Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2308747647025300.0
KLLA0F18678g50447313330.0
AGR024C47747112571e-170
YDR036C (EHD3)50046412071e-162
Scas_661.2652346511851e-159
CAGL0K11968g49545911581e-155
Scas_706.211304128850.027
Scas_526.2304169830.029
CAGL0K10296g24838740.33
Kwal_47.1700438566750.33
Kwal_56.23316278111730.49
KLLA0B05016g886105740.52
YGR277C30587673.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23087
         (470 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23087                                                         979   0.0  
KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces...   518   0.0  
AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978) [...   488   e-170
YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of t...   469   e-162
Scas_661.26                                                           461   e-159
CAGL0K11968g complement(1153196..1154683) similar to sp|P28817 S...   450   e-155
Scas_706.21                                                            37   0.027
Scas_526.2                                                             37   0.029
CAGL0K10296g complement(1002739..1003485) similar to sp|P41734 S...    33   0.33 
Kwal_47.17004                                                          33   0.33 
Kwal_56.23316                                                          33   0.49 
KLLA0B05016g 454717..457377 gi|1709486|sp|P54788|ORC1_KLULA Kluy...    33   0.52 
YGR277C (YGR277C) [2222] chr7 complement(1045649..1046566) Membe...    30   3.3  

>Kwal_56.23087
          Length = 476

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/470 (100%), Positives = 470/470 (100%)

Query: 1   MLRSSIRCHQVRRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSD 60
           MLRSSIRCHQVRRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSD
Sbjct: 1   MLRSSIRCHQVRRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSD 60

Query: 61  VNNIVIIKSSNAPRSLCAGGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV 120
           VNNIVIIKSSNAPRSLCAGGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV
Sbjct: 61  VNNIVIIKSSNAPRSLCAGGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV 120

Query: 121 LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQL 180
           LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQL
Sbjct: 121 LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQL 180

Query: 181 ALYLCLTGDLLSGVDVYMAGLASHYVPSHNLEDLQARLGELPVTNSEEMWKITGDALEEF 240
           ALYLCLTGDLLSGVDVYMAGLASHYVPSHNLEDLQARLGELPVTNSEEMWKITGDALEEF
Sbjct: 181 ALYLCLTGDLLSGVDVYMAGLASHYVPSHNLEDLQARLGELPVTNSEEMWKITGDALEEF 240

Query: 241 SVAIPEDYNFKYSNAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQK 300
           SVAIPEDYNFKYSNAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQK
Sbjct: 241 SVAIPEDYNFKYSNAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQK 300

Query: 301 LASKSPVSLQVAIEQFHRNSQSDIESALKQDLVTASNMCEDTVSEFSQATKHKLVDKSKA 360
           LASKSPVSLQVAIEQFHRNSQSDIESALKQDLVTASNMCEDTVSEFSQATKHKLVDKSKA
Sbjct: 301 LASKSPVSLQVAIEQFHRNSQSDIESALKQDLVTASNMCEDTVSEFSQATKHKLVDKSKA 360

Query: 361 PFQWTKTALTVEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDYITG 420
           PFQWTKTALTVEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDYITG
Sbjct: 361 PFQWTKTALTVEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDYITG 420

Query: 421 NDNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSVGDAG 470
           NDNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSVGDAG
Sbjct: 421 NDNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSVGDAG 470

>KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces
           cerevisiae YDR036c singleton, start by similarity
          Length = 504

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/473 (53%), Positives = 335/473 (70%), Gaps = 11/473 (2%)

Query: 1   MLRSSIRCHQVRRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSD 60
           +L++ +  +Q+R  MSE VKF     +RVVTL RP+KLNAL  +MC  I+PTLQEYAKS 
Sbjct: 17  VLKTRLAVNQLR-FMSE-VKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKST 74

Query: 61  VNNIVIIKSSNAPRSLCAGGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV 120
           VNN+VI+ SS +PR+ C+GGDVA VA     G  D + EFF  EYSLNL LAT NKPV+ 
Sbjct: 75  VNNVVILNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVIS 134

Query: 121 LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQL 180
           +MDGITMGGGVGL+TH+PFRIATENTRW MPEMDIGFFPDVG TFS+PK+TTVGG  GQL
Sbjct: 135 IMDGITMGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQL 194

