Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2337919519310161e-143
YDR084C1991976912e-93
CAGL0K09988g1961936503e-87
Scas_636.82011976288e-84
Sklu_501.11951946261e-83
AGR153C2011995975e-79
KLLA0C11869g1951945741e-75
CAGL0D01078g90629633.2
CAGL0I00880g73687616.1
Kwal_33.1449350472606.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23379
         (193 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23379                                                         395   e-143
YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein ...   270   2e-93
CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces c...   254   3e-87
Scas_636.8                                                            246   8e-84
Sklu_501.1 YDR084C, Contig c501 280-867                               245   1e-83
AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)...   234   5e-79
KLLA0C11869g complement(1020415..1021002) similar to sp|P38962 S...   225   1e-75
CAGL0D01078g complement(125834..128554) highly similar to sp|P40...    29   3.2  
CAGL0I00880g 64400..66610 weakly similar to sp|P30620 Saccharomy...    28   6.1  
Kwal_33.14493                                                          28   6.3  

>Kwal_56.23379
          Length = 195

 Score =  395 bits (1016), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/193 (100%), Positives = 193/193 (100%)

Query: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60
           MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL
Sbjct: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60

Query: 61  TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEYAPGPPINPVDSKLFWWSLYVSPALWV 120
           TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEYAPGPPINPVDSKLFWWSLYVSPALWV
Sbjct: 61  TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEYAPGPPINPVDSKLFWWSLYVSPALWV 120

Query: 121 IFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTETWFQLPNIATFE 180
           IFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTETWFQLPNIATFE
Sbjct: 121 IFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTETWFQLPNIATFE 180

Query: 181 NLGRFATVQNFFR 193
           NLGRFATVQNFFR
Sbjct: 181 NLGRFATVQNFFR 193

>YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spbc2a9.05cp [600 bp, 199 aa]
          Length = 199

 Score =  270 bits (691), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 126/197 (63%), Positives = 156/197 (79%), Gaps = 4/197 (2%)

Query: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60
           MD A+NFY TILKSSHPL+LS H+AGKA P+V Y+IGS FL+FT  FITV+LLL+ DFYL
Sbjct: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60

Query: 61  TKNINGRKLVQLRWWYDSSS-SKDSPLTFESYKEYAPGPPINPVDSKLFWWSLYVSPALW 119
           TKNI GRKLVQLRWWYDS+  +KDS  TFESYK+YAPGPPIN +DSKLFWWS+YV+P +W
Sbjct: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW 120

Query: 120 VIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSS---KTETWFQLPNI 176
            +F +LCL + K  YLIL+ +A+CLT WN +GFR CD+W+P +  S    T  WF LP++
Sbjct: 121 GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV 180

Query: 177 ATFENLGRFATVQNFFR 193
             FENL R A +Q+FF+
Sbjct: 181 PGFENLSRLANIQSFFQ 197

>CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces
           cerevisiae YDR084c, start by similarity
          Length = 196

 Score =  254 bits (650), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 113/193 (58%), Positives = 149/193 (77%), Gaps = 1/193 (0%)

Query: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60
           MDH +NFY TIL+SSHPL+++ H+AGKA PL  Y+ G  F SFTA FIT++LLLA DFY 
Sbjct: 1   MDHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYF 60

Query: 61  TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEYAPGPPINPVDSKLFWWSLYVSPALWV 120
           TKNI+GR+LVQLRWWYDSS++     TFES+K+Y  GPPINP+DSKLFWWS+Y++PA+W 
Sbjct: 61  TKNISGRRLVQLRWWYDSSATSTETFTFESHKQYTAGPPINPIDSKLFWWSMYLTPAIWF 120

Query: 121 IFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTETWFQLPNIATFE 180
           + G+L + + K +  ILI +A C+TGWN +GFR CD+W+P  NS  TE +FQLP+I   +
Sbjct: 121 VLGILAILRLKLITFILIAVATCMTGWNTYGFRCCDRWNP-NNSQSTEPFFQLPSIPGLD 179

Query: 181 NLGRFATVQNFFR 193
           N+ R A  Q+FF+
Sbjct: 180 NITRLARFQSFFQ 192

>Scas_636.8
          Length = 201

 Score =  246 bits (628), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 153/197 (77%), Gaps = 4/197 (2%)

Query: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60
           M+H  NFY TILKSSHP++L LH+AGKA P+V Y+IGS FL FTA FI V+LLLA DFYL
Sbjct: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60

Query: 61  TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEYAP--GPPINPVDSKLFWWSLYVSPAL 118
           TKNI+GRKLVQLRWWYDS++       FESYK+Y P  GPPINP+DS+LFWWS+Y +P +
Sbjct: 61  TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV 120

Query: 119 WVIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSK--TETWFQLPNI 176
           W +FG+LC+ + K  YL+L+ +AV LTGWN +GFR CDKWDP A ++   TE+WFQLP+I
Sbjct: 121 WAVFGILCILRLKLFYLVLVVVAVFLTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI 180

Query: 177 ATFENLGRFATVQNFFR 193
              +NL R A  Q+FF+
Sbjct: 181 PGLDNLQRMARFQSFFQ 197

>Sklu_501.1 YDR084C, Contig c501 280-867
          Length = 195

 Score =  245 bits (626), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 153/194 (78%), Gaps = 2/194 (1%)

