Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2308031428714540.0
ABL103W3171905092e-62
KLLA0F18722g2701664931e-60
YBR057C (MUM2)3661554453e-52
CAGL0H10164g4841443459e-37
Scas_718.502361412312e-22
Scas_661.252251312172e-20
Scas_678.2536844700.86
Sklu_1973.177748691.1
CAGL0E04070g585135672.1
AER241W85229645.3
Kwal_23.359712135605.9
KLLA0F16643g66586636.4
YMR065W (KAR5)50463636.5
Scas_659.947554628.7
KLLA0E04807g76069629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23080
         (310 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23080                                                         564   0.0  
ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH] complement(2...   200   2e-62
KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236 Saccha...   194   1e-60
YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein req...   176   3e-52
CAGL0H10164g complement(991125..992579) weakly similar to sp|P38...   137   9e-37
Scas_718.50                                                            94   2e-22
Scas_661.25                                                            88   2e-20
Scas_678.25                                                            32   0.86 
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          31   1.1  
CAGL0E04070g complement(389195..390952) similar to sp|P38732 Sac...    30   2.1  
AER241W [2743] [Homologous to ScYDR356W (NUF1) - SH] complement(...    29   5.3  
Kwal_23.3597                                                           28   5.9  
KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces...    29   6.4  
YMR065W (KAR5) [4024] chr13 (399701..401215) Coiled-coil membran...    29   6.5  
Scas_659.9                                                             28   8.7  
KLLA0E04807g complement(433298..435580) highly similar to sp|P15...    28   9.7  

>Kwal_56.23080
          Length = 314

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/287 (95%), Positives = 274/287 (95%)

Query: 1   MSSTDWKTMPNFEDSRGLESSFSNLAFAPNAFYSHPEMDKHTIGGNKPNTDSIAPFNGGI 60
           MSSTDWKTMPNFEDSRGLESSFSNLAFAPNAFYSHPEMDKHTIGGNKPNTDSIAPFNGGI
Sbjct: 1   MSSTDWKTMPNFEDSRGLESSFSNLAFAPNAFYSHPEMDKHTIGGNKPNTDSIAPFNGGI 60

Query: 61  FSQPSFPLTSRSMNALPQASSREXXXXXXXXXXXXXFCWNYEQKDSNNGREDTTGTITAN 120
           FSQPSFPLTSRSMNALPQASSRE             FCWNYEQKDSNNGREDTTGTITAN
Sbjct: 61  FSQPSFPLTSRSMNALPQASSRESNDRGGGDSGRGNFCWNYEQKDSNNGREDTTGTITAN 120

Query: 121 SIMDNSVNTKISDFNTTYGSSEQQENAESMQLELQLKETQIESLEVEIQSLKLIFNDGLR 180
           SIMDNSVNTKISDFNTTYGSSEQQENAESMQLELQLKETQIESLEVEIQSLKLIFNDGLR
Sbjct: 121 SIMDNSVNTKISDFNTTYGSSEQQENAESMQLELQLKETQIESLEVEIQSLKLIFNDGLR 180

Query: 181 LRQEHDLRALSGPAINASVEVPASLEAIFQKLSSTLATKDKELDETKKRLESIVTAVALN 240
           LRQEHDLRALSGPAINASVEVPASLEAIFQKLSSTLATKDKELDETKKRLESIVTAVALN
Sbjct: 181 LRQEHDLRALSGPAINASVEVPASLEAIFQKLSSTLATKDKELDETKKRLESIVTAVALN 240

Query: 241 PSNTVTKLGRYDEEALAHKMVVRLETLTKENQDMAKMLGYGRSKENH 287
           PSNTVTKLGRYDEEALAHKMVVRLETLTKENQDMAKMLGYGRSKENH
Sbjct: 241 PSNTVTKLGRYDEEALAHKMVVRLETLTKENQDMAKMLGYGRSKENH 287

>ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH]
           complement(205068..206021) [954 bp, 317 aa]
          Length = 317

 Score =  200 bits (509), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 110/190 (57%), Positives = 137/190 (72%), Gaps = 15/190 (7%)

