSLL+SC+T+G+++GI+ SLF+ LNDD         
Sbjct: 735 ELEEQNSESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFKSLNDDTQLENETSI 794

Query: 769 XXXXXXXXXXXXXXXXXXXXXXFSRFKFAPWWHYV 803
                                 FSRF FAP WHY+
Sbjct: 795 LTMIFISLSISLILGAWSLLLMFSRFTFAPTWHYI 829

>AGR160W [4471] [Homologous to ScYDR089W - SH]
           complement(1045983..1048493) [2511 bp, 836 aa]
          Length = 836

 Score =  357 bits (915), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 254/839 (30%), Positives = 404/839 (48%), Gaps = 76/839 (9%)

Query: 14  EWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQTQFRNVNDFVGMKI 73
           EW LN +DY++L+E V+  TT+   ++      +   L  L  AF+ +  NVN FV +K+
Sbjct: 23  EWTLNGMDYEYLREEVRRATTYAGGREE----TDGRVLGRLLGAFRAELSNVNLFVSLKM 78

Query: 74  KEASTRLVSVESSIIRLQR-QMQEPHRNKRRQLALISSHLDHCNMELLRICRFLILQKIA 132
           +E + RL +VE+ I+  +R ++ EP     R L   +  L  C+ +L R+ R+L+LQK A
Sbjct: 79  REITARLETVEAGIVEWRRRKVGEPGARALR-LRRANGQLAQCSADLQRLARYLLLQKAA 137

Query: 133 XXXXXXXXXXYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLDPYLLEVSLVVDV 192
                     YYPYD+A  E FV  +  C EL+   E G+ FT +DL+PYLLEVSL++ V
Sbjct: 138 LRKLTRRLVRYYPYDEAEVEGFVAALYACDELQQGHE-GVVFTAVDLEPYLLEVSLIMGV 196

Query: 193 LQELEQAASGRKGSLTHETMKSEMPGEIEGAHSAP---MASHADSDLAFDSIFLGKASRL 249
           L +LE              MK      +E A   P   +     S L FD++FLGK   L
Sbjct: 197 LYDLE--------------MKDR---SVERAREPPNNVLGRPITSCLTFDTLFLGKYHLL 239

Query: 250 QAFLVADESISQMKFLLLQLGFHVVDDDMILVXXXXXXXXXXXXXXANGTSGKTPRTVKS 309
           Q  L++ +++ ++KFLL++L + ++DDD++                  G+          
Sbjct: 240 QRLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFD 299

Query: 310 FHDLRLASDQNENVALPMISDIRSSQQTEIAMLDSKPVPSFLEDDAINRHPTIVVNGSRT 369
           F   R A     N +LP      S  +T +  LD +    F+ D+A N+HP I V G + 
Sbjct: 300 FGAARPAR-MRRNSSLPDKLRTLSQLRTHMYPLDKQ----FMTDEAYNQHPNIFVRGQQD 354

Query: 370 CKCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLDXXXXXXXXXXXXPIGKLCLEWIKS 429
             CL+MCHVGG+RNHI+++N+    +   L+ +                + KLCL+W+++
Sbjct: 355 DACLLMCHVGGMRNHIITQNLPLPLVLECLTKRQWSHKNIPLSA-----LDKLCLDWVRT 409

Query: 430 HSLHQCGPKISTQRTR-FTK----AVGEPNLTEYLVCVDESIVLAGSKKVPHAVVEIRSQ 484
           ++L      IS +RTR FTK      G    + YL+ +DE + +  + K+PHA VE+R  
Sbjct: 410 NNLGLSDFVISVKRTRFFTKRDEVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKL 469

Query: 485 QSGGMLHRKEGYK-DELITTLIEKMYENHISCYPLKEDQTLWKLLYQAAN--AEDLKSGL 541
            +  +   K   K D  ++ LI+ + +  +SCYPL    TLWK+ Y   +  AE+++  +
Sbjct: 470 TNTVVTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEEIERSM 529

Query: 542 FSAACPS----LTSFNSESIFEIGESELSRMIAAKGEQRRASFAGKKPKSRKTKEQLISP 597
           ++A   +     ++ + + +F IG   L +M      QR  S A    KS+  +    SP
Sbjct: 530 YAALAAADFQDSSNISGDILFSIGRRRLDQMSTPTVPQRTPSLAKSSHKSQDAQ----SP 585

