Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2339053352624900.0
KLLA0C11913g52952316840.0
Scas_576.0d48948115970.0
CAGL0I08613g55950815770.0
AGR155C49540910931e-144
Kwal_55.221736591201032e-04
CAGL0K03157g724172910.007
YHL016C (DUR3)735176900.009
KLLA0F28083g698106840.036
ABR043W686194830.059
KLLA0C17468g723110820.070
Kwal_14.803693103790.15
Scas_709.61738178692.5
KLLA0F02750g1148101674.6
Kwal_26.8136721169649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23390
         (526 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23390                                                         963   0.0  
KLLA0C11913g complement(1024233..1025822) similar to ca|CA4263|I...   653   0.0  
Scas_576.0d                                                           619   0.0  
CAGL0I08613g complement(839912..841591) weakly similar to sp|P33...   612   0.0  
AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp...   425   e-144
Kwal_55.22173                                                          44   2e-04
CAGL0K03157g 290552..292726 highly similar to sp|P33413 Saccharo...    40   0.007
YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permeas...    39   0.009
KLLA0F28083g complement(2594274..2596370) similar to ca|CA5245|C...    37   0.036
ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH] complement(4...    37   0.059
KLLA0C17468g complement(1532768..1534939) similar to sp|P33413 S...    36   0.070
Kwal_14.803                                                            35   0.15 
Scas_709.61                                                            31   2.5  
KLLA0F02750g complement(250368..253814) some similarities with s...    30   4.6  
Kwal_26.8136                                                           29   9.6  

>Kwal_56.23390
          Length = 533

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/526 (91%), Positives = 483/526 (91%)

Query: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60
           MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV
Sbjct: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60

Query: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120
           GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV
Sbjct: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120

Query: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180
           GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF
Sbjct: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180

Query: 181 LTDTMQXXXXXXXXXXXACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240
           LTDTMQ           ACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF
Sbjct: 181 LTDTMQVSVVFVILVIVACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240

Query: 241 FLSGFWLRTFAARTDKDLLIGCSXXXXXXXXXXXXXXXTGFLAVWAGLVEVADQELGGSS 300
           FLSGFWLRTFAARTDKDLLIGCS               TGFLAVWAGLVEVADQELGGSS
Sbjct: 241 FLSGFWLRTFAARTDKDLLIGCSLAFAVLVAIVALIGVTGFLAVWAGLVEVADQELGGSS 300

Query: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRXXXXXX 360
           FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVR      
Sbjct: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRGLVALI 360

Query: 361 XXXXXXXXXXXEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFLSAWEIVGGGLGGIFAVW 420
                      EDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFLSAWEIVGGGLGGIFAVW
Sbjct: 361 MVPVVVVGLIAEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFLSAWEIVGGGLGGIFAVW 420

Query: 421 IFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILALR 480
           IFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILALR
Sbjct: 421 IFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILALR 480

Query: 481 TAVVYLRCRSKGLEFDMYKKPPAAELQDEDTGYDSATVNKTYTDRT 526
           TAVVYLRCRSKGLEFDMYKKPPAAELQDEDTGYDSATVNKTYTDRT
Sbjct: 481 TAVVYLRCRSKGLEFDMYKKPPAAELQDEDTGYDSATVNKTYTDRT 526

>KLLA0C11913g complement(1024233..1025822) similar to
           ca|CA4263|IPF2277 Candida albicans unknown function,
           start by similarity
          Length = 529

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/523 (63%), Positives = 396/523 (75%), Gaps = 14/523 (2%)

Query: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWK--KDAKTFLSANGTQKGVPLAFNFVASAL 58
           MG +S  AAHGI+WP Y V+L+ A  +A+WK     KTFLSANGTQ+GVPLAFNFVASAL
Sbjct: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60

Query: 59  GVGVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYG 118
           G GV S YPQIANI GL GLLVY+LAG LPMF+FAFFGPIIRKK P GFVLTEWV  R+G
Sbjct: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120

Query: 119 VVGGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHI 178
           ++ G YLSACTI+T+FLFMVSELASLK+ IESLT IKALPV+IVECV+TTIYT++GGFHI
Sbjct: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180

Query: 179 SFLTDTMQXXXXXXXXXXXACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTN 238
           SF+TDT+Q           +CAMG+Y+ ID S I  SGLLK + LGWQLVYIL VAIFTN
Sbjct: 181 SFITDTIQVSIVFILLIIVSCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240

Query: 239 DFFLSGFWLRTFAARTDKDLLIGCSXXXXXXXXXXXXXXXTGFLAVWAGLVEVADQELGG 298
           DFF+SGFWLRTFAARTDKDL+IGCS               TG +AVWAG + VADQE  G
Sbjct: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300