Query: 113 TTGTITANSIMDNSVNTKISDFNTTYGSSEQQ---------ENAESMQLELQLKETQIES 163
           T GT+T  SIMD       S F+TT+ ++  Q         E+ ES++LELQLKETQIES
Sbjct: 97  TAGTLTTASIMDGHTAKSSSGFSTTFATTSSQQSNPSHGSLESMESLRLELQLKETQIES 156

Query: 164 LEVEIQSLKLIFNDGLRLRQ-EHDL--RALSGPAINAS---VEVPASLEAIFQKLSSTLA 217
           LE EI  LK IFN GL  +Q E  L  R L   A++     VE+PA+LE IF KL+++L 
Sbjct: 157 LEDEITKLKSIFNQGLTFKQQEQQLQKRKLHQHALDLDHMPVEIPANLEIIFNKLATSLK 216

Query: 218 TKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVRLETLTKENQDMAKM 277
            KD+EL++T+KRLESI+TA+ALNPSN+VT+ GRYDEEALAHKM+VRLE LTKENQ+MAK+
Sbjct: 217 RKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEMLTKENQEMAKL 276

Query: 278 LGYGRSKENH 287
           L YGRSKE H
Sbjct: 277 LSYGRSKETH 286

>KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein
           singleton, hypothetical start
          Length = 270

 Score =  194 bits (493), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 101/166 (60%), Positives = 127/166 (76%), Gaps = 3/166 (1%)

Query: 122 IMDNSVNTKISDFNTTYGSSEQQENAESMQLELQLKETQIESLEVEIQSLKLIFNDGLRL 181
           IMD S   K S FNTT+  SE + ++++ +LELQLKETQIESLE+EI+ LK +FN GL  
Sbjct: 80  IMDRSSYAKSSGFNTTF-DSETEPSSDNFKLELQLKETQIESLEIEIKKLKEVFNQGLTF 138

Query: 182 RQEHDLRALSGPAI--NASVEVPASLEAIFQKLSSTLATKDKELDETKKRLESIVTAVAL 239
           +Q+ + +     A+  ++ +++PASLE IF KLS +L  KD+EL ETK+RLE IVTAVAL
Sbjct: 139 KQQEEQKMKKSKALTFDSEIQIPASLEIIFCKLSDSLKRKDQELQETKRRLEGIVTAVAL 198

Query: 240 NPSNTVTKLGRYDEEALAHKMVVRLETLTKENQDMAKMLGYGRSKE 285
           NPSN+ TK GRYDEEALAHKMV RLETL KEN++MAKML YGR KE
Sbjct: 199 NPSNSTTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYGRVKE 244

>YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein
           required for premeiotic DNA synthesis and sporulation
           [1101 bp, 366 aa]
          Length = 366

 Score =  176 bits (445), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 118/155 (76%)

Query: 131 ISDFNTTYGSSEQQENAESMQLELQLKETQIESLEVEIQSLKLIFNDGLRLRQEHDLRAL 190
           +++ N+   +S + +  E++++ELQ+KE+QIESLE EIQ LK IFN+GL  +Q       
Sbjct: 174 MNNVNSNEMNSNKDDRMEALEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEK 233

Query: 191 SGPAINASVEVPASLEAIFQKLSSTLATKDKELDETKKRLESIVTAVALNPSNTVTKLGR 250
               I  + E+PASLE IF+KLSS+L  K+KEL ETK+ LESI+TA+ALNP+N+VTK GR
Sbjct: 234 ENCHIPQTFELPASLEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGR 293

Query: 251 YDEEALAHKMVVRLETLTKENQDMAKMLGYGRSKE 285
           YD E++AHKMVVRLE LT EN++MAKML YGRSKE
Sbjct: 294 YDAESIAHKMVVRLENLTNENKEMAKMLAYGRSKE 328

>CAGL0H10164g complement(991125..992579) weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein,
           hypothetical start
          Length = 484

 Score =  137 bits (345), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 101/144 (70%), Gaps = 6/144 (4%)

