Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2307937236719720.0
Sklu_2360.537236718330.0
KLLA0F18744g37236717240.0
Scas_661.2437236717230.0
CAGL0H10142g37236717050.0
YDR035W (ARO3)37036716570.0
ABL102C37336715900.0
YBR249C (ARO4)37035411381e-156
AFL047W36436011151e-152
Scas_597.1337235411131e-152
CAGL0C01573g35635411111e-152
Sklu_1187.136835411021e-150
KLLA0F06556g36435410951e-149
Kwal_14.155436435410891e-148
Scas_26.11831678451e-114
AFR270W381107880.006
CAGL0M04829g1706118711.1
YEL023C682105672.9
CAGL0J08459g80171664.1
CAGL0D00572g1037106664.1
KLLA0E20515g42855638.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23079
         (367 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23079                                                         764   0.0  
Sklu_2360.5 YDR035W, Contig c2360 14257-15375                         710   0.0  
KLLA0F18744g complement(1723008..1724126) highly similar to sp|P...   668   0.0  
Scas_661.24                                                           668   0.0  
CAGL0H10142g 989652..990770 highly similar to sp|P14843 Saccharo...   661   0.0  
YDR035W (ARO3) [888] chr4 (521811..522923) 2-Dehydro-3-deoxyphos...   642   0.0  
ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH] (206411..207...   617   0.0  
YBR249C (ARO4) [428] chr2 complement(716839..717951) 2-Dehydro-3...   442   e-156
AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH] complement(...   434   e-152
Scas_597.13                                                           433   e-152
CAGL0C01573g 170694..171764 highly similar to sp|P32449 Saccharo...   432   e-152
Sklu_1187.1 YBR249C, Contig c1187 489-1595                            429   e-150
KLLA0F06556g 633167..634261 highly similar to sp|P32449 Saccharo...   426   e-149
Kwal_14.1554                                                          424   e-148
Scas_26.1                                                             330   e-114
AFR270W [3462] [Homologous to NOHBY] complement(919886..921031) ...    39   0.006
CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...    32   1.1  
YEL023C (YEL023C) [1401] chr5 complement(108504..110552) Protein...    30   2.9  
CAGL0J08459g complement(839245..841650) similar to sp|P50896 Sac...    30   4.1  
CAGL0D00572g complement(72970..76083) similar to sp|Q07468 Sacch...    30   4.1  
KLLA0E20515g complement(1815696..1816982) similar to sp|P35183 S...    29   8.4  

>Kwal_56.23079
          Length = 372

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/367 (100%), Positives = 367/367 (100%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240

Query: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300
           LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI
Sbjct: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300

Query: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360
           YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA
Sbjct: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360

Query: 361 KGVQNRR 367
           KGVQNRR
Sbjct: 361 KGVQNRR 367

>Sklu_2360.5 YDR035W, Contig c2360 14257-15375
          Length = 372

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/367 (91%), Positives = 355/367 (96%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHE PIS KGHKTIVDAREQVC+ILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEY D+LAA S+K +KDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FTNLVEK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVS+DAMRAAAHSHYFLSVTKPG+TAIVGTEGNSDTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240

Query: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300
           LRGGK GTNYD+ NVK+TQ+EL+KAK+A+ENG  RRIMIDCSHGNSSKD+RNQPKVAQSI
Sbjct: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300

Query: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360
           Y+QLT G+NAICGVMIESNLVEGRQDVP EGGREGLKYGCSITDACIGWE+TE+VL LLA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360

Query: 361 KGVQNRR 367
           KGVQNRR
Sbjct: 361 KGVQNRR 367

>KLLA0F18744g complement(1723008..1724126) highly similar to
           sp|P14843 Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           phenylalanine-inhibited, start by similarity
          Length = 372

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/367 (86%), Positives = 337/367 (91%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFI NDH+GDR+ LEDWRIKGYDPLTPPDLLQHE PI  K  K IV+ARE+VCDILNGKD
Sbjct: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCSIHDPKAAYEY D L   S + + DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FT L EK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV+VDAMR+AAHSHYFLSVTKPGVTAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240

Query: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300
           LRGGKTGTN+DAENVKKTQ ELVKAK+A+  G  RRIM+DCSHGNS KD+RNQPKVAQS+
Sbjct: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300

