Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2340528026512880.0
AGR158C2672628011e-107
YDR087C (RRP1)2782657911e-106
Scas_636.102882667465e-99
CAGL0M11110g2702627281e-96
KLLA0C11979g2612617011e-92
Sklu_1568.32202116789e-90
CAGL0G04433g78652691.2
AFR075C74046671.7
CAGL0D00440g18477651.9
KLLA0E24761g44532652.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23405
         (277 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23405                                                         500   0.0  
AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH] (1043874..1...   313   e-107
YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein inv...   309   e-106
Scas_636.10                                                           291   5e-99
CAGL0M11110g complement(1095317..1096129) similar to sp|P35178 S...   285   1e-96
KLLA0C11979g complement(1027919..1028704) similar to sp|P35178 S...   274   1e-92
Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement        265   9e-90
CAGL0G04433g complement(421718..424078) similar to sp|P42946 Sac...    31   1.2  
AFR075C [3267] [Homologous to ScYJL108C (PRM10) - SH; ScYJL107C ...    30   1.7  
CAGL0D00440g complement(52244..52798) similar to sp|P34232 Sacch...    30   1.9  
KLLA0E24761g 2191359..2192696 similar to sp|P20049 Saccharomyces...    30   2.9  

>Kwal_56.23405
          Length = 280

 Score =  500 bits (1288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/265 (93%), Positives = 248/265 (93%)

Query: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60
           MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR
Sbjct: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120
           PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD
Sbjct: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120

Query: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180
           KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD
Sbjct: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180

Query: 181 EWEKLILHNGXXXXXXXXXXXXXXXXXAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240
           EWEKLILHNG                 AKLQEECARIAETPLAQFVEIFEDLASNINNIK
Sbjct: 181 EWEKLILHNGEDEDEEDDEKTNQEDEEAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240

Query: 241 SLRDKIKEDIFKDERLKKWGVLETQ 265
           SLRDKIKEDIFKDERLKKWGVLETQ
Sbjct: 241 SLRDKIKEDIFKDERLKKWGVLETQ 265

>AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH]
           (1043874..1044677) [804 bp, 267 aa]
          Length = 267

 Score =  313 bits (801), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 193/262 (73%), Gaps = 17/262 (6%)

Query: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60
           +++S FV+QLASN+R+VRE+AL+SL+ YL ++Q ++  Q  FD+LWKGLY+AMWFSDRPR
Sbjct: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63

Query: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120
           PQQRLA  LGEL +L+ D        G+  L DRAF++FSKAFW+V+CLEWY IDHHRLD
Sbjct: 64  PQQRLAAQLGELSLLFLD--------GDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLD 115

Query: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180
           KYLLLVRRVL +QLR+L+ R WD  +V  Y+  VL+ LPLSG  KVYNGIPFHIIDIFVD
Sbjct: 116 KYLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVD 175

Query: 181 EWEKLILHNGXXXXXXXXXXXXXXXXXAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240
           EWE+L+L +G                  +L E+   IA TPL +FV +F+ LA+NI NIK
Sbjct: 176 EWERLVLRDG---------RDAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIK 226

Query: 241 SLRDKIKEDIFKDERLKKWGVL 262
            LR+KIK+D+  D+RL  WGVL
Sbjct: 227 ILREKIKQDLLADQRLYDWGVL 248

>YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein
           involved in maturation of 25S rRNA [837 bp, 278 aa]
          Length = 278

 Score =  309 bits (791), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 190/265 (71%), Gaps = 8/265 (3%)

Query: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60
           ME+S FVKQL+SN R  R  AL++LKKYLT KQFKENKQ  F+KLWKGLYYAMWFSDRPR
Sbjct: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60

Query: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120
           PQQRLAN LGELH LYFD  DN  ++ ELT ND+AF+KFS+ FW+V+C EW+ ID +RLD
Sbjct: 61  PQQRLANELGELHGLYFDPKDNSTAD-ELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLD 119

Query: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180
           KYLLL+RRVL  QL+YLQ R WD+++V  YI+ VLR LPLSG  KVY GIP HI+DI +D
Sbjct: 120 KYLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLD 179

Query: 181 EWEKLILHNGXXXXXXXXXXXXXXXXXAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240
           EWE+L+                      ++++      +TPLA  + IF+D+ ++ NN K
Sbjct: 180 EWERLL-------KDGDEDDEDEENKEEEMRKIAESAKKTPLADVIAIFQDIVADYNNSK 232

