Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2249952752027090.0
Sklu_2419.353153114480.0
KLLA0C06006g51239213051e-176
ACL014C52439412731e-171
Scas_644.1051252412221e-164
YMR004W (MVP1)51139211741e-157
CAGL0J11704g50943111701e-156
Kwal_23.28964212051478e-10
ACR074W4102511334e-08
Scas_690.224281881317e-08
KLLA0C10967g400771228e-07
Scas_663.19169971062e-05
ADR390C163971034e-05
CAGL0G06424g164971018e-05
CAGL0J01001g430761004e-04
YOR357C (GRD19)16274946e-04
Kwal_23.343861475970.001
Sklu_2167.4349107930.002
Kwal_26.6858160107890.003
ADR211W60098930.004
YOR069W (VPS5)67574910.006
KLLA0E09141g63634890.009
KLLA0F16643g66574880.012
Scas_712.3335796860.017
CAGL0L10472g638148860.021
YDL113C (ATG20)64034840.037
Scas_613.21649109840.041
CAGL0H10428g75330830.052
Sklu_2428.664778830.056
YJL036W (SNX4)423174820.059
Sklu_2219.263432820.076
ADR192C60380810.082
Kwal_47.1907934583800.086
Kwal_23.3773991105780.24
Sklu_1971.416567730.32
Scas_322.217667730.34
Scas_580.318363720.47
Scas_698.32699147740.60
Kwal_55.2153315967690.95
YKR078W585107721.0
Sklu_2221.567181711.3
CAGL0I01144g17397691.4
Sklu_2286.5463147683.2
Sklu_2404.316362653.3
YER170W (ADK2)225107654.4
KLLA0F10109g62334674.5
CAGL0I02002g30994647.4
Kwal_55.21745629105657.6
YML104C (MDM1)112780648.9
KLLA0F16709g531157649.2
Scas_714.5863680649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22499
         (520 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22499                                                        1048   0.0  
Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement        562   0.0  
KLLA0C06006g complement(530169..531707) similar to sp|P40959 Sac...   507   e-176
ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH] (333900..33...   494   e-171
Scas_644.10                                                           475   e-164
YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required fo...   456   e-157
CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces...   455   e-156
Kwal_23.2896                                                           61   8e-10
ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH] complement(...    56   4e-08
Scas_690.22                                                            55   7e-08
KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces c...    52   8e-07
Scas_663.19                                                            45   2e-05
ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH] (1410245.....    44   4e-05
CAGL0G06424g complement(621136..621630) highly similar to sp|Q08...    44   8e-05
CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces cer...    43   4e-04
YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protei...    41   6e-04
Kwal_23.3438                                                           42   0.001
Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement         40   0.002
Kwal_26.6858                                                           39   0.003
ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -...    40   0.004
YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorti...    40   0.006
KLLA0E09141g complement(817829..819739) similar to sgd|S0002271 ...    39   0.009
KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces...    39   0.012
Scas_712.33                                                            38   0.017
CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces...    38   0.021
YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein th...    37   0.037
Scas_613.21                                                            37   0.041
CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces...    37   0.052
Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement        37   0.056
YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sort...    36   0.059
Sklu_2219.2 YDL113C, Contig c2219 4054-5958                            36   0.076
ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)...    36   0.082
Kwal_47.19079                                                          35   0.086
Kwal_23.3773                                                           35   0.24 
Sklu_1971.4 YHR105W, Contig c1971 6476-6973                            33   0.32 
Scas_322.2                                                             33   0.34 
Scas_580.3                                                             32   0.47 
Scas_698.32                                                            33   0.60 
Kwal_55.21533                                                          31   0.95 
YKR078W (YKR078W) [3328] chr11 (584594..586351) Protein with sim...    32   1.0  
Sklu_2221.5 YDR425W, Contig c2221 7089-9104                            32   1.3  
CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces cer...    31   1.4  
Sklu_2286.5 , Contig c2286 6691-8082 reverse complement                31   3.2  
Sklu_2404.3 YOR357C, Contig c2404 1457-1948                            30   3.3  
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...    30   4.4  
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    30   4.5  
CAGL0I02002g complement(171015..171944) weakly similar to sp|P38...    29   7.4  
Kwal_55.21745                                                          30   7.6  
YML104C (MDM1) [3867] chr13 complement(58939..62322) Intermediat...    29   8.9  
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    29   9.2  
Scas_714.58                                                            29   9.6  