Query: 598 QANSKPP--IRYWNEFDNGEEA-GNESFYRDTEAM-PFEGEMDNGFIVFNRNFINATYNF 653
            ++ + P   RYWNE D   +A   + FYRD E +   + E ++GFI F++NFI   Y +
Sbjct: 586 SSSGETPQRKRYWNELDEQNDADAQDCFYRDPEELHTGDYEAEHGFIKFDKNFILNFYQY 645

Query: 654 SESLRRFLTLSSDEPEKR---PLLTDSQHRQXXXXXXXXXXXXXXXXAERDYNRYI---- 706
              L          P++    P   DS+  +                +  +    +    
Sbjct: 646 LHKLNHIFCYQKKPPKEYTVVPCSGDSEITRSELTPLIRQNSEARSYSALEVQSTLPGGG 705

Query: 707 ------NYTIEQ-----EDSQSVYEFKHDQVVTFFYLSSLLVSCITSGISLGIVASLFRE 755
                 N+  E      ++   +Y +KHD+VV+ FYL++LLVSCIT+G ++GI+ SLF  
Sbjct: 706 SQLQVPNWDDEAALVCYDELDVLYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSA 765

Query: 756 L-NDDIVFGAGPGXXXXXXXXXXXXXXXXXXXXXXXFSRFKFAPWWHYVGCFLIFLVVA 813
           L ND   F                            FSR+  APWWHY  C ++F++V 
Sbjct: 766 LGNDQTEFEGSNYITALILVSLVVSLMLSSFSLLLLFSRYHMAPWWHYSSCIIVFILVT 824

>Scas_636.12
          Length = 837

 Score =  355 bits (911), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 259/867 (29%), Positives = 413/867 (47%), Gaps = 96/867 (11%)

Query: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60
           M F S + +KSVP+W+  N++Y  LK+A+   T                 L  L   F+ 
Sbjct: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHT----------------RLETLDAMFKE 44

Query: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELL 120
           QF+N+N FV +KIKE STR++SVE+SI      +Q+  R       ++ SH++ CN EL 
Sbjct: 45  QFQNINLFVSLKIKEISTRIMSVEASI------LQQTMRKGPSNFKIVFSHVNDCNEELQ 98

Query: 121 RICRFLILQKIAXXXXXXXXXXYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLD 180
            + R+LI+QK+A           +    AV E++V ++    + +   + G+SF KLDLD
Sbjct: 99  MLSRYLIVQKLAVKKLLRRLISSHD-GSAVVEEWVTELYQSDDYQNGYQ-GVSFAKLDLD 156

Query: 181 PYLLEVSLVVDVLQELEQAASGRKGSLTHETMKSEMPGE---IEGAHSAPMASHADSDLA 237
           PYL+E+SL+VDVL +L+   +    +    T+ +    E   +    + P   +   D+ 
Sbjct: 157 PYLIEISLIVDVLNDLKLKVTTNNNNDVSSTLLTSKHNETLNLRSNENPPSIQNNGEDII 216

Query: 238 -----FDSIFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMILVXXXXXXXXXXX 292
                FD+IF+ K   L   +V++E+I + KF+LL   F +VDD   L+           
Sbjct: 217 RSAIDFDTIFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQ--LISTSKDIIVSTE 274

Query: 293 XXXANGTSGKTPRTVKSFHDLRLASDQNENVALPM----ISDIRSSQQT-EIAMLDSKP- 346
               N    K+  +++SF   + ++ Q  N A       +  +R SQ    I++LD  P 
Sbjct: 275 QNRPNLNVKKSMASIRSFQTFQSSTKQRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPT 334

Query: 347 -VPSFLEDDAINRHPTIVVNGSRTC---KCLVMCHVGGLRNHIVSENVSKKKLASVLSNK 402
            VP F++DDA N+ PT++++   T     C++MCH+GGLR+H+V+ N+  + +  VLS  
Sbjct: 335 GVPRFMKDDAFNQSPTLLIHLQDTNISPNCILMCHMGGLRDHLVTNNIPLEVINQVLSQD 394