Query: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360
           YEQL+ GQNAICGVMIESNLVEGRQDVP EGGRE L YGCSITDACIGWETTE+VL LLA
Sbjct: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360

Query: 361 KGVQNRR 367
           KGV+NRR
Sbjct: 361 KGVKNRR 367

>Scas_661.24
          Length = 372

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/367 (86%), Positives = 338/367 (92%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFIKNDH GDRTRLEDWRIKGYDPLTPPDLLQHE PIS +GHK IVDARE VCDILNGKD
Sbjct: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEY DRLA  +   +KDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FT LVEK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVS+DAMRAAAH HYFLSVTKPGVTAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240

Query: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300
           LRGGK GTN+DAE+V+ T++EL K  + + N   RRIMIDCSHGNS+KDYRNQPKVAQSI
Sbjct: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300

Query: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360
           Y+QLT G+NAICGVMIESNLVEGRQDVP EGGR GLKYGCSITDACIGWE+TE+VL  LA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360

Query: 361 KGVQNRR 367
           +GV+NRR
Sbjct: 361 EGVRNRR 367

>CAGL0H10142g 989652..990770 highly similar to sp|P14843
           Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase, start by
           similarity
          Length = 372

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/367 (85%), Positives = 338/367 (92%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFIKND+ GDRTRLEDWRIKGYDPLTPPDLLQHE PIS KG   I+ AR+ VCDILNGKD
Sbjct: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCSIHDPKAAYEY D+LA  ++K + DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FT L+EK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV++DAMRAA+H HYFLSVTKPGVTAIVGTEGNSDTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240

Query: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300
           LRGGK GTNYDAENVK T+E+L KAK+ +E   TRRIMIDCSHGNS+KDYRNQPKVAQ I
Sbjct: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300

Query: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360
           Y QL+ G+N +CGVMIESNLVEGRQDVP EGGREGLKYGCSITDACIGW+TTE VL LLA
Sbjct: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360

Query: 361 KGVQNRR 367
           +GV+NRR
Sbjct: 361 EGVRNRR 367

>YDR035W (ARO3) [888] chr4 (521811..522923)
           2-Dehydro-3-deoxyphosphoheptonate aldolase (DAHPS),
           inhibited by phenylalanine [1113 bp, 370 aa]
          Length = 370

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/367 (81%), Positives = 339/367 (92%), Gaps = 2/367 (0%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFIKNDH GDR RLEDWRIKGYDPLTPPDLLQHE PISAKG + I+ AR+ VCDILNGKD
Sbjct: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCS+HDPKAAY+Y DRLA  S+K +KDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISRE+F  LVEK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV++DAMRAAAH HYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240

Query: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300
           LRGGK GTN+D E+V+ T+++L KA + +++ K  RIMIDCSHGNS+KD++NQPKVA+ I
Sbjct: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDDSQK--RIMIDCSHGNSNKDFKNQPKVAKCI 298

Query: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360
           Y+QLT+G+N++CGVMIESN+ EGRQD+P EGGREGLKYGCS+TDACIGWE+TE+VL LLA
Sbjct: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358

Query: 361 KGVQNRR 367
           +GV+NRR
Sbjct: 359 EGVRNRR 365

>ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH]
           (206411..207532) [1122 bp, 373 aa]
          Length = 373

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/367 (78%), Positives = 327/367 (89%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFIKN+++GD++RLEDWRIKGYDPLTPP++LQHELP+SA G   IV ARE V  +L+G+D
Sbjct: 1   MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAIIVRAREGVVQVLSGRD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRL++V+GPCSIHDP+AA EY  RL+  + +   +LL+IMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE++T LVE +PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDG LQV++DAMRAAAHSHYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFLSVTKPGVTAIVGTEGNEDTFII 240

Query: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300
           LRGGK GTNYDA +V++ +++LV AK+ +  G  RRIMIDCSHGNS+KDYRNQPKVAQ I
Sbjct: 241 LRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRRIMIDCSHGNSNKDYRNQPKVAQDI 300