Query: 299 SSFFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRXXXX 358
           ++FFI+LT MP WV+GFVLAF+ +LSTCTLDSLQSA+VSTISND+FRNKLP+I++R    
Sbjct: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRGIVV 360

Query: 359 XXXXXXXXXXXXXEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFLSAWEIVGGGLGGIFA 418
                        +DVL+I+LIVDLLSS+VVP+LMLGL S+  FL+AWEI+GGG GG+ +
Sbjct: 361 LIMVPVVVVGLIADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLS 420

Query: 419 VWIFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILA 478
           VWIFGTVYYDSPREGG+LLL+ NGL        Y +DW+AFGAFVVAPFGG++ GF +L 
Sbjct: 421 VWIFGTVYYDSPREGGKLLLIWNGL--------YADDWAAFGAFVVAPFGGLIFGFFVLF 472

Query: 479 LRTAVVYLRCRSKGLEFDMYKKP----PAAELQDEDTGYDSAT 517
           +RT +VY+ C+     FD+Y K        E+Q   T  D  +
Sbjct: 473 VRTIIVYIDCKKNNKPFDLYSKKFIYRHEGEVQSTTTDGDKKS 515

>Scas_576.0d
          Length = 489

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/481 (65%), Positives = 383/481 (79%), Gaps = 9/481 (1%)

Query: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60
           MG LS   A+ IIWP Y VLL++A A+AYWK+D+K+FLS+NGTQK +PLAFNFVAS LG 
Sbjct: 12  MGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFVASGLGC 71

Query: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120
           GV S YPQIANI GLHGLLVYA++GGLPMF+FA+ GP+IRKK P GFVLTEWVFHR+G++
Sbjct: 72  GVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLI 131

Query: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180
            G YLSACTILT++LF+VSE+ASLK+CIE++T+IKALPV+I+ECV+TTIYT++GGF+ISF
Sbjct: 132 CGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISF 191

Query: 181 LTDTMQXXXXXXXXXXXACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240
           +TD +Q           ACAMG+YIEID S IGPSGLLKQNKLGWQLVYIL  AIFTNDF
Sbjct: 192 ITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDF 251

Query: 241 FLSGFWLRTFAARTDKDLLIGCSXXXXXXXXXXXXXXXTGFLAVWAGLVEVADQELGGSS 300
           F+SGFWLRTFA+R+DKDL+IGCS               TGF+AVWAGLV+VAD+E  G++
Sbjct: 252 FMSGFWLRTFASRSDKDLMIGCSVACVILVVFCTVVGVTGFIAVWAGLVQVADEENSGAA 311

Query: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRXXXXXX 360
           FFILL  +P+WVMGF + F+T+LSTCTLDSLQSA+VSTISND+FRN+L +++VR      
Sbjct: 312 FFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWVRGIVVLI 371

Query: 361 XXXXXXXXXXXEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFL-SAWEIVGGGLGGIFAV 419
                      E+VL+I+LIVDLLSS+VVPVL+LG WS+   L +AWE++GGGLGGI +V
Sbjct: 372 MVPVVVVGLIAENVLNIYLIVDLLSSSVVPVLVLGFWSKFDDLWTAWEVIGGGLGGILSV 431

Query: 420 WIFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILAL 479
           WIFGTVYY S REGGRLLL+SNGL        Y +DWS FGAFVVAP GG++    IL +
Sbjct: 432 WIFGTVYYHSAREGGRLLLISNGL--------YVDDWSTFGAFVVAPGGGLVFSGFILVI 483

Query: 480 R 480
           R
Sbjct: 484 R 484

>CAGL0I08613g complement(839912..841591) weakly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3, hypothetical
           start
          Length = 559

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/508 (62%), Positives = 385/508 (75%), Gaps = 20/508 (3%)

Query: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60
           MGHLS+PAAH IIWP YGVLL+TA  VAYWK+D+KTFLSANGTQK +PLAFNFVAS LG 
Sbjct: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60

Query: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120
           GV STYPQIAN+ GLHGLLVYALAGGLPMF+FAF GP+IRKK P GFVLTEWVFHR+G++
Sbjct: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120

Query: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180
            G YLSACTILT++LF+VSE+ASLK+ I++LT+I +LPV+I+ECV+TTIYT++GGFHISF
Sbjct: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180

Query: 181 LTDTMQXXXXXXXXXXXACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240
           +TD++Q           A AMG+ I ID   IGPSGLLK NKLGWQLVYIL VAIFTNDF
Sbjct: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240