Query: 403 SLDXXXXXXXXXXXXPIGKLCLEWIKSHSLHQCGPKISTQRTRFTKAVGEPNLTEYLVCV 462
                          PI  + LEWI +  L   G KI  +RTR   +  E     YL+ +
Sbjct: 395 V--KGSIPPSNSNFNPIDNMALEWIMNQKLRHTGMKIDIKRTRLIFSTEE---FTYLISI 449

Query: 463 DESIVLAGSKK---VPHAVVEIR--SQQSGGMLHRKE-----GYKDELITTLIEKMYENH 512
           DE I +  + +    PH++VEI+  S++S   +H           +E +  +  ++YE +
Sbjct: 450 DEKICITFNDEKFYFPHSIVEIKLLSKKSPSSMHANNINNPTKSMNEKLQHIFREVYEKN 509

Query: 513 ISCYPLKEDQTLWKLLYQA-----ANAEDLKSGLFSA--ACPSLTSFNSESIFEIGESEL 565
           I C+ L  + TLWK+ Y        N  DL   L       P   S ++E  F +G   +
Sbjct: 510 IQCFSLDRNWTLWKICYSICQLPNVNDNDLFKLLLQCDYTLPPNDSLSTEEFFALGHDGI 569

Query: 566 SRMIAA-------KGEQRRASFAGKKP------KSRKTKEQLISPQANSKPPIRYWNEFD 612
             +             Q +++ +  KP      K+ K KE+            RYWNEFD
Sbjct: 570 LELCYPPFQEEIRNKSQSQSTHSNFKPHPYNESKANKQKER----------TFRYWNEFD 619

Query: 613 NGEEA---GNESFYRDTEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRFLTLSSDEPE 669
           + + +    N+ FY+D E      + D+G + FNR FI++ ++  +S++  +     +  
Sbjct: 620 DDQASINRENQHFYQD-EDESICSQEDHGLVTFNRPFIDSMFDKFKSIKSMIIPRKRKQR 678

Query: 670 KRPLLTDSQHRQXXXXXXXXXXXXXXXXAERDYNRYINYTIEQ-EDSQSVYEFKHDQVVT 728
           K+     +                    +E D    + Y     ++S+S+YEFKHDQV+T
Sbjct: 679 KKRQQDGTSIYGSTYVLGSRSTLTLSPGSESDLEALLEYDPSNVQESESIYEFKHDQVLT 738

Query: 729 FFYLSSLLVSCITSGISLGIVASLFREL-NDD-IVFGAGPGXXXXXXXXXXXXXXXXXXX 786
            FYL+SLL+SC+TSG+ LGIV +LFRE  NDD IVF                        
Sbjct: 739 VFYLASLLISCMTSGLCLGIVLALFRESENDDVIVFDGINFLLAVIIGSLLVSLILIIVS 798

Query: 787 XXXXFSRFKFAPWWHYVGCFLIFLVVA 813
               FSRF  AP WHY+ CF+ F++V 
Sbjct: 799 LLLLFSRFTLAPLWHYISCFVFFIMVT 825

>CAGL0C03696g complement(367135..369630) similar to sp|P38966
           Saccharomyces cerevisiae YDR089w, start by similarity
          Length = 831

 Score =  336 bits (861), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 255/851 (29%), Positives = 414/851 (48%), Gaps = 72/851 (8%)

Query: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60
           MKFGSQI +KSVP+W+LNNIDY+ LK+ +K VT+ K    P S+  E  E+     +F+ 
Sbjct: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKT--APNSNDFEGLEV-----SFKQ 53

Query: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELL 120
               +N FV +K+KE S++LVS+E SI +L       +R   R++  I ++L+ CN  L 
Sbjct: 54  NIVQINLFVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQ 113

Query: 121 RICRFLILQKIAXXXXXXXXXXYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLD 180
           ++ RF+I+Q+IA          +Y  DK +A++F+  I NC ELR   E G+SF  LDL 
Sbjct: 114 KLSRFVIVQRIALRKLFKKITKHYG-DKKIAQQFISSIQNCNELRDGYE-GVSFKNLDLQ 171

Query: 181 PYLLEVSLVVDVLQELEQA--ASGRKGSLTHETMKSEMPGEIEGAHSAPMASHADSDLAF 238
            YL+EVSL++D+L ++  A  ++G    L  E  +          +  P+ S   ++  F
Sbjct: 172 SYLVEVSLIMDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFT-TNQQF 230