Query: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360
           YEQL+ G+NAICGVMIESNLVEGRQD+P   GR GLKYGCSITDACIGW+ T EVL LLA
Sbjct: 301 YEQLSKGENAICGVMIESNLVEGRQDIPEGNGRVGLKYGCSITDACIGWDQTVEVLELLA 360

Query: 361 KGVQNRR 367
           KGV N+R
Sbjct: 361 KGVINKR 367

>YBR249C (ARO4) [428] chr2 complement(716839..717951)
           2-Dehydro-3-deoxyphosphoheptonate aldolase
           (3-deoxy-D-arabino-heptulosonate-7-phosphate synthase or
           DAHP synthase), inhibited by tyrosine [1113 bp, 370 aa]
          Length = 370

 Score =  442 bits (1138), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/354 (62%), Positives = 267/354 (75%), Gaps = 10/354 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ ++P +    +T    R +  DI+ GKDDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            +AA EY  RL   S +   DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SRELFTNLVE-KMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R+LF NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLSFPVGF 200

Query: 194 KNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVILRGGKTGTNYDAE 253
           KNGTDG L V+VDA +AAAHSH+F+ VTK GV AI  T+GN   FVILRGGK GTNYDA+
Sbjct: 201 KNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 NVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSIYEQLTDGQNAICG 313
           +V + + +L     A  NG    +MID SHGNS+KD+RNQPKV   + EQ+ +G+NAI G
Sbjct: 261 SVAEAKAQLP----AGSNG----LMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITG 312

Query: 314 VMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLAKGVQNRR 367
           VMIESN+ EG Q +PAE G+ GLKYG SITDACIGWETTE+VL  LA  V+ RR
Sbjct: 313 VMIESNINEGNQGIPAE-GKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQRR 365

>AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH]
           complement(351599..352693) [1095 bp, 364 aa]
          Length = 364

 Score =  434 bits (1115), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 212/360 (58%), Positives = 265/360 (73%), Gaps = 11/360 (3%)

Query: 9   GDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKDDRLVIVIG 68
            D  + ED RI GYDPL  P LLQ ++P +    +T    R +  DI+ GKDDR+++V+G
Sbjct: 9   ADADQAEDVRILGYDPLVSPALLQSQIPATQACLETAQKGRREAIDIITGKDDRVLVVVG 68

Query: 69  PCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQI 128
           PCSIHD  AA EY  RL   +++   DL+++MRAYLEKPRTTVGWKGLINDPD++N+F I
Sbjct: 69  PCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRAYLEKPRTTVGWKGLINDPDVNNTFNI 128

Query: 129 NKGLRISRELFTNLVE-KMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGL 187
           NKGL+ +R+LF NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGL
Sbjct: 129 NKGLQAARQLFVNLTSIGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGL 188

Query: 188 SFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVILRGGKTG 247
           SFPIGFKNGTDG L V++DA++A++HSH+F+ VTK GV AI  T+GN   FVILRGGK G
Sbjct: 189 SFPIGFKNGTDGSLDVALDAVKASSHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKRG 248

Query: 248 TNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSIYEQLTDG 307
           TNYDA +V + + +L    +         +MID SHGNS+KD+RNQPKV + + EQ+ +G
Sbjct: 249 TNYDATSVAEAKAKLPPTGV---------LMIDYSHGNSNKDFRNQPKVNEVVSEQIANG 299

Query: 308 QNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLAKGVQNRR 367
           ++ I GVMIESN+ EG Q +P E G+ GLKYG SITD CI WETTEEVL  LA  V+ RR
Sbjct: 300 EDKIVGVMIESNINEGSQKIPPE-GKAGLKYGVSITDGCISWETTEEVLRKLAGAVRKRR 358

>Scas_597.13
          Length = 372

 Score =  433 bits (1113), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 215/354 (60%), Positives = 270/354 (76%), Gaps = 10/354 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ ++P + K  +T    R +  +I++G+DDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLVSPALLQVQIPATEKCIETAKKGRRESIEIISGRDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EY  +L   + + ++DL++IMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LDAAQEYALKLKKLADELSQDLVVIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SRELFTNLVE-KMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R+LF NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 200

