Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2251525625312311e-173
Kwal_46.165313812538841e-119
Kwal_55.1998164583730.26
Kwal_33.1542230274652.1
YNL001W (DOM34)386125616.7
Scas_683.37820111627.1
AAL072C122050627.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22515
         (253 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22515                                                         478   e-173
Kwal_46.16531                                                         345   e-119
Kwal_55.19981                                                          33   0.26 
Kwal_33.15422                                                          30   2.1  
YNL001W (DOM34) [4584] chr14 (627455..628615) Protein involved i...    28   6.7  
Scas_683.37                                                            28   7.1  
AAL072C [115] [Homologous to ScYDR293C (SSD1) - SH] (218958..222...    28   7.2  

>Kwal_56.22515
          Length = 256

 Score =  478 bits (1231), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/253 (92%), Positives = 233/253 (92%)

Query: 1   MSPYGSTKLPKEYAEHPQLALFYYSYMINKNLVTVTRSELTFEWPKPYVVLNTIVKRLEN 60
           MSPYGSTKLPKEYAEHPQLALFYYSYMINKNLVTVTRSELTFEWPKPYVVLNTIVKRLEN
Sbjct: 1   MSPYGSTKLPKEYAEHPQLALFYYSYMINKNLVTVTRSELTFEWPKPYVVLNTIVKRLEN 60

Query: 61  HTFIIQNKYKQLPYIVKNQIGKGIECPTNETIEELTPYVDPRKRRTISIRLGPKREALDF 120
           HTFIIQNKYKQLPYIVKNQIGKGIECPTNETIEELTPYVDPRKRRTISIRLGPKREALDF
Sbjct: 61  HTFIIQNKYKQLPYIVKNQIGKGIECPTNETIEELTPYVDPRKRRTISIRLGPKREALDF 120

Query: 121 FTELTDLKAAQSKDENLSKLEVRISCRQWFNSSLDVERTARNIRKLWVLEMILSGAXXXX 180
           FTELTDLKAAQSKDENLSKLEVRISCRQWFNSSLDVERTARNIRKLWVLEMILSGA    
Sbjct: 121 FTELTDLKAAQSKDENLSKLEVRISCRQWFNSSLDVERTARNIRKLWVLEMILSGAESSI 180

Query: 181 XXXXXXXXQETGLYSMFMREPSDAEMAIDHGVFWDKISXXXXXXXXPNEEGDDEEAFKRL 240
                   QETGLYSMFMREPSDAEMAIDHGVFWDKIS        PNEEGDDEEAFKRL
Sbjct: 181 EDEDEIEDQETGLYSMFMREPSDAEMAIDHGVFWDKISQLQQNQLLPNEEGDDEEAFKRL 240

Query: 241 PDCARRFDNLLEE 253
           PDCARRFDNLLEE
Sbjct: 241 PDCARRFDNLLEE 253

>Kwal_46.16531
          Length = 381

 Score =  345 bits (884), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 167/253 (66%), Positives = 194/253 (76%), Gaps = 1/253 (0%)

Query: 1   MSPYGSTKLPKEYAEHPQLALFYYSYMINKNLVTVTRSELTFEWPKPYVVLNTIVKRLEN 60
           +SPYGSTKLPKEY+EHPQLALFYYSYMINKN  +  RSELTFEWPKPYVVLNTIVKRLE+
Sbjct: 41  VSPYGSTKLPKEYSEHPQLALFYYSYMINKNTASAARSELTFEWPKPYVVLNTIVKRLES 100

Query: 61  HTFIIQNKYKQLPYIVKNQIGKGIECPTNETIEELTPYVDPRKRRTISIRLGPKREALDF 120
           H F+++NKY QLP IVK  IG+GIECPTN++IEELTP++DPRKR  I IRLGPKREALDF
Sbjct: 101 HIFVVRNKYTQLPSIVKKHIGEGIECPTNDSIEELTPFLDPRKRHPIIIRLGPKREALDF 160

Query: 121 FTELTDLKAAQSKDENLSKLEVRISCRQWFNSSLDVERTARNIRKLWVLEMILSGAXXXX 180
           FTELTDL+AAQSK ENLSKLEVRISCRQWF SSLDVER+AR IR+LW+LEM++S A    
Sbjct: 161 FTELTDLEAAQSKYENLSKLEVRISCRQWFGSSLDVERSARTIRRLWLLEMVMSRA-ESI 219