Query: 148 ESMQLELQLKETQIESLEVEIQSLKLIFNDGLRLRQEHDLRALSGPA----INASVEVPA 203
           ++++ ++Q+K+ Q++SL+ E+  LK   +  + +    D+ + +           ++VP 
Sbjct: 314 DTLKYDIQVKDAQLQSLQRELTRLKSAIS--VAVDNTKDISSKTADKEEHITTKEIDVPN 371

Query: 204 SLEAIFQKLSSTLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVR 263
           SL+ IF+KLSS L  ++KELDETK  LES++ A+ALNPSN+ TK GRYD E LAHK VVR
Sbjct: 372 SLDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVR 431

Query: 264 LETLTKENQDMAKMLGYGRSKENH 287
           LETLTKENQ+MA+ML +GR+KE H
Sbjct: 432 LETLTKENQEMARMLSFGRAKEKH 455

>Scas_718.50
          Length = 236

 Score = 93.6 bits (231), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 80/141 (56%), Gaps = 19/141 (13%)

Query: 150 MQLELQLKETQIESLEVEIQSLKLIFN---DGLRLRQEHDLRALSGPAINASVEVPASLE 206
           +Q +L +K+ QIESLE EIQ+LK I     +G R   +  +    GP             
Sbjct: 84  LQEKLNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDKISKHYGP------------- 130

Query: 207 AIFQKLSSTLATKDKELDETKKRLESIVTAVALN--PSNTVTKLGRYDEEALAHKMVVRL 264
            IF  L S+L  +++E +  K+  E +   VA+N   SN++TK GRYD E +AHKM++R 
Sbjct: 131 -IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRF 189

Query: 265 ETLTKENQDMAKMLGYGRSKE 285
           E LTKEN  MAKML YGR  E
Sbjct: 190 EMLTKENSRMAKMLSYGRPME 210

>Scas_661.25
          Length = 225

 Score = 88.2 bits (217), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 87/131 (66%), Gaps = 5/131 (3%)

Query: 154 LQLKETQIESLEVEIQSLKLIFNDGLRLRQEHDLRALSGPAINASVEVPASLEAIFQKLS 213
           L +KETQ+ SL++E+  LK I  + ++ +Q    +++  P  +  + V  + E +F +L+
Sbjct: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQ----KSVDDPNSHELLNV-TNHELLFTRLN 123

Query: 214 STLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVRLETLTKENQD 273
           S L  K++E+ + + + ES++TA+AL+P+N +   G+ D E ++ KMV +LETLTKENQ+
Sbjct: 124 SLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKENQE 183

Query: 274 MAKMLGYGRSK 284
           M+K+L +  SK
Sbjct: 184 MSKLLNFEVSK 194

>Scas_678.25
          Length = 368

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 98  CW-NYEQKDSNNGREDTTGTITANSIMDNSVNTKISDFNTTYGS 140
           CW NY  K S N R    G   AN ++  + + +I  F  ++GS
Sbjct: 42  CWKNYMLKSSTNTRRKLLGLYLANHVVQQAKSQQIGQFQDSFGS 85

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 182 RQEHDLRALSGPAINASVEVPASLEAIFQKLSSTLATKDKELDETKKR 229
           +QEH L  + GPAI   V+VP + E +  K    L ++  EL +   R
Sbjct: 121 QQEHSLNYVQGPAIFDVVQVPYTQEEVLLKEVDFLKSRLWELRQLTGR 168

>CAGL0E04070g complement(389195..390952) similar to sp|P38732
           Saccharomyces cerevisiae YHL039w, start by similarity
          Length = 585

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 4/135 (2%)

Query: 99  WNYEQKDSNNGREDTTGTITANSIMDNSVNTKISDFNTTYGSSEQQENAE-SMQLELQLK 157
           WNY     N   +D       + + +N       D+  +YG    QEN   S+ L L+L 
Sbjct: 255 WNYSDDTFNYTNKDLAYLKNGDELFNNYGEKSNVDYLISYGFLNSQENIHNSVNLTLRLD 314

