Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2338065564628230.0
AGR154C6282132175e-18
KLLA0C11891g6171992042e-16
YDR085C (AFR1)6202182042e-16
YER158C5732301561e-10
Scas_636.8d4331591362e-08
Scas_459.1*648281184e-06
CAGL0I08591g51760997e-04
Kwal_26.7070131554721.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23380
         (646 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23380                                                        1092   0.0  
AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -...    88   5e-18
KLLA0C11891g complement(1021360..1023213) some similarities with...    83   2e-16
YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein inv...    83   2e-16
YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein...    65   1e-10
Scas_636.8d                                                            57   2e-08
Scas_459.1*                                                            50   4e-06
CAGL0I08591g complement(837496..839049) some similarities with s...    43   7e-04
Kwal_26.7070                                                           32   1.7  

>Kwal_56.23380
          Length = 655

 Score = 1092 bits (2823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/646 (85%), Positives = 552/646 (85%)

Query: 1   MSSLYSASRDDLSVTSFGSSVMELDSNAGLDPRARSTSDLFEVPASRMRPKPYKRSSSAR 60
           MSSLYSASRDDLSVTSFGSSVMELDSNAGLDPRARSTSDLFEVPASRMRPKPYKRSSSAR
Sbjct: 1   MSSLYSASRDDLSVTSFGSSVMELDSNAGLDPRARSTSDLFEVPASRMRPKPYKRSSSAR 60

Query: 61  HVFSSPQPNNSLSLIPEQQQVPTHLLHSLTPYQKQRRRMKNSFQFPNGESFTPRQKSVAA 120
           HVFSSPQPNNSLSLIPEQQQVPTHLLHSLTPYQKQRRRMKNSFQFPNGESFTPRQKSVAA
Sbjct: 61  HVFSSPQPNNSLSLIPEQQQVPTHLLHSLTPYQKQRRRMKNSFQFPNGESFTPRQKSVAA 120

Query: 121 FAGPTHRLSGPSGTRSNGPGARDMFNSCPSTPKPASGRSDSLARSFSNMPPPLSHRPPAS 180
           FAGPTHRLSGPSGTRSNGPGARDMFNSCPSTPKPASGRSDSLARSFSNMPPPLSHRPPAS
Sbjct: 121 FAGPTHRLSGPSGTRSNGPGARDMFNSCPSTPKPASGRSDSLARSFSNMPPPLSHRPPAS 180

Query: 181 RIQKSSSMSRLPYVGLAPKPSSVDPYVMAAKKEHSASFHSIPNRFDCEPNSHTSSRTQVV 240
           RIQKSSSMSRLPYVGLAPKPSSVDPYVMAAKKEHSASFHSIPNRFDCEPNSHTSSRTQVV
Sbjct: 181 RIQKSSSMSRLPYVGLAPKPSSVDPYVMAAKKEHSASFHSIPNRFDCEPNSHTSSRTQVV 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGPVKVNITPFNIAKPALLQHDNMKPLT 300
                                           KGPVKVNITPFNIAKPALLQHDNMKPLT
Sbjct: 241 SSNNSDTNSSSSLRSHNVASSNTSTDASDSVSKGPVKVNITPFNIAKPALLQHDNMKPLT 300

Query: 301 KINHPGSTKISSGQIKSKIQPSARVQPQPQTIGTKSATPTSQDSKGVKRSTSSRIGSFFR 360
           KINHPGSTKISSGQIKSKIQPSARVQPQPQTIGTKSATPTSQDSKGVKRSTSSRIGSFFR
Sbjct: 301 KINHPGSTKISSGQIKSKIQPSARVQPQPQTIGTKSATPTSQDSKGVKRSTSSRIGSFFR 360