Query: 181 ALYLCLTGDLLSGVDVYMAGLASHYVPSHNLEDLQARLGELPVTNS--------EEMWKI 232
           A YLC+TGD+L+G D Y+AG+ASHYVP   + +LQARL EL +T +        +E++ +
Sbjct: 195 AQYLCMTGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDEIFDV 254

Query: 233 TGDALEEFSVAIPEDYNFKYSNAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKE 292
              A+EEF+  +P DY FKY+  +LNVIE CF   N LK I + L++++   + S   +E
Sbjct: 255 VNHAIEEFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLDEVIAGKTVSQTAQE 314

Query: 293 FSRVTLQKLASKSPVSLQVAIEQFHRNSQSDIESALKQDLVTASNMCED-TVSEFSQATK 351
           F+  T Q LASKSPVSL++A E F RNS +DI++AL QDL+TA+ M E   + EF++AT 
Sbjct: 315 FAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKMSESPDLCEFAEATS 374

Query: 352 HKLVDKSKAPFQWTKTALTVEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTE 411
           HKL++K+K P+QW    L + ++S L+S  ++  VSL +  + +T+ +YP+HS++ LP E
Sbjct: 375 HKLLEKNKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNE 434

Query: 412 QNLKDYITGNDNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKC 464
             ++ YITG DN GR  A    E +K+F Q NP++K KTG+ YL   I  RKC
Sbjct: 435 TLVEKYITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRKC 487

>AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978)
           [1434 bp, 477 aa]
          Length = 477

 Score =  488 bits (1257), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 329/471 (69%), Gaps = 5/471 (1%)

Query: 1   MLRSSIRCHQVRRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSD 60
           M+RS++R    RR MS  VKF +   +RVVTL RPEKLNA++ ++C  I+P +QEYAKSD
Sbjct: 1   MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSD 60

Query: 61  VNNIVIIKSSNAPRSLCAGGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV 120
           V N+++  S+ APR+ CAGGD+  +A       L+   +FFQ EY++N +LATY KPVV 
Sbjct: 61  VANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVA 120

Query: 121 LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQL 180
           LMDGITMGGGVGL  HVPFR+ATENT+W MPE+DIG  PDVG +F+LP+I T+GG +GQL
Sbjct: 121 LMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTLGGQEGQL 180

Query: 181 ALYLCLTGDLLSGVDVYMAGLASHYVPSHNLEDLQARLGELPVT-NSEEMWKITGDALEE 239
             YLCLTG++L G DVYMAGLASHYV S     L+ RLG +P+T  ++E +  T   +EE
Sbjct: 181 GYYLCLTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITRKADETFANTNAVIEE 240

Query: 240 FSVAIPEDYNFKYSNAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQ 299
           FS  +P+ Y FKY+  +L+VIE  F  +   K +R  LE   +S++ S   + F++ TL+
Sbjct: 241 FSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATLE 300

Query: 300 KLASKSPVSLQVAIEQFHRNSQSDIESALKQDLVTASNMCEDT-VSEFSQATKHKLVDKS 358
           KL++KS VS ++  EQF RNSQ DI+SA+KQDL+T++N+  +  ++EF  A  HKLV+K+
Sbjct: 301 KLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEKA 360

Query: 359 KAPFQWTKTALTVEELSRLVSPRAATSVS-LQKFPDSLTWKKYPYHSQFMLPTEQNLKDY 417
           K P++W  T+ +V ++S+L++   A  +  L+ F   +T+K Y YH++F LPTE  ++ Y
Sbjct: 361 KTPYEWKNTSPSVADISKLLAADPANPIDLLETF--GVTFKNYRYHNKFTLPTEAAVQAY 418

Query: 418 ITGNDNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSVGD 468
           ITG D SGRS+A   AE +KYF+++NP S+GK G  Y+ + I  RKC + +
Sbjct: 419 ITGTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMDN 469

>YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of the
           enoyl-coA hydratase/isomerase protein family [1503 bp,
           500 aa]
          Length = 500

 Score =  469 bits (1207), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 234/464 (50%), Positives = 311/464 (67%), Gaps = 18/464 (3%)

Query: 19  VKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSNAPRSLCA 78
           V F  +  +RV+TL RP+KLNAL+ +M + +  TL EYAKSD  N+VI+KSSN PRS CA
Sbjct: 39  VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCA 98

Query: 79  GGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVVLMDGITMGGGVGLATHVP 138
           GGDVA VA+ N   +   S++FF  EYSLN  +ATY KP+V  MDGITMGGGVGL+ H P
Sbjct: 99  GGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTP 158