Query: 158 ETQIESLEVEIQSLKLIFNDGLRLR-QEHDLRALSGPAINASVEVPASLEAIFQKLSSTL 216
            T I   +  +++L+++ ND +  +  ++D   +S       V    S E I   L S L
Sbjct: 315 PTFISQAKEHVENLEIVSNDTVLFKISKNDPLPVSLVHFFGYVTKLKSEEHI--TLRSIL 372

Query: 217 ATKDKELDETKKRLE 231
              D+ ++  K++LE
Sbjct: 373 EGSDQLINILKQKLE 387

>AER241W [2743] [Homologous to ScYDR356W (NUF1) - SH]
           complement(1082034..1084592) [2559 bp, 852 aa]
          Length = 852

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 209 FQKLSSTLATKDKELDETKKRLESIVTAV 237
            QKL  TL  ++KELDE  + LES V A+
Sbjct: 388 LQKLRQTLEERNKELDERVEALESQVAAI 416

>Kwal_23.3597
          Length = 121

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 193 PAINASVEVPASLEAIFQKLSSTLATKDKELDETK 227
           P++N       +LE  F  L + L +KD+ELD+ K
Sbjct: 26  PSVNQGARHEKALEEQFAALKAELESKDRELDDYK 60

>KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w VPS5 involved in Golgi retention and
           vacuolar sorting, start by similarity
          Length = 665

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 122 IMDNSVNTKISDFNTTYGSSEQQENAESMQLELQLKETQIESLEVEIQSLKLIFNDGLRL 181
           +++N +N K + FN   G+S   E A S++ EL++  ++   ++ E Q++  +    +  
Sbjct: 567 LVENDLNKKQTQFNKVSGNSANSEKATSIENELRILTSRCNKIKQEWQTIAEVIRKDV-- 624

Query: 182 RQEHDLRALSGPAINASVEVPASLEA 207
             +HD+  +     N  + + +++E+
Sbjct: 625 -NQHDVDTIEDFRNNMEIYLESAIES 649

>YMR065W (KAR5) [4024] chr13 (399701..401215) Coiled-coil membrane
           protein required for homotypic nuclear fusion [1515 bp,
           504 aa]
          Length = 504

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%)

Query: 210 QKLSSTLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVRLETLTK 269
           +++ ST     ++L+ TKK+L+ I   V+L   N +T +   D      KM++R   L  
Sbjct: 390 EEIFSTFNDISEKLNGTKKKLDDIEIRVSLVHKNVMTMMRVLDFMWKTSKMIIRCGYLAV 449

Query: 270 ENQ 272
           +N+
Sbjct: 450 KNK 452

>Scas_659.9
          Length = 475

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 104 KDSNNGREDTTGTITANSIMDNSVNTKISDFNTTYGSSEQQENAESMQLELQLK 157
           KD  +   D   + T + I+  S +  I  FNTT+G S +  + + MQ   Q+K
Sbjct: 296 KDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQVK 349

>KLLA0E04807g complement(433298..435580) highly similar to sp|P15303
           Saccharomyces cerevisiae YPR181c SEC23 component of
           COPII coat of ER-golgi vesicles singleton, start by
           similarity
          Length = 760

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 196 NASVE----VPASLEAIFQKLSSTLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRY 251
           N +VE    VP  +  IF  +  T A +++ L   K   ESI+T+++L P+N +  L  Y
Sbjct: 107 NTTVEYITSVPVQVPPIFFFIVDTTA-EEENLQALK---ESIITSLSLLPANALVGLITY 162

Query: 252 DEEALAHKM 260
           D     H +
Sbjct: 163 DNVIQLHDL 171

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.124    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,733,899
Number of extensions: 344133
Number of successful extensions: 1493
Number of sequences better than 10.0: 89
Number of HSP's gapped: 1480
Number of HSP's successfully gapped: 93
Length of query: 310
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 209
Effective length of database: 13,099,691
Effective search space: 2737835419
Effective search space used: 2737835419
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 61 (28.1 bits)