Query: 194 KNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVILRGGKTGTNYDAE 253
           KNGTDG L V+VDA +AA+HSH+F+ VTK GV AI  T+GN   FVILRGGK GTNYDA+
Sbjct: 201 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 NVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSIYEQLTDGQNAICG 313
           +V + + +L     A  NG    +MID SHGNS+KD+RNQPKV  ++ EQ+ +G+NAI G
Sbjct: 261 SVAEAKAQLP----AGSNG----LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGENAIIG 312

Query: 314 VMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLAKGVQNRR 367
           VMIESN+ EG Q +P E G+ GLKYG SITDACI +ETTE+VL  LA  V+ RR
Sbjct: 313 VMIESNINEGSQKIPPE-GKAGLKYGVSITDACISFETTEDVLKKLAAAVRQRR 365

>CAGL0C01573g 170694..171764 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4, start by
           similarity
          Length = 356

 Score =  432 bits (1111), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 215/354 (60%), Positives = 267/354 (75%), Gaps = 10/354 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ ++P +    +T    R++  +I+ G+DDR+++++GPCS+HD
Sbjct: 8   EDVRILGYDPLVSPALLQVQVPATEVSIQTARRGRKESIEIITGRDDRVLVIVGPCSVHD 67

Query: 75  PKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EY  RL   S +  KDL I+MRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 68  LDAAQEYAQRLKKLSDELQKDLCIVMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 127

Query: 135 SRELFTNLVEK-MPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R+LF NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 128 ARQLFVNLTNTGVPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 187

Query: 194 KNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVILRGGKTGTNYDAE 253
           KNGTDG L V+VDA +AA+HSH+F+ VTK GV AI  T+GN   FVILRGGK GTNYDA+
Sbjct: 188 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 247

Query: 254 NVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSIYEQLTDGQNAICG 313
           +V + +++L +      NG    +MID SHGNS+KD+RNQPKV  ++ EQ+ +G+ AI G
Sbjct: 248 SVAEAKKQLPEGA----NG----LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEKAIVG 299

Query: 314 VMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLAKGVQNRR 367
           VMIESN+ EG Q +P E G+ GLKYG SITDACI WETTE+VL  LA  V+ RR
Sbjct: 300 VMIESNINEGNQCIPPE-GKAGLKYGVSITDACISWETTEDVLRKLAAAVRQRR 352

>Sklu_1187.1 YBR249C, Contig c1187 489-1595
          Length = 368

 Score =  429 bits (1102), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 210/354 (59%), Positives = 265/354 (74%), Gaps = 11/354 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ ++P +    +T    R++  DI+ GKDDR+++++GPCSIHD
Sbjct: 19  EDVRILGYDPLVSPALLQSQVPATQVSLQTAQRGRKESIDIITGKDDRVLVIVGPCSIHD 78

Query: 75  PKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            + A EY  RL   S +   DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 79  LELAQEYGTRLKKLSDELQGDLCIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQY 138

Query: 135 SRELFTNLVE-KMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R+LF NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 139 ARQLFVNLTSLGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGLSFPIGF 198

Query: 194 KNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVILRGGKTGTNYDAE 253
           KNGTDG L V++DA++AA+HSH+F+ VTK GV AI  T+GN   F+ILRGGK GTNYDA+
Sbjct: 199 KNGTDGTLGVALDAVKAASHSHHFMGVTKHGVAAITTTKGNEHCFIILRGGKKGTNYDAQ 258

Query: 254 NVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSIYEQLTDGQNAICG 313
           +V + + +L           T  +M+D SHGNS+KD+RNQPKV  ++ EQ+ +G++ I G
Sbjct: 259 SVAEAKAQLP---------PTGALMVDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 309

Query: 314 VMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLAKGVQNRR 367
           VMIES++ EG+Q +P E G+ GLKYG SITD CIGWE+TE+VL  LA  V+ RR
Sbjct: 310 VMIESHINEGQQSIPPE-GKAGLKYGVSITDGCIGWESTEQVLRKLAAAVRQRR 362

>KLLA0F06556g 633167..634261 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           tyrosine-inhibited, start by similarity
          Length = 364

 Score =  426 bits (1095), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 212/354 (59%), Positives = 264/354 (74%), Gaps = 11/354 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ ++P S +  +T    R++  DI+ GKDDR+++V+GPCSIHD
Sbjct: 13  EDVRILGYDPLVSPALLQAQVPASQECLETAQKGRKESIDIITGKDDRVLVVVGPCSIHD 72