Query: 139 FRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQLALYLCLTGDLLSGVDVYM 198
           FRIATENT+W MPEMDIGFFPDVG+TF+LP+I T+     Q+ALYLCLTG++++G D YM
Sbjct: 159 FRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYM 218

Query: 199 AGLASHYVPSHNLEDLQARLGEL--PVTN---SEEMWKITGDALEEFSVAIPEDYNFKYS 253
            GLASHYV S NL+ LQ RLGE+  P  N   S   + +  ++++EF   +P+DY FKYS
Sbjct: 219 LGLASHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYS 278

Query: 254 NAQLNVIETCFG-PENGLKGIRAALEKIVNS---SSASPEEKEFSRVTLQKLASKSPVSL 309
           N +LNVIE CF   +NG       +E I+N+      S E K F++    KL +KSP SL
Sbjct: 279 NEKLNVIEACFNLSKNG------TIEDIMNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSL 332

Query: 310 QVAIEQFHRNSQSDIESALKQDLVTASNMC--EDTVSEFSQATKHKLVDKSKAPFQWTKT 367
           Q+A+     NS+  IESA+K+DL TA+NMC  +D++ EFS+ATKHKL+DK + P+ WTK 
Sbjct: 333 QIALRLVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWTKK 392

Query: 368 A-LTVEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDYITGNDNSGR 426
             L V +L+ + SP+ +  +SL +   ++TW +YPYHS++ LPTEQ +  YI    N   
Sbjct: 393 EQLFVSQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDT 452

Query: 427 SLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSVGDAG 470
                  EVL +F+   PS +GK GI+ LC  +C RKC   + G
Sbjct: 453 GAKVTEREVLNHFANVIPSRRGKLGIQSLCKIVCERKCEEVNDG 496

>Scas_661.26
          Length = 523

 Score =  461 bits (1185), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 230/465 (49%), Positives = 314/465 (67%), Gaps = 21/465 (4%)

Query: 19  VKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSNAPRSLCA 78
           V F  +  +RVVTL RP KLNAL+ +MCQ +   L EY+KSD  N++I+KSS+  RSLCA
Sbjct: 52  VLFSMQDTARVVTLNRPAKLNALNFEMCQSMFQILNEYSKSDATNLIIVKSSDKGRSLCA 111

Query: 79  GGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVVLMDGITMGGGVGLATHVP 138
           GGDVA VA+QNL G    ++EFF++EYSLNL +ATY KP+V  M+GITMGGGVGL+ H P
Sbjct: 112 GGDVATVAVQNLNGNHKKAIEFFEAEYSLNLQMATYPKPIVTYMNGITMGGGVGLSVHTP 171

Query: 139 FRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQLALYLCLTGDLLSGVDVYM 198
           FRIATENT+W MPEMDIGFFPDVGTTF+LP++ T+     Q+ALYLCLTG++L+G D YM
Sbjct: 172 FRIATENTKWAMPEMDIGFFPDVGTTFALPRLVTMANNHSQMALYLCLTGEVLNGEDAYM 231

Query: 199 AGLASHYVPSHNLEDLQARLGEL---------PVTNSEEMWKITGDALEEFSVAIPEDYN 249
            GLASHYV S NL+ L+ RLGEL         P  +S   + +    + EFS  +P DY 
Sbjct: 232 LGLASHYVNSENLQSLEVRLGELTPTKHITADPAKSSAIFFDMVNGTINEFSTNLPMDYK 291

Query: 250 FKYSNAQLNVIETCFG--PENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQKLASKSPV 307
           FK++  QL+VIE+CF       ++ I  +L++   S +       F      KLA+KS  
Sbjct: 292 FKFTTDQLDVIESCFDITRHTSIEEILRSLDQYAKSEAGI----SFCTEIKNKLATKSMT 347

Query: 308 SLQVAIEQFHRNSQSDIESALKQDLVTASNMC--EDTVSEFSQATKHKLVDKSKAPFQWT 365
           S+Q+A++    NS+ DI SAL++DL TASNMC  E+ VSEFS+ATKHKLVDK K P+ W 
Sbjct: 348 SMQIALKVLKENSRDDINSALRRDLFTASNMCVNEEGVSEFSEATKHKLVDKQKTPYPWK 407

