Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.225201571568141e-113
Scas_248.1d1541315419e-72
KLLA0C05896g1581284837e-63
ACL018W1341274164e-53
Scas_587.9*128855670.67
Sklu_2043.224222622.1
CAGL0F01749g46966587.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22520
         (156 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22520                                                         318   e-113
Scas_248.1d                                                           213   9e-72
KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359 ...   190   7e-63
ACL018W [1031] [Homologous to NOHBY] complement(329990..330394) ...   164   4e-53
Scas_587.9*                                                            30   0.67 
Sklu_2043.2 , Contig c2043 4428-5156 reverse complement                28   2.1  
CAGL0F01749g 172820..174229 highly similar to sp|P37291 Saccharo...    27   7.6  

>Kwal_56.22520
          Length = 157

 Score =  318 bits (814), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%)

Query: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60
           MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN
Sbjct: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60

Query: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120
           QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ
Sbjct: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120

Query: 121 SEIEYLRDLLEQERGKVQLPVEPSGRHGRDAASAKE 156
           SEIEYLRDLLEQERGKVQLPVEPSGRHGRDAASAKE
Sbjct: 121 SEIEYLRDLLEQERGKVQLPVEPSGRHGRDAASAKE 156

>Scas_248.1d
          Length = 154

 Score =  213 bits (541), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%)

Query: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60
           MSA+AVKLG L+IRQVTRPVANVLKAQAKQHD FKRIC+ +AQ+MHR D  LR+RLTP N
Sbjct: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60

Query: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120
              K+RPLN+ +AVENGAT  SE FVFGVTGSVVVWET+RQR KE+NRREQV+ DISFLQ
Sbjct: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120

Query: 121 SEIEYLRDLLE 131
           SEIE LR L+E
Sbjct: 121 SEIEELRSLME 131

>KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359
           Candida albicans unknown function, start by similarity
          Length = 158

 Score =  190 bits (483), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 105/128 (82%)

Query: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60
           MSA+A+KLG LL+RQVTRP+ANVLK QAK+H  FK IC+G+AQKMH  D  LR++LTP  
Sbjct: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60

Query: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120
               +RPLND +AVENGAT LSE FVFGVTGSVVVWET+RQR KE++RREQV  DI+FLQ
Sbjct: 61  FSKTIRPLNDTKAVENGATLLSEGFVFGVTGSVVVWETLRQRQKELDRREQVTQDIAFLQ 120

Query: 121 SEIEYLRD 128
           SEIE LR 
Sbjct: 121 SEIEELRS 128

>ACL018W [1031] [Homologous to NOHBY] complement(329990..330394)
           [405 bp, 134 aa]
          Length = 134

 Score =  164 bits (416), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 105/127 (82%)

Query: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60
           MSALA KLG LLIRQVTRPVANVLK QAKQH  FK++C+ +AQ+MHR D KLR+RLTP  
Sbjct: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60

Query: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120
           Q  K+RPLND RAVENGAT LSE FVFGVTG+VVVWETVRQR KE++RREQV  DI  LQ
Sbjct: 61  QPKKIRPLNDERAVENGATLLSELFVFGVTGTVVVWETVRQRNKELDRREQVLQDIKELQ 120

Query: 121 SEIEYLR 127
            EI+ L+
Sbjct: 121 EEIDELK 127

>Scas_587.9*
          Length = 1288

 Score = 30.4 bits (67), Expect = 0.67,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%)

Query: 89   VTGSVVVWETVRQRAKEINRREQVASDISFLQSEIEYLRDLLEQERGKVQLPVEP 143
            VT    ++  V++  K+I   + V + I+ L  E+EY R + E  R + + P  P
Sbjct: 1206 VTTDKRMYNKVQEVKKQIAAEDGVKTAINCLYCELEYARSVTEDRRKRTKDPKNP 1260

>Sklu_2043.2 , Contig c2043 4428-5156 reverse complement
          Length = 242

 Score = 28.5 bits (62), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 105 EINRREQVASDISFLQSEIEYL 126
           E NRRE + SDI   Q +IE+L
Sbjct: 30  ETNRREIIPSDIELTQDDIEFL 51

>CAGL0F01749g 172820..174229 highly similar to sp|P37291
           Saccharomyces cerevisiae YLR058c SHM2 serine
           hydroxymethyltransferase, start by similarity
          Length = 469

 Score = 26.9 bits (58), Expect = 7.6,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 33/66 (50%)

Query: 52  LRTRLTPGNQEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQ 111
           L+   TP  +E + + L +A+A+EN    L    V   T S +V  ++R++  +  R E 
Sbjct: 307 LKQAATPEFKEYQTQVLKNAKALENEFQTLGYRLVSNGTDSHMVLVSLREKGVDGARVEY 366

Query: 112 VASDIS 117
           V   I+
Sbjct: 367 VCEKIN 372

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,241,214
Number of extensions: 148227
Number of successful extensions: 442
Number of sequences better than 10.0: 13
Number of HSP's gapped: 442
Number of HSP's successfully gapped: 13
Length of query: 156
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 63
Effective length of database: 13,376,635
Effective search space: 842728005
Effective search space used: 842728005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)