Query: 75  PKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            K A +Y   L A S +   DL IIMRAYLEKPRTTVGWKGLINDPD+DN++ INKGL++
Sbjct: 73  LKEAQDYAKGLKALSDELKGDLCIIMRAYLEKPRTTVGWKGLINDPDVDNTYNINKGLQV 132

Query: 135 SRELFTNLVE-KMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           SR+LF NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 133 SRQLFVNLTSLGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 192

Query: 194 KNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVILRGGKTGTNYDAE 253
           KNGTDG L V++DA++AA+HSH+F+ VTK GV AI  T+GN   FVILRGGK GTNYD+ 
Sbjct: 193 KNGTDGTLGVALDAVQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKQGTNYDSV 252

Query: 254 NVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSIYEQLTDGQNAICG 313
           +V + ++ L    +         +MID SHGNS+KD+RNQPKV  ++ EQ+ +G++ I G
Sbjct: 253 SVAEAKKALPPTGV---------LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 303

Query: 314 VMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLAKGVQNRR 367
           VMIES++ EG+Q +PAE G+ GLKYG SITD CI  ETT EVL  LA  V+ RR
Sbjct: 304 VMIESHINEGKQSIPAE-GKAGLKYGVSITDGCISLETTAEVLRKLAAAVRARR 356

>Kwal_14.1554
          Length = 364

 Score =  424 bits (1089), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 261/354 (73%), Gaps = 11/354 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI G DPL  P LLQ ++P + +  +T+   R     I+ G+DDRL++++GPCSIHD
Sbjct: 14  EDVRILGLDPLVSPALLQSQIPATPECLRTVQKGRVGASKIIMGEDDRLLVIVGPCSIHD 73

Query: 75  PKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
              A EY  RL   + +   +L IIMRAYLEKPRTTVGWKGLINDPD++NSF INKGL+ 
Sbjct: 74  LDLAQEYARRLKKVADELEGELCIIMRAYLEKPRTTVGWKGLINDPDVNNSFNINKGLQC 133

Query: 135 SRELFTNLVEK-MPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R+LF NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 134 ARQLFVNLTSAGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 193

Query: 194 KNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVILRGGKTGTNYDAE 253
           KNGTDG + V++DAM AA+HSH+F+ VTK G  AI  T+GN   FVILRGG  GTNYDA+
Sbjct: 194 KNGTDGTMGVAIDAMLAASHSHHFMGVTKHGFAAITTTKGNEHCFVILRGGTKGTNYDAK 253

Query: 254 NVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSIYEQLTDGQNAICG 313
           +V + + +L         G T  +M+DCSHGNS+KDYRNQPKV  ++ EQ+ +G++ I G
Sbjct: 254 SVAEAKAQL-------PPGGT--LMVDCSHGNSNKDYRNQPKVNDAVCEQVANGEDKIIG 304

Query: 314 VMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLAKGVQNRR 367
           VMIES++ EG+Q +P E G+ GLKYG SITD CIGWETTEEVL  L+  V+ RR
Sbjct: 305 VMIESHINEGKQSIPPE-GKAGLKYGVSITDGCIGWETTEEVLRKLSNAVKQRR 357

>Scas_26.1
          Length = 183

 Score =  330 bits (845), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 155/167 (92%), Positives = 162/167 (97%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHE PIS KGHKTIVDAREQVC+ILNGKD
Sbjct: 3   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 62

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEY D+LAA S+K +KDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 63  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 122

Query: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSL 167
           DIDNSFQINKGLRISRE+FTNLVEK+PIAGEMLDTISPQFLSDCFS+
Sbjct: 123 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSV 169

>AFR270W [3462] [Homologous to NOHBY] complement(919886..921031)
           [1146 bp, 381 aa]
          Length = 381

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 135 SRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFK 194
           +R++   + E   +  ++LD     F+SD  SL  + AR+ +  L  ++ASGL   +  +
Sbjct: 126 TRDVLRAICEHTGVCLDILDNTLMNFVSDIPSLVVLDARSPDISL--KVASGLPSNVAVR 183