Query: 241 SLRDKIKEDIFKDERLKKWGVLETQ 265
            LR+KIKED+F D RL  W +LE +
Sbjct: 233 VLREKIKEDLFSDTRLVSWDILEGE 257

>Scas_636.10
          Length = 288

 Score =  291 bits (746), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 143/266 (53%), Positives = 187/266 (70%), Gaps = 10/266 (3%)

Query: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60
           M++S FVKQL+SN R VRE++L++L+K+L +K+    KQ+ F+KLWKGLY+AMWFSDRPR
Sbjct: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60

Query: 61  PQQRLANSLGELHVLYFDKADNQKSNGE--LTLNDRAFLKFSKAFWRVICLEWYGIDHHR 118
           PQQRLAN LG+L+ LYF++ DN+    E  L+ ND+AF+KFSKAFW+++CLEWY ID  R
Sbjct: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120

Query: 119 LDKYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIF 178
           +DKYLLL RRV  +QL+YLQ R W+ ++V  Y + VL  LPLSGD KVY+GIPFHIIDI 
Sbjct: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180

Query: 179 VDEWEKLILHNGXXXXXXXXXXXXXXXXXAKLQEECARIAETPLAQFVEIFEDLASNINN 238
           +DEWE+L+                     A        + ETPL  F++IF  L SN+NN
Sbjct: 181 LDEWERLLTDKDDEHDDEEKETDEVDIVIA--------VKETPLNNFIKIFYGLVSNVNN 232

Query: 239 IKSLRDKIKEDIFKDERLKKWGVLET 264
            K LR KIKED+  D RL +WG++E 
Sbjct: 233 SKILRTKIKEDLLADPRLIEWGIIEN 258

>CAGL0M11110g complement(1095317..1096129) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs, start
           by similarity
          Length = 270

 Score =  285 bits (728), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 189/262 (72%), Gaps = 12/262 (4%)

Query: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60
           ME+S FVKQLASN R VRE+AL++L++++ + QFK++KQ  FDKLWKGLYYAMWF DRPR
Sbjct: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60

Query: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120
           PQQRLA++LG LHV +FD+ D+     ELT+ND+AF++FSKAFWR++CLEW GID  RLD
Sbjct: 61  PQQRLASTLGALHVRFFDERDSGAE--ELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLD 118

Query: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180
           KYLLL+RR L +Q +YLQ+R+W   +V+ Y+  VL  +PLSGD KVYNGIP H++DI +D
Sbjct: 119 KYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMLD 178

Query: 181 EWEKLILHNGXXXXXXXXXXXXXXXXXAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240
           EWE+L                       ++ +E   ++ +PL Q ++I  +L  N +N K
Sbjct: 179 EWERL--------ALEDEEEELEEDKKLEIMKEF--VSGSPLDQVLDILRNLLKNYDNSK 228

Query: 241 SLRDKIKEDIFKDERLKKWGVL 262
            LRDKIK+++  D+RL +WG++
Sbjct: 229 ILRDKIKKEVLTDKRLAQWGIV 250

>KLLA0C11979g complement(1027919..1028704) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs
           singleton, start by similarity
          Length = 261

 Score =  274 bits (701), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 138/261 (52%), Positives = 183/261 (70%), Gaps = 20/261 (7%)

Query: 4   SAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPRPQQ 63
           +  VKQLA + +  RE+A +SL+KYLTT+ F+  KQ+ FDKLWKGLYY+MW  D+P PQQ
Sbjct: 3   NTLVKQLAGHRKETREQAFESLRKYLTTRNFQNAKQSQFDKLWKGLYYSMWHCDKPIPQQ 62

Query: 64  RLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLDKYL 123
            LA SLGELH+LY  K  NQ+          AF++FSKAFW+VIC+EWY IDHHRLDK+L
Sbjct: 63  SLAYSLGELHLLYL-KGKNQQ----------AFIRFSKAFWKVICIEWYRIDHHRLDKFL 111

Query: 124 LLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVDEWE 183
           LL+RR L  Q++YL   EW++ +V +YI  VL+K+PLSGD+KVYNGIPFHIIDI +DEW 
Sbjct: 112 LLIRRCLHFQIKYLHECEWEQALVDDYINKVLKKIPLSGDRKVYNGIPFHIIDILLDEWV 171

