Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2250540339817950.0
ACL016C3613538471e-111
KLLA0C05962g3663998271e-108
Scas_611.23362536941e-88
YMR005W (TAF4)3882536651e-83
CAGL0J11726g3362506541e-82
Scas_697.1061049691.8
CAGL0C01199g92275663.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22505
         (398 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22505                                                         696   0.0  
ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH] (331298..33...   330   e-111
KLLA0C05962g complement(527216..528316) similar to sp|P50105 Sac...   323   e-108
Scas_611.2                                                            271   1e-88
YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA po...   260   1e-83
CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces...   256   1e-82
Scas_697.10                                                            31   1.8  
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    30   3.9  

>Kwal_56.22505
          Length = 403

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/398 (87%), Positives = 348/398 (87%)

Query: 1   MAKSPKRQAPITQDVPRAKKPKTEEQEGVFEIKERAFEQGGANVNGSPGKTDSSTEFSTP 60
           MAKSPKRQAPITQDVPRAKKPKTEEQEGVFEIKERAFEQGGANVNGSPGKTDSSTEFSTP
Sbjct: 1   MAKSPKRQAPITQDVPRAKKPKTEEQEGVFEIKERAFEQGGANVNGSPGKTDSSTEFSTP 60

Query: 61  FGGNVEEGRTSASLPESASPSINLVEGQSAKDSDDRKKNRGGGSQQQYQKAGGPAAKRSV 120
           FGGNVEEGRTSASLPESASPSINLVEGQSAKDSDDRKKNRGGGSQQQYQKAGGPAAKRSV
Sbjct: 61  FGGNVEEGRTSASLPESASPSINLVEGQSAKDSDDRKKNRGGGSQQQYQKAGGPAAKRSV 120

Query: 121 MTQSTATVXXXXXXXXXXXXXXXXXXKMQTDPDKLSDALFSAGVDIREEEALLNSSMNIT 180
           MTQSTATV                  KMQTDPDKLSDALFSAGVDIREEEALLNSSMNIT
Sbjct: 121 MTQSTATVQHPSQQQSQAPNQQQASSKMQTDPDKLSDALFSAGVDIREEEALLNSSMNIT 180

Query: 181 KSSXXXXXXXXXXXXXXXXXXXHPTHIASFMKKVGSEQNFNQDFSKAHDVLSLMSTACEF 240
           KSS                   HPTHIASFMKKVGSEQNFNQDFSKAHDVLSLMSTACEF
Sbjct: 181 KSSAQAGAQAINNQIPPQPPLLHPTHIASFMKKVGSEQNFNQDFSKAHDVLSLMSTACEF 240

Query: 241 FMTDIITNSLVISRHRRRSIKLNSGRRSEVSRALRDLAIXXXXXXXXXXXXXISMGLEKE 300
           FMTDIITNSLVISRHRRRSIKLNSGRRSEVSRALRDLAI             ISMGLEKE
Sbjct: 241 FMTDIITNSLVISRHRRRSIKLNSGRRSEVSRALRDLAIQQKEQEERRVKRRISMGLEKE 300

Query: 301 TAEAKMETDETLHRASNATANMMIAGGKKKYSWLNAGAKANNNSVKVLGKVSSDVAARGE 360
           TAEAKMETDETLHRASNATANMMIAGGKKKYSWLNAGAKANNNSVKVLGKVSSDVAARGE
Sbjct: 301 TAEAKMETDETLHRASNATANMMIAGGKKKYSWLNAGAKANNNSVKVLGKVSSDVAARGE 360

Query: 361 IGIRYREAREEPGIVMRDLLNALENRRVGVNKVIPKGY 398
           IGIRYREAREEPGIVMRDLLNALENRRVGVNKVIPKGY
Sbjct: 361 IGIRYREAREEPGIVMRDLLNALENRRVGVNKVIPKGY 398

>ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH]
           (331298..332383) [1086 bp, 361 aa]
          Length = 361

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 225/353 (63%), Gaps = 35/353 (9%)