Query: 361 KLLPSKRXXXXXXXXXXXXXXXXXXXXXKIXXXXXXXXXXXXXMLPPSPTKSTSGDQXXX 420
           KLLPSKR                     KI             MLPPSPTKSTSGDQ   
Sbjct: 361 KLLPSKRKKPVPQTPAPQVAPPPSKAVQKISSDNTANATSTTDMLPPSPTKSTSGDQFFD 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXSLLLKNDHATLKPLRLPLSEKDSTAKDERPESQAL 480
                                    SLLLKNDHATLKPLRLPLSEKDSTAKDERPESQAL
Sbjct: 421 DIEDHENEDDDDDDDQLLDIDLVFDSLLLKNDHATLKPLRLPLSEKDSTAKDERPESQAL 480

Query: 481 DQHSGTTDEGVIDQDLIREFSRLGSFITDGITHQQTASVPPPRSQKRPRLSNKESVVGFY 540
           DQHSGTTDEGVIDQDLIREFSRLGSFITDGITHQQTASVPPPRSQKRPRLSNKESVVGFY
Sbjct: 481 DQHSGTTDEGVIDQDLIREFSRLGSFITDGITHQQTASVPPPRSQKRPRLSNKESVVGFY 540

Query: 541 RHQASQNHLALDPDERLAHSLQRDWESVYYDAVVATSTDVTAGKKLRFSTAVYVKDTYAA 600
           RHQASQNHLALDPDERLAHSLQRDWESVYYDAVVATSTDVTAGKKLRFSTAVYVKDTYAA
Sbjct: 541 RHQASQNHLALDPDERLAHSLQRDWESVYYDAVVATSTDVTAGKKLRFSTAVYVKDTYAA 600

Query: 601 AEYERSDKKFIRTRRRMMQTKNMAYIEAVTSQLNQFKKGEMKVHGA 646
           AEYERSDKKFIRTRRRMMQTKNMAYIEAVTSQLNQFKKGEMKVHGA
Sbjct: 601 AEYERSDKKFIRTRRRMMQTKNMAYIEAVTSQLNQFKKGEMKVHGA 646

>AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -
           SH] (1038731..1040617) [1887 bp, 628 aa]
          Length = 628

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 97/213 (45%), Gaps = 65/213 (30%)

Query: 492 IDQDLIREFSRLGSFITDGITHQQTAS-----------VPPPRSQKRPRLSNKESVVGFY 540
           +D +LI EFS+LG +I  G   Q+  +            PPPRS +RP     +    FY
Sbjct: 410 LDYELIHEFSKLGEYIRTGTEGQELGATLLSLSSFSNLTPPPRSNRRPVFRQPDVSQSFY 469

Query: 541 RHQASQNHLALDPD-----------------ERLAHSLQRDWESVYYDAV---------- 573
                 +++ L PD                 +R+  +LQ+ W+ V+ +            
Sbjct: 470 -----HSNMTLSPDFAKGIRANDKLSAFQYKDRILSNLQQHWKVVHVNETMPRQSSPSKS 524

Query: 574 ---------------------VATSTDVTAGKKLRFSTAVYVKDTYAAAEYERSDKKFIR 612
                                + ++  V + K++ FS  +YV DTY+  +Y RSDK+F+R
Sbjct: 525 IISSQPSLEFANSSSSRSSSPLDSAKSVKSTKRIEFSDVIYVNDTYSHWDYRRSDKRFLR 584

Query: 613 TRRRMMQTKN-MAYIEAVTSQLNQFKKGEMKVH 644
            R+++M + + + +++AV  +LN++K+ EM VH
Sbjct: 585 ERKQLMTSAHGLPFVQAVKWELNEYKRHEMMVH 617

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 44/83 (53%), Gaps = 16/83 (19%)

Query: 32  PRARSTSDLFEVPASRMRPKPYKRSSSARHVFSSPQPNNSLSLIPEQQQVPTHLLHSLTP 91
           PR++ST DLF +P   +  +  +R     H  SS         + E+ + PT        
Sbjct: 21  PRSQSTGDLFLIP--ELDQERERRRRQGAHSMSSVS-------LQERARAPT-------A 64