Query: 366 KTALTVEELSR-LVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDY---ITGN 421
             ++    L R +VSP+ +T VSL +   ++TW +YPYHS++ LP+EQ++K Y   ++G+
Sbjct: 408 HNSVISPNLLRAMVSPKLSTPVSLWENFSNITWDQYPYHSKYQLPSEQSIKQYLRRVSGH 467

Query: 422 DNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSV 466
            +   S      EVLK+F++ N  +K K+ +  +C+ IC RKC++
Sbjct: 468 QDGATSAFITKNEVLKHFTRTNKLTKDKSDVALICNIICERKCNM 512

>CAGL0K11968g complement(1153196..1154683) similar to sp|P28817
           Saccharomyces cerevisiae YDR036c, hypothetical start
          Length = 495

 Score =  450 bits (1158), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 228/459 (49%), Positives = 307/459 (66%), Gaps = 13/459 (2%)

Query: 19  VKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSNAPRSLCA 78
           V F  +  +R+VTL RP+KLNAL+ +MC  I  TL EY+KSD  N+++IKS+N+PRSLCA
Sbjct: 35  VLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCA 94

Query: 79  GGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVVLMDGITMGGGVGLATHVP 138
           GGDVA+VA  NL    +SS+  F+SEYSLN  LATY KPVVV MDGITMGGGVGL+ H P
Sbjct: 95  GGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTP 154

Query: 139 FRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQLALYLCLTGDLLSGVDVYM 198
           FRIATENT+W MPE DIGFFPDVGTTF+LP++ T+     Q+ALYLCLTGD++SG D Y+
Sbjct: 155 FRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAYL 214

Query: 199 AGLASHYVPSHNLEDLQARLGEL-PVTN----SEEMWKITGDALEEFSVAIPEDYNFKYS 253
            GLASHY+P  NLE LQ RLGEL P  +    S+E +     A+EEF+  +P ++ FK+S
Sbjct: 215 LGLASHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFS 274

Query: 254 NAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKEFSRVTLQKLASKSPVSLQVAI 313
             QL VIE CF   +G + I A   K+  +   +PE  +F+R T +KL SKS  S+QV I
Sbjct: 275 KDQLEVIEKCFDISSG-ESINAIFSKL-EAFEGTPEMMQFARDTKKKLESKSMTSMQVGI 332

Query: 314 EQFHRNSQSDIESALKQDLVTASNMC--EDTVSEFSQATKHKLVDKSKAPFQWT-KTALT 370
                NS+ DIESALK+DL TA NMC  +  ++EFS ATKHKL+DK K P+ W  +T LT
Sbjct: 333 RLMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQRTELT 392

Query: 371 VEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTEQNLKDYITGNDNSGRSLAA 430
            ++++ L++P+ +  VSL +   ++TW +YP+  ++ LP +  ++  +      G     
Sbjct: 393 PQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKRG---PI 449

Query: 431 NHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSVGDA 469
              +V+KYF+ +NP +K K G+   CD +   K S   A
Sbjct: 450 KKNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWKLSFDHA 488

>Scas_706.21
          Length = 1304

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 22/128 (17%)

Query: 217 RLGELPVTNSEEMWKITGDALEEFSVAIPEDYNFKYS--------------NAQLNVIET 262
           ++GEL     EE +K     LE  S+A  + YN  Y               N  LN   +
Sbjct: 347 KMGELQA--REEAYKKNVITLESLSMAFSDRYNLGYVGNKPQEFFEKSKKFNDDLNTSFS 404

Query: 263 CFGPE--NGLKGIRAALEKIVNSSSASPEEKEFSRVTLQKLASK-SPVSLQVAIEQFHRN 319
            F  E  N LK +   L +I NS +   +  E+S+   QK++++   ++ ++ I +F   
Sbjct: 405 NFEKESRNRLKSLENELSEITNSETIQNQRLEYSKADQQKISAEIEKLTSELTINEF--- 461

Query: 320 SQSDIESA 327
           + SD+E+A
Sbjct: 462 THSDLEAA 469

>Scas_526.2
          Length = 304

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 74/169 (43%), Gaps = 20/169 (11%)

Query: 12  RRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSN 71
           R+ MS+ V +  +G   ++ L  P  LN+L+      I   L++    D   I +++SS 
Sbjct: 29  RQKMSKRVSYTIEGPIFIIKLNDPRHLNSLTFDDFVYIAMLLEKANSDDSIFITVLQSS- 87