Query: 48  PGKTDSSTEFSTPFGGNV--EEGRTSASLPESASPSINLVEGQSAKDSDDRKKNRGGGSQ 105
           P  +D S +  TPF   V  +E    A LPES  P+  L        S   +K     S 
Sbjct: 37  PTGSDFSNDMPTPFDNFVGQDEQSNRAELPESGQPATTLALPAGGAGSGAGRK-----SP 91

Query: 106 QQYQKAGGPAAKRSVMTQSTATVXXXXXXXXXXXXXXXXXXKMQTDPDKLSDALFSAGVD 165
           Q+ Q+AG        M ++                      K Q+DPDKLSDAL SAGVD
Sbjct: 92  QKMQRAG--------MRRAAGA----------------GAPKQQSDPDKLSDALLSAGVD 127

Query: 166 IREEEALLNSSMNITKSSXXXXXXXXXXXXXXXXXXXHPTHIASFMKKVGSEQNFNQDFS 225
           I+EEEALL+S++   KS+                   HP+H+AS MKKV +EQNFNQDFS
Sbjct: 128 IKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFL----HPSHVASMMKKVAAEQNFNQDFS 183

Query: 226 KAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGRRSEVSRALRDLAIXXXXXX 285
           K+ ++LSLMSTACE ++ DIITNS++ISRHRR+++KLNSGRRSE +R LRDLA+      
Sbjct: 184 KSSELLSLMSTACELYIRDIITNSIIISRHRRKAVKLNSGRRSETTRVLRDLALKQREQE 243

Query: 286 XXXXXXXISMGLEKETAEAKMETDETLHRASNATANMMIAGGKKKYSWLNAGAKANNNSV 345
                  I++GLEKE  + K+++ ETLHRASNATANMMIAGGKKKYSWL +G+K N   +
Sbjct: 244 ERRVKRRIALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKKYSWLTSGSKVNATDL 303

Query: 346 KVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALENRRVGVNKVIPKGY 398
           K  GKVSS VAARG++GI++REAREEPGIVMRDLL+ALENRRVGVN  I KGY
Sbjct: 304 KNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVGVNNTIAKGY 356

>KLLA0C05962g complement(527216..528316) similar to sp|P50105
           Saccharomyces cerevisiae YMR005w MPT1 required for
           protein synthesis singleton, start by similarity
          Length = 366

 Score =  323 bits (827), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/399 (47%), Positives = 248/399 (62%), Gaps = 39/399 (9%)

Query: 1   MAKSPKRQAPITQDVPRAKKPKTEEQEGVFEIKERAFEQGGANVNGSPGKTDSSTEFSTP 60
           MAKSPKR+    +D+   K+ K             +FE G       P  +D  ++  TP
Sbjct: 1   MAKSPKRKNSEPEDLSSNKRSK-------------SFEFGKVENGLEPSGSDFGSDLPTP 47

Query: 61  FGGNVEEGRTSASLPESASPSINLVEGQSAKDSDDRKKNRGGGSQQQYQKAGGPAAKRSV 120
           F   V E     +LP+++SP+ NL    S ++S          + +Q QKA     K++ 
Sbjct: 48  FDTMVTE--QPLALPKASSPTTNLA---SPRNSSTPNLKTTSTTSKQSQKA---EQKKNA 99

Query: 121 MTQSTATVXXXXXXXXXXXXXXXXXXKMQTDPDKLSDALFSAGVDIREEEALLNSSMNIT 180
              + +T                     Q+DPDKLSDAL SAGVDIREEEALL+S++  T
Sbjct: 100 GGSTGSTTASTTK-------------PQQSDPDKLSDALLSAGVDIREEEALLSSTVART 146

Query: 181 KSSXXXXXXXXXXXXXXXXXXXHPTHIASFMKKVGSEQNFNQDFSKAHDVLSLMSTACEF 240
           K++                   HP +I+ FMK++ SEQNF+QDF+K  D+L LMSTACE 
Sbjct: 147 KATGISANNQVPSHPPFL----HPKNISDFMKRIASEQNFHQDFNKNTDILGLMSTACEL 202