Query: 239 DSIFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMILVXXXXXXXXXXXXXXANG 298
           D +   K   +Q+ LV  ++  Q+KFLL+ LGF V D ++  +                 
Sbjct: 231 DQVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRDIIASEP-------N 283

Query: 299 TSGKTPRTVKSFHD------LRLASDQNENVALPMISDIRSSQQTEIAMLDSKPVPSFLE 352
           +  ++ R+ KSF++       RL +   E   L    ++  S+   + +  S  V S + 
Sbjct: 284 SEVRSLRSKKSFYESDRPALKRLHTSSTE--YLNNAEEMEQSKCKAVMLTPSGKVDSSIY 341

Query: 353 DDA-INRHPTIVV----NGSRTCKCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLDXX 407
           D   I  +P++++    N     +C+V+CHVGGLR  +V++ +   +++  L N +    
Sbjct: 342 DSKKITSYPSVLLEYEKNNVIANECIVICHVGGLRGKVVTDKLHINEISEYLKNSN---- 397

Query: 408 XXXXXXXXXXPIGKLCLEWIKSHSLHQCGPKISTQRTRFTKAVGEPNLTEYLVCVDESIV 467
                     P+ K+ L+WI  H + +CG +I  +RTR+       NL  Y++ +DE   
Sbjct: 398 ----KQAISDPLAKIALDWICDHGMKECGIEIGFKRTRYF-CNKHSNL--YMITIDEEFT 450

Query: 468 LAGS-----KKVPHAVVEIRSQQSGGMLHRKEGYKDELITTLIEKMYENHISCYPLKEDQ 522
           L+ S     K + H+++++R   +      K   K      + EK+  + I C+P + D 
Sbjct: 451 LSDSNGQTEKLMDHSIIDLRVVTTNFSSDNKSLAKKS--QEIYEKIISSKIQCFPFQPDF 508

Query: 523 TLWKLL---YQAANAEDLKSGLFSAACPSLTSFNS---ESIFEIGESELSRMIAAKGEQ- 575
              KLL   ++   ++D+   L       L   N    +  F IG   L  + +++ +  
Sbjct: 509 HPVKLLLSIHENNGSKDVIHRLMLENIYELNENNKITEDEFFGIGFDLLLDICSSEFKDN 568

Query: 576 --RRASFAGKKPKSRKTKEQLISPQANS---KPPIRYWNEFDN-GEEAGNESFY-----R 624
             ++     + P   K K  L+S   N+   KP IRYWNEFD+  EE G   FY      
Sbjct: 569 YYQKVESPTRTPNDWK-KNNLLSKNKNTENNKPAIRYWNEFDDLEEENGGGGFYIQDRTD 627

Query: 625 DTEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRFLTL-SSDEPEKRPLLTDSQHR-QX 682
           D E+   + E D GFI F+++FI +TY+  +S R FL    ++     P L D   R   
Sbjct: 628 DLESNELQQERDYGFIHFSKDFIESTYSSLQSFRDFLGFKDNNRTAIDPALLDLSERFGN 687

Query: 683 XXXXXXXXXXXXXXXAERDYNRYINYTIEQ-EDSQSVYEFKHDQVVTFFYLSSLLVSCIT 741
                          +  D  + I + +++ E+S+SVY +KHDQV++  YL +LL++C T
Sbjct: 688 SNYGSISSKGSILSNSVEDIRKLIEHQMKEIENSESVYVYKHDQVLSLMYLFALLMACAT 747

Query: 742 SGISLGIVASLFRELNDDIVFGAGPGXXXXXXXXXXXXXXXXXXXXXXXFSRFKFAPWWH 801
           SGI +GIV S+F   N DI    G                         FSR+ +AP WH
Sbjct: 748 SGICMGIVLSVFNGDNSDIEIDVGKTLIITVILSLGISLGLITLCLLLLFSRYTYAPIWH 807

Query: 802 YVGCFLIFLVV 812
           Y   F IF+++
Sbjct: 808 YALSFAIFIMI 818

>Kwal_27.12292
          Length = 217

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTT 34
          MKFG       VPEW    ++YK+LK+ +K +TT
Sbjct: 1  MKFGKTFPNHQVPEWSHEYVNYKNLKKLIKEITT 34

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 44/111 (39%), Gaps = 25/111 (22%)