Query: 92  YQKQRRRMKNSFQFPNGESFTPR 114
           YQ+ R +MK SFQFPNGESFTPR
Sbjct: 65  YQRLRTQMKQSFQFPNGESFTPR 87

>KLLA0C11891g complement(1021360..1023213) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c singleton,
           hypothetical start
          Length = 617

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 94/199 (47%), Gaps = 39/199 (19%)

Query: 473 ERPESQALDQHSGTTDEG---VIDQDLIREFSRLGSFITDGITHQQTASV---------- 519
           E P    L+      D+G   ++D DL+       S +     HQQ + +          
Sbjct: 420 EPPSLLDLETEDDIEDDGFKDLMDIDLV-----FDSLLLKSEQHQQNSDIALINQFNEST 474

Query: 520 --------PPPRSQKRPRLSNKESVVGFYRHQASQNHLALDPDERLAHSLQRDWESVYYD 571
                   PP RS KRP L         + H   Q   +    +R+   L ++W++V+++
Sbjct: 475 RISPPTVEPPLRSSKRPLLVKDYQGRLIHHHNNGQTTHS----DRIIEHLHQNWKAVHFN 530

Query: 572 AVVAT------STDVTAGKKLRFSTAVYVKDTYAAAEYERSDKKFIRTRRRMMQTKNMAY 625
           AVV +      S+   + KK RF+  +YV DT++  EY RSDK F  +R+++ +++   Y
Sbjct: 531 AVVPSVVRSNDSSSPVSAKKCRFNEEIYVNDTFSPTEYLRSDKAFPESRKQLSKSR---Y 587

Query: 626 IEAVTSQLNQFKKGEMKVH 644
           I+ +  +LN+FKK EM VH
Sbjct: 588 IDGIKMELNEFKKREMLVH 606

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 56/89 (62%), Gaps = 9/89 (10%)

Query: 30  LDPRARSTSDLFEVPA-SRMRPKPYKRSSSARHVFSSPQ-PNNSLSLIPEQQQVPTHLLH 87
           L PR+ STSDLF  P+ S  + + ++ S +   +  S   PN  L+LIPE +    H  H
Sbjct: 24  LLPRSTSTSDLFAFPSYSHSQKRLFQNSENGVELSKSVSIPN--LALIPEHK---AH--H 76

Query: 88  SLTPYQKQRRRMKNSFQFPNGESFTPRQK 116
            LTPYQ QR  MK SFQFPNGESFTPR++
Sbjct: 77  RLTPYQIQRSHMKQSFQFPNGESFTPRRQ 105

>YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein
           involved in morphogenesis of the mating projection
           (shmoo) [1863 bp, 620 aa]
          Length = 620

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 104/218 (47%), Gaps = 29/218 (13%)

Query: 450 KNDHATLKPLRLPLSEK-DSTAKDERPESQALDQHSGTTDEGVIDQDLIREFSRLGSFIT 508
           +ND   L+  +L + +K   T+ ++  +    D      +EG+ID+ +I EFS+LG +I 
Sbjct: 398 ENDKYDLRRRQLEIRQKLHETSHNDDGKVSFRDTEKHNVNEGLIDKTIIEEFSKLGEYII 457

Query: 509 DGITHQQTASVPPPRSQKRPRLSNKESVVGFYRHQASQNH-------LALDPDERLAHSL 561
           D      T + PPPRS KRP L + ES   FY               L +     + + L
Sbjct: 458 D------TRNQPPPRSSKRPSLDDNESARYFYNISTDLRQSLSGPISLPMHVGNDMVNRL 511

Query: 562 QRDWESVYYD----AVVATSTDVTA------GKKLRFSTAVYVKDTYAAAEYERSDKKFI 611
           + DWE + ++    ++  +S D          K +RF+  V +  T+++  YER++ +FI
Sbjct: 512 RNDWEYIRFEDRRNSLPDSSFDKVETPPKPIKKDVRFAKEVCLASTWSSNAYERANPEFI 571