Query: 181 XXXXXXXXQETGLYSMFMREPSDAEMAIDHGVFWDKISXXXXXXXXPNEEGDDEEAFKRL 240
                   QE  + +    E S +   IDH  FWD++S        P+E GD+E+   RL
Sbjct: 220 QQAAAAEDQEPTVDNESQGESSGSGPPIDHAAFWDELSQLERNQLLPDEHGDEEDTLTRL 279

Query: 241 PDCARRFDNLLEE 253
            DCA R   LL+E
Sbjct: 280 SDCAGRAQKLLDE 292

>Kwal_55.19981
          Length = 645

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 51  LNTIVKRLENHTFIIQNKYKQLPYIVKNQIGKGIECPTNETIEELTPYVDPRKRRTISIR 110
           L   VKRL     ++QN+Y   PY+V +  G  I    +  ++  +  V+ R++     R
Sbjct: 56  LEFFVKRLN----MLQNRYNIRPYLVFD--GDAITVKKDTEVKRKSKRVESREKALALWR 109

Query: 111 LGPKREALDFFTELTDLKAAQSK 133
            G KR+A ++F +  D+    +K
Sbjct: 110 SGEKRQAYEYFQKCVDVTPEMAK 132

>Kwal_33.15422
          Length = 302

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 75  IVKNQIGKGIECPTNETIEELTPYVDPRKRRTISIRLGPKREALDFFTELTD-LKAAQSK 133
           IV + + +GIE P+ E  EEL  Y+  R+    ++++    E   F  E  D +KAA S 
Sbjct: 149 IVDDSVFEGIEPPSKEIFEELRLYI-SRRLTPQAVKIRADIEVSCFSYEGIDAIKAALSA 207

Query: 134 DENLSKLEVRISCR 147
            E +S  +++I  +
Sbjct: 208 AEEMSTEQMQIKAK 221

>YNL001W (DOM34) [4584] chr14 (627455..628615) Protein involved in
           protein translation [1161 bp, 386 aa]
          Length = 386

 Score = 28.1 bits (61), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 11/125 (8%)

Query: 40  LTFEWPKPYVVL----NTIVKRLENHTFIIQNKYKQLPYIVKNQIGKGIECPTNETI-EE 94
            T ++  P+ ++    N  +++L N    I+ K      +++  I       ++ TI ++
Sbjct: 107 FTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQ 166

Query: 95  LTPYVDPRKRRTISI-RLGPKREALDFFTELTDLKAAQSKDENLSKLEVRISCRQWFNSS 153
              Y  P+K+RT  + +   K E   F+  +    +A  KD N  KL+  I C   F + 
Sbjct: 167 KIEYSMPKKKRTTDVLKFDEKTEK--FYKAIY---SAMKKDLNFDKLKTIILCSPGFYAK 221

Query: 154 LDVER 158
           + +++
Sbjct: 222 ILMDK 226

>Scas_683.37
          Length = 820

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 22/111 (19%)

Query: 52  NTIVKRLENHTFIIQNKYKQLPYIVKNQIGKGIECPTNETIEELTPYVDPRKRRTISIRL 111
           N +++  E++  I+  K K +   +++   K IE    ++ +ELTPY+D +         
Sbjct: 648 NDVLQNSESNEKILLKKLKTISRAIESVSSKNIELINGKSEDELTPYIDSK--------- 698

Query: 112 GPKREALDFFTELTDLKAAQS--KDENLSKLEVRISCRQWFNSSLDVERTA 160
                      E+ DLK   +  + E  +K+E+R S R      +++ERT 
Sbjct: 699 ---------IQEIDDLKKEVTFFRREMKNKIELRQSAR--LKKYVELERTG 738

>AAL072C [115] [Homologous to ScYDR293C (SSD1) - SH] (218958..222620)
            [3663 bp, 1220 aa]
          Length = 1220

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 51   LNTIVKRLENHTFIIQ-NKYKQLPYIVKNQIGKGIECPTNETIEELTPYV 99
            LN ++ R+E   +I + ++ K++P +++ +IG  + C    T+  L P+ 
Sbjct: 1171 LNDVITRVEGDNYIQEIHELKKVPILLRAEIGMALPC---LTVRALNPFT 1217

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,651,878
Number of extensions: 293368
Number of successful extensions: 725
Number of sequences better than 10.0: 11
Number of HSP's gapped: 723
Number of HSP's successfully gapped: 11
Length of query: 253
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 154
Effective length of database: 13,168,927
Effective search space: 2028014758
Effective search space used: 2028014758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)