Query: 241 FMTDIITNSLVISRHRRRSIKLNSGRRSEVSRALRDLAIXXXXXXXXXXXXXISMGLEKE 300
           +M D+ITNSL++S HRR+ +KLN+GRRSEVSR+LRDLA+             I++GLEK+
Sbjct: 203 YMRDVITNSLILSIHRRKGVKLNTGRRSEVSRSLRDLALRQKTQEERRVQRRIALGLEKQ 262

Query: 301 TAEAKMETDETLHRASNATANMMIAGG-KKKYSWLNAGAKANNNSVKVLGKVSSDVAARG 359
           T +A+++T+ET +RASNATAN+MIAGG KKKYSWL AG+K+++  +K  G VSS VAARG
Sbjct: 263 TTDARLDTEETQYRASNATANLMIAGGNKKKYSWLTAGSKSSSTDLKNQGNVSSAVAARG 322

Query: 360 EIGIRYREAREEPGIVMRDLLNALENRRVGVNKVIPKGY 398
           E+GI+YREAREEPGIVMRDLL ALENRRVGVN VI KGY
Sbjct: 323 EMGIKYREAREEPGIVMRDLLLALENRRVGVNNVITKGY 361

>Scas_611.2
          Length = 336

 Score =  271 bits (694), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 141/253 (55%), Positives = 178/253 (70%), Gaps = 8/253 (3%)

Query: 149 QTDPDKLSDALFSAGVDIREEEALLNSSMNITKSSXXXXXXXXXXXXXXXXXXXHPTHIA 208
           Q+DP+K+ D LFSAGVDIREEEALLNSS+  +K+                    HP  +A
Sbjct: 84  QSDPNKMQDVLFSAGVDIREEEALLNSSIIASKN----KINTMDVRIPSHPPFLHPDQVA 139

Query: 209 SFMKKVGSEQN--FNQDFSKAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGR 266
            FM++V  EQ     QDFSK  ++LS+MSTACE +M DI+TN+LVISRHRRR+IKLN+GR
Sbjct: 140 RFMQRVAKEQQRRTRQDFSKYPELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGR 199

Query: 267 RSEVSRALRDLAIXXXXXXXXXXXXXISMGLEKETAEAKMETDETLHRASNATANMMIAG 326
           RSE+S  LR++A+             I++GLEKE  E K++++ETLHRASN TA +  AG
Sbjct: 200 RSEISMILRNIALKEKKDEEKRVKKRIALGLEKEDLENKIDSEETLHRASNVTAGLR-AG 258

Query: 327 GKKKYSWLNAG-AKANNNSVKVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALEN 385
            KK+Y WL +  +K  N SVK  GKV+SD+AARGE G+++REAREEPGIVMRDLL ALEN
Sbjct: 259 SKKQYGWLTSSVSKPTNTSVKSAGKVASDIAARGETGLKFREAREEPGIVMRDLLYALEN 318

Query: 386 RRVGVNKVIPKGY 398
           RR GV+ VI KGY
Sbjct: 319 RRNGVHNVISKGY 331

>YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA
           polymerase II general transcription factor TFIID [1167
           bp, 388 aa]
          Length = 388

 Score =  260 bits (665), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 131/253 (51%), Positives = 175/253 (69%), Gaps = 6/253 (2%)

Query: 147 KMQTDPDKLSDALFSAGVDIREEEALLNSSMNITKSSXXXXXXXXXXXXXXXXXXXHPTH 206
           + Q+DP+K+ D LFSAG+D+REEEALLNSS+N +KS                    HP  
Sbjct: 136 QQQSDPNKMQDVLFSAGIDVREEEALLNSSINASKS----QVQTNNVKIPNHLPFLHPEQ 191