Query: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFL-SFTAHFITVLLLLAVDFY 59
           MD  KNFY+TILKSSHPL+LSLH+ GKA P++ YL+GSWF+ SF A FI V+LLLA DFY
Sbjct: 1   MDQIKNFYETILKSSHPLILSLHLLGKAAPILSYLLGSWFIHSFAALFILVILLLAADFY 60

Query: 60  LTKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEYAPGPPINPVDSKLFWWSLYVSPALW 119
           LTKNI+GRKLVQLRWWYDS     +P TFESYK+Y  G PINP+DSKLFWWS+Y++P +W
Sbjct: 61  LTKNISGRKLVQLRWWYDSMGQAKTPFTFESYKQYPAGNPINPIDSKLFWWSIYLTPVVW 120

Query: 120 VIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTETWFQLPNIATF 179
            IFG+LC+ + +FLYL+L+ +A+ L GWN HGFRSCDKW+P  +S    +W  LPN+++ 
Sbjct: 121 AIFGILCILKFQFLYLLLVVLALGLNGWNAHGFRSCDKWEPGQDSG-NNSWIXLPNLSSL 179

Query: 180 ENLGRFATVQNFFR 193
           ENL R A   +FF+
Sbjct: 180 ENLSRIARFXSFFQ 193

>AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)
           [606 bp, 201 aa]
          Length = 201

 Score =  234 bits (597), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 148/199 (74%), Gaps = 6/199 (3%)

Query: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHF-ITVLLLLAVDFY 59
           MD  +NFY TI+KSSHPLVLSLH+AGKA P+  YL+G WF+S+T+HF I  +LLLAVDFY
Sbjct: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60

Query: 60  LTKNINGRKLVQLRWWYDSSSSKD--SPLTFESYKEYA--PGPPINPVDSKLFWWSLYVS 115
           LTKNI+GRKLV LRWW++++ + +  SP  FESYK+Y    GP +NP+DSKLFW S Y +
Sbjct: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120

Query: 116 PALWVIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTET-WFQLP 174
           PALW +FG+LC+ + +F+ L L+  A  LTG+N +GFRSCD+W+P   SS+T + W Q+P
Sbjct: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180

Query: 175 NIATFENLGRFATVQNFFR 193
                EN+ R  T Q FFR
Sbjct: 181 TFTNVENIQRLFTFQTFFR 199

>KLLA0C11869g complement(1020415..1021002) similar to sp|P38962
           Saccharomyces cerevisiae YDR084c singleton, start by
           similarity
          Length = 195

 Score =  225 bits (574), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 137/194 (70%), Gaps = 4/194 (2%)

Query: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60
           MD A+NFY+TIL SSHPL+L++H+ GKA P+V YL+GSWFLS T  FI V+L LA DFY 
Sbjct: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60

Query: 61  TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEY--APGPPINPVDSKLFWWSLYVSPAL 118
           TKNINGRKL+Q RWWYD S    +   FES+KEY      PINP+DSKLFW SLYV+P +
Sbjct: 61  TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI 120

Query: 119 WVIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTETWFQLPNIAT 178
           WV+FG LCL + +F+YLIL+  A  L  WN + +R CD+W+P   +      FQLP + +
Sbjct: 121 WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEA--PLFQLPMLPS 178

Query: 179 FENLGRFATVQNFF 192
           F NL R   +Q+FF
Sbjct: 179 FANLDRVTRLQSFF 192

>CAGL0D01078g complement(125834..128554) highly similar to sp|P40482
           Saccharomyces cerevisiae YIL109c SEC24, start by
           similarity
          Length = 906

 Score = 28.9 bits (63), Expect = 3.2,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 66  GRKLVQLRWWYDSSSSKDSPLTFESYKEY 94
           GR+L  LR W  S+  +D  L  ESY+E+
Sbjct: 868 GRELQPLRMWATSNLVEDKVLGTESYREF 896

>CAGL0I00880g 64400..66610 weakly similar to sp|P30620 Saccharomyces
           cerevisiae YMR137c PSO2 DNA repair protein, start by
           similarity
          Length = 736

 Score = 28.1 bits (61), Expect = 6.1,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 7/87 (8%)

Query: 6   NFYQTILKSS-----HPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60
           NF Q+          H + L   I  K+   ++YL+G++ +      I +   L    Y+
Sbjct: 480 NFRQSFFGDKQKSIFHFMSLPSSIDKKSEIPMLYLVGTYSIGKEKLAIKIAETLNTKIYV 539

Query: 61  TKNINGRKLVQLRW--WYDSSSSKDSP 85
             N   RK+V + W   +D+S   D P
Sbjct: 540 QSNSIKRKMVSIYWDQCFDNSLLTDDP 566

>Kwal_33.14493
          Length = 504

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 19/72 (26%)

Query: 100 INPVDSKLFWWSLYV---------SPALWV----------IFGLLCLFQAKFLYLILIGM 140
           + P DSKLF+  +Y+         SP  WV          +F +   FQ  F  L ++  
Sbjct: 327 MEPEDSKLFFAVIYLAPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFILNE 386

Query: 141 AVCLTGWNLHGF 152
            V L G   HGF
Sbjct: 387 RVALLGHWKHGF 398

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.470 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,543,105
Number of extensions: 269579
Number of successful extensions: 891
Number of sequences better than 10.0: 14
Number of HSP's gapped: 878
Number of HSP's successfully gapped: 14
Length of query: 193
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 97
Effective length of database: 13,272,781
Effective search space: 1287459757
Effective search space used: 1287459757
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 58 (26.9 bits)