Query: 195 NGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVIL 241
                 +  ++  +   A    + +V+  G+   + T GN DTF+ L
Sbjct: 184 CRNANEIFSAIKILEHIAQPTLYPTVSHDGLPICIHTTGNPDTFLAL 230

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
           Saccharomyces cerevisiae YMR229c RRP5, hypothetical
           start
          Length = 1706

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 16/118 (13%)

Query: 239 VILRGGKTGTNYDAE----NVKKTQEEL-----VKAKIAEENGKTRRIMIDCSHGNSSKD 289
           ++  GG TG    +E     VK+ ++ L     V+ K+ E + + RRI++ C   N    
Sbjct: 603 IMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNE--- 659

Query: 290 YRNQPKVAQSIYEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACI 347
              + +  +SI E L  GQ+ I  V++E        ++P  G R G+ Y   I+D  I
Sbjct: 660 ---EAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIR-GVIYVGHISDERI 713

>YEL023C (YEL023C) [1401] chr5 complement(108504..110552) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.9143p [2049 bp, 682 aa]
          Length = 682

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 6/105 (5%)

Query: 183 LASGLSFPIGFKNGTDGGLQVSVDAMRAA-AHSHYFLSVTKPGVTAIVGTEGNSDTFVIL 241
           LA  + F + FK G          ++ +  A +H +LS   P   +++G   N D     
Sbjct: 414 LAEAIKFGVKFKPGAIHDFATKHTSIGSLFADTHDYLSFNSPKKCSLLGVSDNEDG---A 470

Query: 242 RGGKTGTNYDAENVKKTQEELVKAKIAEENGKTR-RIMIDCSHGN 285
           R  K+G N   E+  K  +E  +  + +E  K +    + C H N
Sbjct: 471 REDKSGRNERMEDCLKNIKE-TRLSLKDEKEKVKDAFTLKCGHAN 514

>CAGL0J08459g complement(839245..841650) similar to sp|P50896
           Saccharomyces cerevisiae YDR505c PSP1, start by
           similarity
          Length = 801

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 3/71 (4%)

Query: 279 IDCSHGNSSKDYRNQPKVAQSIYEQLTDGQNAICGVMIESNLVEGRQDV---PAEGGREG 335
           +D S+GN S    N PK A S +E   D  +      I   L+ G+ D+   P   G   
Sbjct: 179 MDYSNGNQSAGAWNNPKTALSGFEAQQDRNDGRRSSYISDTLIHGQYDIHNNPIPNGIAA 238

Query: 336 LKYGCSITDAC 346
           L++  S   A 
Sbjct: 239 LRHHSSAAGAM 249

>CAGL0D00572g complement(72970..76083) similar to sp|Q07468
           Saccharomyces cerevisiae YDL077c VAM6 Vacuolar
           carboxypeptidase Y, start by similarity
          Length = 1037

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 44/106 (41%), Gaps = 14/106 (13%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60
           + +   H     RL +WR + +  +       +E+P++       +D  E +CD+   KD
Sbjct: 132 ILVYTTHTPRVLRLFEWRKRSFQNV-------YEVPLN-------LDKTEIICDVSTIKD 177

Query: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEK 106
           D +V       + + K A    +++    KK   D +I     LE+
Sbjct: 178 DLVVTTNKATYLWNYKTAKPVMNKITKMVKKRTPDNIITALTELER 223

>KLLA0E20515g complement(1815696..1816982) similar to sp|P35183
           Saccharomyces cerevisiae YBL069w AST1 PMA1 protein
           targeting protein, start by similarity
          Length = 428

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 26/55 (47%)

Query: 239 VILRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQ 293
           ++L    +G N+   N+ +  +EL+    A  NGK  + + D    N   +Y N+
Sbjct: 229 IVLISSTSGMNFIKSNLPELVDELLFIDYAATNGKIYKPLSDLVASNELVEYNNE 283

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,155,526
Number of extensions: 523293
Number of successful extensions: 1375
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1371
Number of HSP's successfully gapped: 26
Length of query: 367
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 264
Effective length of database: 13,030,455
Effective search space: 3440040120
Effective search space used: 3440040120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)