Query: 241 FLSGFWLRTFAARTDKDLLIGCSXXXXXXXXXXXXXXXTGFLAVWAGLVEVADQELGGSS 300
           F+SGFWLRTFA+R++KDLLIGCS               TGF+AVWAGL+   DQE  G++
Sbjct: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSGAA 300

Query: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRXXXXXX 360
           F++LL  +PSW++GF L F+ +LSTCTLDSLQSA+VSTISND+FRNKL ++ VR      
Sbjct: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVVAI 360

Query: 361 XXXXXXXXXXXEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFL-SAWEIVGGGLGGIFAV 419
                      +DVLSI+LIVDLLSS+VVPVL++GLW +L  + SAWE++GGG  GI  V
Sbjct: 361 MVPVVVVGLIAQDVLSIYLIVDLLSSSVVPVLVVGLWGKLDEIWSAWEVIGGGCAGILGV 420

Query: 420 WIFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILAL 479
           WIFGTVYY S +EGGRLLL+SNGL        Y +DW AFGAFVVAP  G++   +ILA+
Sbjct: 421 WIFGTVYYHSAKEGGRLLLISNGL--------YADDWGAFGAFVVAPGAGLVCSVIILAI 472

Query: 480 RTAVVYLRCRSKGLEFDMYKKPPAAELQ 507
           R +++ L           YKK P     
Sbjct: 473 RLSLMKL-----------YKKNPEGRFH 489

>AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp,
           495 aa]
          Length = 495

 Score =  425 bits (1093), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 236/409 (57%), Positives = 299/409 (73%), Gaps = 2/409 (0%)

Query: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60
           MG LS  AA+ I+WP Y V+L  A  +AY  ++ +TFLSANGTQK VPLA NF+AS LG 
Sbjct: 62  MGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLGC 121

Query: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120
           GV   YPQ+AN++GL GLLVY L   LPM++FAFFGP+I++  P GFVLTEWV  R+G V
Sbjct: 122 GVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRV 181

Query: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180
             LYLSACTILTL+LFMVSE+ SL+  +++L++IK +PVV+V+CV+TTIYT +GGFHISF
Sbjct: 182 AALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPVVVVQCVVTTIYTAIGGFHISF 241

Query: 181 LTDTMQXXXXXXXXXXXACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240
           +TD++Q           A A+G  ++ID ++IGPSGLL+ ++LGWQLVYIL VAIFTNDF
Sbjct: 242 VTDSLQATVVLLLVVVGAVAVGTSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTNDF 301

Query: 241 FLSGFWLRTFAARTDKDLLIGCSXXXXXXXXXXXXXXXTGFLAVWAGLVEVADQELGGSS 300
           F+SGFWLRTFAAR+++DLL+GCS               TG LAVWAG   VAD  L  +S
Sbjct: 302 FMSGFWLRTFAARSNRDLLLGCSLAAVLLAVVLLLVGVTGLLAVWAGYAPVAD--LDSAS 359

Query: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRXXXXXX 360
           FF+LL A+P+W  G VLA + +LSTCTLDS QSA+VSTISNDLFRN+LP +Y R      
Sbjct: 360 FFLLLAALPAWANGVVLALVVVLSTCTLDSFQSALVSTISNDLFRNRLPPLYARAAVAVV 419

Query: 361 XXXXXXXXXXXEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFLSAWEIV 409
                       D+L+I+LIVDLLS+AVVPV++LG W R   LSAWE++
Sbjct: 420 MVPVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELI 468

>Kwal_55.22173
          Length = 659

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 12/120 (10%)

Query: 70  ANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVVGG-LYLSAC 128
           A + G+ G  +YA+ G + + LFAF    I+++ P    ++E ++ R+G  G  +YL  C
Sbjct: 79  AYLHGISGAWLYAVGGTIQITLFAFLALQIKQRAPSAHTVSEMLYVRFGKSGHIMYLCYC 138

Query: 129 T-----ILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISFLTD 183
                 + +L L   S+  +    + ++ +   LP+ +V      +YT +GG   +F++D
Sbjct: 139 AATNVMVSSLLLLGGSQAFAAATGMHTVAASFLLPLNVV------VYTALGGLKATFISD 192

>CAGL0K03157g 290552..292726 highly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c Urea active
           transporter, start by similarity
          Length = 724

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 70/172 (40%), Gaps = 11/172 (6%)

Query: 18  GVLLLTACAVAYWKK--DAKTFLSANGTQKGVPLAFNFVASALGVGVFSTYPQIANISGL 75
           G++L T     Y K+   A+ F +A  T K   +A   V+S +      T      + G+
Sbjct: 27  GMILTTYMLRRYQKEIITAEEFTTAGRTVKTGLVAAAVVSSWIWCSTLLTSAS-KQLDGM 85