Query: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFK---------------PEKQPASSV 45
           MKFG       VPEW    ++YK LK+ +K +T  +               P  +P +++
Sbjct: 1   MKFGKTFPNHQVPEWSHQYVNYKGLKKLIKQITQTQEKLHREQHDHSGETDPPARPRNTL 60

Query: 46  NEDAE----------LMWLYRAFQTQFRNVNDFVGMKIKEASTRLVSVESS 86
           N D            L   + A       V++F  M+  E + RL  + SS
Sbjct: 61  NIDENYLNDSLVKSLLASFFFALDRDIEKVDNFYNMQFLEYNRRLRRLISS 111

>AGR223W [4534] [Homologous to ScYPL110C - SH]
          complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVT-----TFKPEKQPAS 43
          MKFG       VPEW    ++YK LK+ +K +T      F+ E+  AS
Sbjct: 1  MKFGKTFPNHQVPEWAHKYVNYKGLKKQIKEITLVQDALFRQEQGAAS 48

>YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of
          the phosphate permease family of membrane transporters,
          appears to play a supporting role in phosphate uptake
          under high phosphate growth conditions [2772 bp, 923
          aa]
          Length = 923

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQ-PASSVNEDAE 50
          M+F   +   +VPEW+ + +DY  LK  + T+ T + +++ P   +N+DA+
Sbjct: 1  MRFSHFLKYNAVPEWQNHYLDYNELKNLIYTLQTDELKQETPTGDLNDDAD 51

>Scas_704.39
          Length = 916

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVK 30
          MKFG  + E  +PEW+   IDYK  K+ +K
Sbjct: 1  MKFGDHLRESIIPEWKDKYIDYKSSKKRIK 30

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPE--KQPASSVNEDAELMW 53
          MKFG  + +  +PEW    ++YK LK+ +K +T  + +  +Q  S+  E  + +W
Sbjct: 1  MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEITKVQDDLYQQENSANGEGDKPLW 55

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member
          of the glycerophosphoryl diester phosphodiesterase
          family, contains six ankyrin (Ank) repeats and a SYG1,
          Pho81 and XPR1 (SPX) N-terminal domain, has weak
          similarity to S. cerevisiae Pho81p, which is a
          cyclin-dependent kinase (CDK) inhibitor [3672 bp, 1223
          aa]
          Length = 1223

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVN 46
          MKFG       +PEW    + YK LK+ +K +T  + +   A + N
Sbjct: 1  MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQEDIYRAHNKN 46

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
          which truncation and overexpression can suppress
          lethality of Gpa1p deficiency, member of the divalent
          anion:Na+ (DASS) family of membrane transporters [2709
          bp, 902 aa]
          Length = 902

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVK 30
          MKF   + E ++PEWR   IDYK  K+ ++
Sbjct: 1  MKFADHLTESAIPEWRDKYIDYKVGKKKLR 30

>KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces
          cerevisiae YCR037c PHO87 member of the phosphate
          permease family, start by similarity
          Length = 900

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTV 32
          MKF   +   +VPEW+   IDY HLK+ + ++
Sbjct: 1  MKFSHSLKYNAVPEWQDYYIDYSHLKKLIYSL 32

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFK 36
          MKFG       VPEW    ++YK LK+ +K +   +
Sbjct: 1  MKFGKTFPNHQVPEWSHEYVNYKSLKKLIKEIVAVQ 36

>ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH]
          complement(542124..544715) [2592 bp, 863 aa]
          Length = 863

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYK 23
          MKF  ++ E S+PEWR   +DYK
Sbjct: 1  MKFAERLRESSIPEWRDKYLDYK 23

>Kwal_23.5785
          Length = 856

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKT 31
          MKF   + E +VPEW    IDYK  K+ +K+
Sbjct: 1  MKFAEHLRESAVPEWIDKYIDYKAGKKKLKS 31

>Scas_625.16
          Length = 932

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAE 50
           MKF   +   +VPEW    I Y HLK+ + ++   K     +S +  D E
Sbjct: 82  MKFSHSLQFNAVPEWSSKYIAYSHLKKLIYSLQKEKLYSSSSSHLQLDEE 131

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,459,814
Number of extensions: 923429
Number of successful extensions: 2627
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2633
Number of HSP's successfully gapped: 34
Length of query: 814
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 704
Effective length of database: 12,788,129
Effective search space: 9002842816
Effective search space used: 9002842816
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)