Query: 612 RTRRRMMQTKNM-----AYIEAVTSQLNQFKKGEMKVH 644
             R R++    +     + +  +  +LN +KK EM VH
Sbjct: 572 MNRHRLLWMMKVHPSMNSAMNEIKLELNSYKKNEMVVH 609

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 69  NNSLSLIPEQQ--QVPTHLLHSLTPYQKQRRRMKNSFQFPNGESFTPR 114
           NN    + + Q  Q    +   LTPYQ QR +MK SFQFPNGE + P+
Sbjct: 105 NNDQDYVSQYQKPQYTFGVYKELTPYQLQRSKMKRSFQFPNGEIYKPK 152

>YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein of
           unknown function [1722 bp, 573 aa]
          Length = 573

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 91/230 (39%), Gaps = 85/230 (36%)

Query: 491 VIDQDLIREFSRLGSFITDGITHQQTASVPPPRSQKRPRLSNKESVVGFYRHQASQNHLA 550
           + D  +++E + LG        + +   +PPPRS  RP LS+K +   +Y  Q S N   
Sbjct: 342 IKDSGIVQELTALGD-------NNRIPVLPPPRSPNRPTLSDKRTTKLYYCSQDSSNE-D 393

Query: 551 LDPDER---LAHSLQRDWESVYYDAV---------VATSTDV------------------ 580
           + P+E+       LQ +W +VY + +         ++T+TD                   
Sbjct: 394 IAPEEKSTVFLKRLQDEWSTVYLNKLPLTASVPSSLSTTTDAANSSFINSSISSPAPSSS 453

Query: 581 ------------------------------TAGKKLRFSTAVYVKDTYAAAEYERSDKKF 610
                                          A K LRF+  +YV DT++AA+Y R D  F
Sbjct: 454 SSSSLVSRGPMQSISSSPTPAPSSGSSKSKNAVKSLRFADEIYVNDTWSAADYCRCDNTF 513

Query: 611 IR----------------TRRRMMQTKNMAYIEAVTSQLNQFKKGEMKVH 644
           +                     +  TKN++ IE +  ++N+FK+ EM+VH
Sbjct: 514 LNNFFKGKSQDITNPSTFVGNNLSSTKNISNIE-IKMEVNEFKRKEMRVH 562

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 27/94 (28%)

Query: 36  STSDLFEVPASRMRPKPYKRSSSARHVFSSPQPNNSLSLIPEQQQVPTHLLHS------- 88
           +TSD    P  R RP P +R              +SL  IPE+     + L S       
Sbjct: 125 TTSDHNAHPQYRCRPNPSRR--------------HSLMTIPEKYSGSRYSLRSSPPTYSN 170

Query: 89  ------LTPYQKQRRRMKNSFQFPNGESFTPRQK 116
                 LTP+Q QR++MK++FQFPNGE+FTPR +
Sbjct: 171 PRVRKELTPFQLQRKQMKSAFQFPNGENFTPRNQ 204

>Scas_636.8d
          Length = 433

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 22/159 (13%)

Query: 492 IDQDLIREFSRLGSFITDGITHQQTASVPPPRSQKRPRLSNKESVVGFYRHQASQNHLAL 551
           +D DLI EF  L   IT       + S+  P  +   R    +  +    H  ++  L  
Sbjct: 280 VDTDLIEEFDDLAYLIT-------SPSILTPPPRSERRPRGMDKTISRRYHHHNRPLLV- 331

Query: 552 DPDERLAHSLQRDWESVYY----DAVVATSTDVTAGKKLRFSTAVYVKDTYAAAEYERSD 607
                    L+ +WE+V+     D      +D    K +RF T +YV DT++  EYER  
Sbjct: 332 --------RLKEEWETVHIGESPDTRKTNKSDAATPKTVRFDTDIYVDDTWSPLEYERHG 383

Query: 608 KKFIRTRRRMMQT--KNMAYIEAVTSQLNQFKKGEMKVH 644
               R  + M++   ++  +I+ +  ++N FK  EM+VH
Sbjct: 384 TTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEMQVH 422