Query: 76  HGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVVGG----LYLSACTIL 131
            G   Y+      +  FA      ++K P+     E V  RYG +G      Y  A  IL
Sbjct: 86  LGGYSYSAGACFQIVAFAILAIKTKQKAPNAHTYLELVRKRYGKIGHCCYLFYAFATNIL 145

Query: 132 TLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISFLTD 183
              + + S  A      ES+T + ++    +  V   IYT  GG   +FLTD
Sbjct: 146 VTAMLLTSGAA----VFESMTGMNSVASCFLLPVGVVIYTLFGGIKATFLTD 193

>YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permease,
           member of the solute:sodium symporter (SSS) family of
           membrane transporters [2208 bp, 735 aa]
          Length = 735

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 71/176 (40%), Gaps = 11/176 (6%)

Query: 18  GVLLLTACAVAYWKKD---AKTFLSANGTQKGVPLAFNFVASALGVGVFSTYPQIANISG 74
           G+++LT   +  ++K+   A+ F +A  + K   +A   V+S +      T        G
Sbjct: 26  GMMVLTTYLLKRYQKEIITAEEFTTAGRSVKTGLVAAAVVSSWIWCSTLLTSSTKEYADG 85

Query: 75  LHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVVG-GLYL---SACTI 130
           + G   YA      +  FA      ++  P+     E V  RYG +G G YL    A  I
Sbjct: 86  IFGGYAYAAGACFQIIAFAILAIKTKQMAPNAHTYLELVRTRYGKIGHGCYLFYAIATNI 145

Query: 131 LTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISFLTDTMQ 186
           L   + + S  A        LT +  +    +  V   +YT  GG   +FLTD M 
Sbjct: 146 LVTSMLLTSGSA----VFSDLTGMNTIASCFLLPVGVVVYTLFGGIKATFLTDYMH 197

>KLLA0F28083g complement(2594274..2596370) similar to
           ca|CA5245|CaDUR32 Candida albicans Urea transport
           protein (by homology), start by similarity
          Length = 698

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 19/106 (17%)

Query: 91  LFAFFGPIIRKKVPHGFVLTEWVFHRYGVVGGLYLSACTILTLFLFMVSELASLKFCIES 150
           L A  G   +KK+P+G    E V  RYG        +  IL +F+ +V+ L S    I  
Sbjct: 107 LMALLGIQAKKKIPNGHTCLEIVELRYG-------KSAHILYMFMCLVNNLLSSSSMI-- 157

Query: 151 LTSIKALPVVI--VECVITTI--------YTTVGGFHISFLTDTMQ 186
           L S  A+ ++   +  V +T+        YT VGG   +FLTD M 
Sbjct: 158 LGSAAAISIISGNLHIVASTMLIPFGVMCYTVVGGLKATFLTDYMH 203

>ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH]
           complement(474297..476357) [2061 bp, 686 aa]
          Length = 686

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 75/194 (38%), Gaps = 11/194 (5%)

Query: 1   MGHLSVPAAHGIIWPMY---------GVLLLTACAVAYWKK--DAKTFLSANGTQKGVPL 49
           M HL+ P + G+ + +          G+++ T     Y ++   A+ F +A  T K   +
Sbjct: 1   MDHLNPPLSQGVGYAIVVGLGAVFAIGMVMTTYIFERYQREVITAEEFATARRTVKTGLI 60

Query: 50  AFNFVASALGVGVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVL 109
           A   V+S      +     +A   G+ G   YA    + + LF+      +++ P+    
Sbjct: 61  ASAVVSSWTWQPRYCQSTTMAYKVGVSGPFYYAAGACVQIILFSTLAIKCKQRAPNAHTF 120

Query: 110 TEWVFHRYGVVGGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTI 169
            E +  RYG    +      ++T  L     L      +  LT +       +  V   I
Sbjct: 121 LEIIKARYGRKAHILHMCYALVTNVLVTTMLLTGGSAVVSELTGMHTAAACFLLPVGVII 180

Query: 170 YTTVGGFHISFLTD 183
           YT  GG   +FLTD
Sbjct: 181 YTLFGGIKATFLTD 194

>KLLA0C17468g complement(1532768..1534939) similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3 urea transport
           protein singleton, start by similarity
          Length = 723

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 43/110 (39%)

Query: 74  GLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVVGGLYLSACTILTL 133
           G+ G   YA   G  + LF+      +++ P+     E +  RYG +G        + T 
Sbjct: 85  GISGGYFYAAGAGYQVILFSALAIKCKQRAPNAHTYLEIIKARYGTIGHFCYMFYALATN 144