Query: 184 KLILHNGXXXXXXXXXXXXXXXXXAKLQEECARIAETPLAQFVEIFEDLASNINNIKSLR 243
           K+                       K +E    +++TPL+ F+ IF++L+S+ NNIK LR
Sbjct: 172 KVC---------YGEEEDEEDNEDDKEEEIKEAVSKTPLSDFISIFQELSSDTNNIKILR 222

Query: 244 DKIKEDIFKDERLKKWGVLET 264
           DKIKED+ KD+RL+ W VL++
Sbjct: 223 DKIKEDLLKDQRLRAWDVLQS 243

>Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement
          Length = 220

 Score =  265 bits (678), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 161/211 (76%), Gaps = 13/211 (6%)

Query: 53  MWFSDRPRPQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWY 112
           MWFSDRPRPQ RL N LGELH+L+F   +N++   E+TL D+AF+KF+  FW+VICLEWY
Sbjct: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQ---EITLVDKAFIKFTNGFWKVICLEWY 57

Query: 113 GIDHHRLDKYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPF 172
            IDHHRLDKY+LLVRRVL +QL+YL+LR W+EE+V  YI +VL+KLPLSGDKKVYNGIPF
Sbjct: 58  SIDHHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPF 117

Query: 173 HIIDIFVDEWEKLILHNGXXXXXXXXXXXXXXXXXAKLQEECAR-IAETPLAQFVEIFED 231
           HIIDIFVDEWEKL++ +                   K  EEC + IA TPL+ FVEIF+D
Sbjct: 118 HIIDIFVDEWEKLVIRD---------GEDEGEDGEEKDSEECKQLIAATPLSLFVEIFQD 168

Query: 232 LASNINNIKSLRDKIKEDIFKDERLKKWGVL 262
           L+SNI NIK LR+KIKEDI  D+RL  WG+L
Sbjct: 169 LSSNIENIKVLREKIKEDILGDQRLHLWGIL 199

>CAGL0G04433g complement(421718..424078) similar to sp|P42946
           Saccharomyces cerevisiae YJL108c PRM10, hypothetical
           start
          Length = 786

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 88  ELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLDKYLLLVRRVLAHQLRYLQL 139
           EL    R  L+  KA      L  YG   HRL++Y+++  RVL    +YL L
Sbjct: 355 ELLQRQRFILRMCKA------LMLYGAPTHRLEEYMIMTSRVLEIDGQYLYL 400

>AFR075C [3267] [Homologous to ScYJL108C (PRM10) - SH; ScYJL107C -
           SH] (561522..563744) [2223 bp, 740 aa]
          Length = 740

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 94  RAFLKFSKAFWRVICLEWYGIDHHRLDKYLLLVRRVLAHQLRYLQL 139
           R  L+  KAF        YG   HRL++Y+++  RVL    ++L L
Sbjct: 315 RFILRLCKAFM------MYGAPTHRLEEYMVMTSRVLEIDSQFLYL 354

>CAGL0D00440g complement(52244..52798) similar to sp|P34232
           Saccharomyces cerevisiae YKL186c MTR2 mRNA transport
           protein, start by similarity
          Length = 184

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 13/77 (16%)

Query: 116 HHRLDKYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAV--LRKLPLSG--DKKVYNGIP 171
           +H +D   + V++VLAH      L E D   + N+++     + +P S    K VYN +P
Sbjct: 11  YHLID---IFVKKVLAH------LDEQDPNKLMNFLQLFQSSKNMPPSPTVSKVVYNSMP 61

Query: 172 FHIIDIFVDEWEKLILH 188
           F    IF+  W + ++ 
Sbjct: 62  FADPSIFLTMWSQQVVQ 78

>KLLA0E24761g 2191359..2192696 similar to sp|P20049 Saccharomyces
           cerevisiae YBR166c TYR1 prephenate dehydrogenase (NADP+)
           singleton, start by similarity
          Length = 445

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 82  NQKSNGELTLNDRAFL---KFSKAFWRVICLE 110
           ++K+ G + L D   L   +FSKA WRVIC +
Sbjct: 13  HEKTIGIIGLGDMGLLYATRFSKAGWRVICCD 44

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,351,113
Number of extensions: 345866
Number of successful extensions: 1078
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1065
Number of HSP's successfully gapped: 16
Length of query: 277
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 177
Effective length of database: 13,134,309
Effective search space: 2324772693
Effective search space used: 2324772693
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)