>Scas_459.1*
          Length = 648

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%)

Query: 89  LTPYQKQRRRMKNSFQFPNGESFTPRQK 116
           LTPYQ Q+++MK SFQFPNGESFTPR +
Sbjct: 259 LTPYQLQKKQMKASFQFPNGESFTPRNQ 286

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 66/174 (37%), Gaps = 49/174 (28%)

Query: 520 PPPRSQKRPRLSNKESVVGFYR--------------HQASQNHLALDPD----ERLAHSL 561
           PP RS  RP L N E+   FY                 +  N+L +       E+    L
Sbjct: 464 PPVRSPNRPALENNETAKLFYHSLDGSLSSTTMTDTESSKPNNLEVSDTLMIPEKTLKRL 523

Query: 562 QRDWESVYYD---------------------------AVVATSTDVTAGKKLRFSTAVYV 594
            +DWE V  +                              + ++  TA K LRF+  + +
Sbjct: 524 YQDWEKVTINKPKIKILTSTSVNSSTSSTSLPSSLNTGYSSATSSSTASKSLRFAKEITI 583

Query: 595 KDTYAAAEYERSDKKFIRTRR----RMMQTKNMAYIEAVTSQLNQFKKGEMKVH 644
            +TY+  EY R+D     T+      ++  K   +I  +  ++NQ+K+ EM VH
Sbjct: 584 SETYSPFEYLRADPDTSTTKSLYGDNLVYLKGHGFINEIKFEINQYKRNEMSVH 637

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 8  SRDDLSVTS-FGSSVMELDSNAGLDPRARSTSDLFEVPASRMRPKPYKRSSSARHVFSSP 66
          SRD   + S + S+    +  +GL PR+ STSDLFE+P   + P  +K   S +H+ ++ 
Sbjct: 10 SRDSGELDSIYSSNSTTYNRRSGLIPRSNSTSDLFEIPDGALAPIRHK--VSIQHLHTTN 67

Query: 67 QPNNS 71
            NN+
Sbjct: 68 NINNT 72

>CAGL0I08591g complement(837496..839049) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c, hypothetical
           start
          Length = 517

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 10/60 (16%)

Query: 61  HVFSSPQPNNSLSLIPEQQQVPTHLLHSLTPYQKQRRRMKNSFQFPNGESFTPRQKSVAA 120
           HV+ +PQ  +  ++     + PT     ++ YQ Q+++MK+SF+F NGE FTPR++  AA
Sbjct: 196 HVYRAPQVEDRRAV-----ETPT-----VSAYQLQKQKMKHSFKFENGEVFTPRRELQAA 245

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 31/84 (36%)

Query: 581 TAGKKLRFSTAVYVKDTYAAAEYERSDKKFIRTRRRMMQTKNMAYIEA------------ 628
           T  KKLRFS  V + DT+A   YERS+  F+             +IE             
Sbjct: 434 TMNKKLRFSNEVLLTDTWAPEVYERSNDSFLDN-----------FIEVGGSTSSGNDSSA 482

Query: 629 --------VTSQLNQFKKGEMKVH 644
                   +  ++N+FKK EM VH
Sbjct: 483 NTTTQKPEIKQEINEFKKNEMVVH 506

>Kwal_26.7070
          Length = 1315

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%)

Query: 56  SSSARHVFSSPQPNNSLSLIPEQQQVPTHLLHSLTPYQKQRRRMKNSFQFPNGE 109
           ++S  + F   +PN+   LI +  Q   + L ++  +   R+RM   F+ PNGE
Sbjct: 661 AASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGE 714

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.126    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,959,209
Number of extensions: 723981
Number of successful extensions: 2562
Number of sequences better than 10.0: 69
Number of HSP's gapped: 2520
Number of HSP's successfully gapped: 84
Length of query: 646
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 538
Effective length of database: 12,857,365
Effective search space: 6917262370
Effective search space used: 6917262370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)