Query: 134 FLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISFLTD 183
            L     L      +  LT +  +    +  V   +YT  GG   +FLTD
Sbjct: 145 VLVTAMLLTGGSAVVSDLTGMHTVAACFLLPVGVVLYTIFGGIKATFLTD 194

>Kwal_14.803
          Length = 693

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 47/103 (45%), Gaps = 19/103 (18%)

Query: 91  LFAFFGPIIRKKVPHGFVLTEWVFHRYGVVGGLYLSACTILTLFLFMVSELASLKFCIES 150
           + A  G   +KK+P G    E V  RYG        +  IL +FL +V+ L S    I  
Sbjct: 107 VMALLGIHAKKKIPKGHTCLEIVHLRYG-------KSTHILYMFLCLVNNLLSTSAMI-- 157

Query: 151 LTSIKALPVVI--VECVITTI--------YTTVGGFHISFLTD 183
           L +  A+ ++   +  V +T+        YT VGG   +FLTD
Sbjct: 158 LAAAGAISIICGDLHIVASTMLIPFGVMAYTVVGGLKATFLTD 200

>Scas_709.61
          Length = 738

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 71/178 (39%), Gaps = 14/178 (7%)

Query: 17  YGVLLLTACAVAYWKK--DAKTFLSANGTQKGVPLAFNFVASALGVGVFSTYPQIANISG 74
           +G++L+T     Y K+   A+ F +A  T K   +A   V+S +      T        G
Sbjct: 26  FGMVLITYMLRRYQKEIITAEEFTTAGRTVKTGLVAAAVVSSWIWASTLLTSVSKQYTGG 85

Query: 75  LHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVVGGL----YLSACTI 130
           + G   Y+      +  FA      ++K P+     E V  RYG  G L    Y  A  I
Sbjct: 86  MFGGYSYSAGACFQIIAFAIIAIKTKQKAPNAHTYLEIVKARYGTPGHLTFLFYALATNI 145

Query: 131 LTLFLFMVSELASLKFC--IESLTSIKALPVVIVECVITTIYTTVGGFHISFLTDTMQ 186
           L   + + S  A       +  + S   LPV +V      +YT  GG   +FLTD + 
Sbjct: 146 LVTAMLLTSGSAVFSDITGMSPIASCFLLPVGVV------VYTLFGGIKATFLTDYLH 197

>KLLA0F02750g complement(250368..253814) some similarities with
           sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
           transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 320 ITILSTCTLDSLQSAMVSTISNDL--FRNKLPLIYVRXXXXXXXXXXXXXXXXXEDVLSI 377
           + + S  T D +  A ++ I +DL  + N +PL Y+R                    ++ 
Sbjct: 760 VDVTSVMTFDEI-VAKINEIKDDLITYSNNIPL-YLRLDNQRTFLARIYHELAESQKIAN 817

Query: 378 FLIVDLLSSAV-----VPVLMLGLWSRLFFLSAWEIVGGGL 413
           F ++ +L + +        ++L  ++R FF   W+IVGGGL
Sbjct: 818 FKLMSVLMTEINIKRETLFIILANFTRAFFDDNWDIVGGGL 858

>Kwal_26.8136
          Length = 721

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 61/169 (36%), Gaps = 2/169 (1%)

Query: 17  YGVLLLTACAVAYWKK--DAKTFLSANGTQKGVPLAFNFVASALGVGVFSTYPQIANISG 74
           +G++L T     Y K+   A+ F +A  T K   +A   V+S            +    G
Sbjct: 26  FGMILTTYMLRRYQKEIITAEEFATAGRTVKTGLIAAAVVSSWTWAATLLESTSMVYKVG 85

Query: 75  LHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVVGGLYLSACTILTLF 134
           + G   Y       +  FA      +++ P+     E +  RYG    +      + T  
Sbjct: 86  ISGGYYYGAGACFQIIAFATLAIKAKQRAPNAHTFLEIINARYGKAAHICYMFYALATNI 145

Query: 135 LFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISFLTD 183
           L     L      +  LT +  +    +  +   IYT  GG   +FLTD
Sbjct: 146 LVTAMLLTGGSAVVNDLTGMDTVAACFLLPLGVIIYTLFGGIKATFLTD 194

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.142    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,773,717
Number of extensions: 556200
Number of successful extensions: 1481
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1483
Number of HSP's successfully gapped: 21
Length of query: 526
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 420
Effective length of database: 12,926,601
Effective search space: 5429172420
Effective search space used: 5429172420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)