Query: 72  APRSLCAGGDVANV-----------ALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV 120
             +   +GG    V           +L NL G + S   F  + +       T+ K +V 
Sbjct: 88  -AKFFSSGGKFEAVLESKGKEDDIGSLNNLIGMISSPNVFVANAFR------THEKLLVC 140

Query: 121 LMDGITMGGGVGLATHVPFRIATENTRWCM-PEMDIGFFPDVGTTFSLP 168
            ++G  +G    +        A +++ + + P  ++GF  +VG++ +LP
Sbjct: 141 CLNGPAVGLSACIVMLCDLVYARDDSVYLLFPFSNLGFVAEVGSSVTLP 189

>CAGL0K10296g complement(1002739..1003485) similar to sp|P41734
           Saccharomyces cerevisiae YOR126c EST2 isoamyl acetate
           hydrolytic enzyme, hypothetical start
          Length = 248

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 122 MDGITMGGGVGLATHVPFRIATE-----NTRWCMPEMD 154
           +DG ++G G+G   +    + T      NTRWC+P +D
Sbjct: 31  IDGFSLGSGLGAVYNRKLDVVTRGFSGYNTRWCLPVLD 68

>Kwal_47.17004
          Length = 385

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 169 KITTVGGVKGQLALYLCLTG---DLLSGVDVYMAGLASH----YVPSHNLEDLQARLGEL 221
           +I +  GV  ++A  +CL+G   D +  VDV++A +A           ++EDLQ R  +L
Sbjct: 223 RIMSFQGVGPKVADCVCLSGLRMDDVVPVDVHIARIAQRDYKFTARKLDIEDLQTRYKDL 282

Query: 222 PVTNSE 227
           PVT  +
Sbjct: 283 PVTRKK 288

>Kwal_56.23316
          Length = 278

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 25  GVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSNAPRSLCAGGDVAN 84
           G+  V+T   P+ LN+ S      +   L+   K D  +  +++SS   R   AG DV+N
Sbjct: 18  GLFFVITFTDPQSLNSFSGTDFLYLAHLLEIADKCDSVSFTVLQSSG--RFFSAGADVSN 75

Query: 85  V------ALQNLAGKLDSSL-EFFQSEYSLNLLLATYNKPVVVLMDGITMG 128
           +      A +   G L   L EF      +    AT++K +V  ++G  +G
Sbjct: 76  IERVQAAARREPGGMLGQWLSEFVSRNLFVTHTFATHSKVLVCCLNGPAIG 126

>KLLA0B05016g 454717..457377 gi|1709486|sp|P54788|ORC1_KLULA
           Kluyveromyces lactis Origin recognition complex subunit
           1, start by similarity
          Length = 886

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 16/105 (15%)

Query: 22  GSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSDVNNIVIIKSSNAPRSLCAGGD 81
           G+ GV + +T+   E +  L T   Q+ +P  Q     ++N + I+K+S          D
Sbjct: 471 GTPGVGKTLTVR--EVVKDLMTSADQKELPRFQYI---EINGLKIVKAS----------D 515

Query: 82  VANVALQNLAG-KLDSSLEFFQSEYSLNLLLATYNKPVVVLMDGI 125
              V  Q ++G KL S       E+  N + AT  +P+VVL+D +
Sbjct: 516 SYEVFWQKISGEKLTSGAAMESLEFYFNKVPATKKRPIVVLLDEL 560

>YGR277C (YGR277C) [2222] chr7 complement(1045649..1046566) Member
           of the cytidylyltransferase family, which are involved
           in phosphatidylcholine biosynthesis [918 bp, 305 aa]
          Length = 305

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 10/87 (11%)

Query: 147 RWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQLALYLCLTGDLLSGVDVYMAGLASHYV 206
           R C  ++DI   P+  T+F L            L     +T D+L G  +  +G+   + 
Sbjct: 33  RECQSQLDIVIVPEFKTSFQL---------DSALGKMYSITRDVLLGYGMINSGINIIFN 83

Query: 207 PSHNLE-DLQARLGELPVTNSEEMWKI 232
             H +E +LQ ++  LP  ++ E WK+
Sbjct: 84  NIHFVESNLQWKVVLLPQESTFETWKL 110

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,613,922
Number of extensions: 602376
Number of successful extensions: 2014
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2035
Number of HSP's successfully gapped: 34
Length of query: 470
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 365
Effective length of database: 12,961,219
Effective search space: 4730844935
Effective search space used: 4730844935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)