Query: 207 IASFMKKVGSEQNFNQDFSKAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGR 266
           ++++M+KVG EQNFN   +K  ++L +MS+ACE +M DI+TN++VISRHRR+++K+NSGR
Sbjct: 192 VSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGR 251

Query: 267 RSEVSRALRDLAIXXXXXXXXXXXXXISMGLEKETAEAKMETDETLHRASNATANMMIAG 326
           RSEVS ALR +A+             I++GLEKE  E K++++ETLHRASN TA +  AG
Sbjct: 252 RSEVSAALRAIALIQKKEEERRVKKRIALGLEKEDYENKIDSEETLHRASNVTAGLR-AG 310

Query: 327 GKKKYSWLNAGA-KANNNSVKVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALEN 385
            KK+Y WL +   K  +   K  GKV+SD+ ARGE G+++REAREEPGIVMRDLL ALEN
Sbjct: 311 SKKQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALEN 370

Query: 386 RRVGVNKVIPKGY 398
           RR  V  +I KGY
Sbjct: 371 RRNSVQTIISKGY 383

>CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces
           cerevisiae YMR005w MPT1 required for protein synthesis,
           hypothetical start
          Length = 336

 Score =  256 bits (654), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 175/250 (70%), Gaps = 8/250 (3%)

Query: 150 TDPDKLSDALFSAGVDIREEEALLNSSMNITKSSXXXXXXXXXXXXXXXXXXXHPTHIAS 209
           TDP+K+ D L SAGVD++EEEALL+S++N++K+                    HP  +++
Sbjct: 89  TDPNKMQDVLISAGVDLKEEEALLSSTVNVSKTQQNAVVIPPHPPFL------HPDQVSN 142

Query: 210 FMKKVGSEQNFNQDFSKAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGRRSE 269
           FMKKV   QNFN  F+K  ++L +MS+ACE ++ DIITN++V+SRHRR+ +K+N GRRS+
Sbjct: 143 FMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGRRSQ 202

Query: 270 VSRALRDLAIXXXXXXXXXXXXXISMGLEKETAEAKMETDETLHRASNATANMMIAGGKK 329
           V+ ALR +AI             I++GLEKE  E KM+++ETLHRASN TA +  AG KK
Sbjct: 203 VAAALRSIAINQKKEEERRMKKRIALGLEKEDYENKMDSEETLHRASNVTATLR-AGSKK 261

Query: 330 KYSWLNAGA-KANNNSVKVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALENRRV 388
           +Y WL +   K  +  VK  GKV++++AARGE G+++REAREEPGIVMRDLL ALE+RR+
Sbjct: 262 QYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMRDLLFALEHRRI 321

Query: 389 GVNKVIPKGY 398
           GV+ +I KGY
Sbjct: 322 GVHNIISKGY 331

>Scas_697.10
          Length = 610

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 295 MGLEK--ETAEAKMETDETLHRASNATANMMIAGGKKKYSWLNAGAKAN 341
           + LEK   TA  K  TDE   +  N+  N +IAG   K SW N+    N
Sbjct: 437 VNLEKSTHTARIKCRTDEDARKLYNSINNRLIAGSIIKASWENSNEIEN 485

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, hypothetical
           start
          Length = 922

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 14  DVPRAKKPKTEEQEGVFEIKERAFEQGGANVNGSPGKTDSSTEFS-TPFGGNVEEGRTSA 72
           D+   K P T +   +  ++ +  E+   N NGS G+ +SS   S TP   N      S 
Sbjct: 545 DLLNTKSPSTFDGISMDMVQNQTTERKNENNNGSIGRNNSSNNISMTPLNTNTTSSGISD 604

Query: 73  SLPESASPSI-NLVE 86
              ++ASPSI +L+E
Sbjct: 605 FAGKTASPSIPHLIE 619

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.125    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,318,689
Number of extensions: 375094
Number of successful extensions: 1121
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1106
Number of HSP's successfully gapped: 30
Length of query: 398
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 294
Effective length of database: 12,995,837
Effective search space: 3820776078
Effective search space used: 3820776078
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)