>Kwal_56.22499
          Length = 527

 Score = 1048 bits (2709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/520 (97%), Positives = 508/520 (97%)

Query: 1   MSFFDDLDDPWKSDQPASSSGVRNEWTTLNAGTFAGSEISATNPLNSPLNPDFGVTALDR 60
           MSFFDDLDDPWKSDQPASSSGVRNEWTTLNAGTFAGSEISATNPLNSPLNPDFGVTALDR
Sbjct: 1   MSFFDDLDDPWKSDQPASSSGVRNEWTTLNAGTFAGSEISATNPLNSPLNPDFGVTALDR 60

Query: 61  NVNDTSINSIGAIRLLSDHQEDVPREGWDESLDTTNHRVSSELVKGNMAAEEPFXXXXXX 120
           NVNDTSINSIGAIRLLSDHQEDVPREGWDESLDTTNHRVSSELVKGNMAAEEPF      
Sbjct: 61  NVNDTSINSIGAIRLLSDHQEDVPREGWDESLDTTNHRVSSELVKGNMAAEEPFVGAAVA 120

Query: 121 XXXXXXRQDFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSP 180
                 RQDFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSP
Sbjct: 121 DSASSGRQDFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSP 180

Query: 181 SSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINL 240
           SSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINL
Sbjct: 181 SSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINL 240

Query: 241 VVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWN 300
           VVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWN
Sbjct: 241 VVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWN 300

Query: 301 EADANIDTALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTN 360
           EADANIDTALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTN
Sbjct: 301 EADANIDTALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTN 360

Query: 361 VIGDHLGRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNV 420
           VIGDHLGRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNV
Sbjct: 361 VIGDHLGRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNV 420

Query: 421 PQLQRRIEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEY 480
           PQLQRRIEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEY
Sbjct: 421 PQLQRRIEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEY 480

Query: 481 VYFQEAQFLISDIFQRWVLLNMKYYELNSNEWDKLLQDVQ 520
           VYFQEAQFLISDIFQRWVLLNMKYYELNSNEWDKLLQDVQ
Sbjct: 481 VYFQEAQFLISDIFQRWVLLNMKYYELNSNEWDKLLQDVQ 520

>Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement
          Length = 531

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/531 (53%), Positives = 370/531 (69%), Gaps = 18/531 (3%)

Query: 1   MSFFDDLDDPWKSDQPAS----SSGVRNEWTTLNAGTFAGSEISATNPLNSPLNPDFGVT 56
           MSF D+  DPW SD P +    S     EW   N+     S I  T  L+S +N D  +T
Sbjct: 1   MSFVDE-PDPWASD-PVTVKDESGSATIEWPPSNSDPLGASSILNTATLSSRMN-DISLT 57

Query: 57  ALDRNVNDTSINSIGAIRLLSDHQ--EDVPREG-WDESLDTTNHRV---SSELVKGNMAA 110
               + ++T +    +  L ++H+  E V     W++    +N  V   S  ++ GN+ +
Sbjct: 58  V---DASNTQVGDFSSTNLFNNHRNGESVMEHSIWEDHPKQSNADVMIPSEPVLVGNVLS 114

Query: 111 EEPFXXXXXXXXXXXXRQD-FESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLV 169
           + P               D   +W EAVR +YNPL  DI++VEE+PEREG+LFKHTNYLV
Sbjct: 115 D-PLNASTSNKSTDDVFDDVLATWIEAVRTTYNPLSTDIVIVEEIPEREGILFKHTNYLV 173

Query: 170 RHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIK 229
           +HLI LPDT PSSDRSVIRRYSDFVWLQEVLLKKYPFRMIP+LPPK+IGSH+ D  F +K
Sbjct: 174 KHLIVLPDTDPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPELPPKKIGSHSADRAFLLK 233

Query: 230 RRNGLSRFINLVVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVK 289
           RR GLSRFINLV+KHPV   DDLVLTFLTVPTDL GWRKQASYDT++EFTD+K+S +F+K
Sbjct: 234 RRRGLSRFINLVMKHPVLNHDDLVLTFLTVPTDLSGWRKQASYDTTEEFTDKKISKSFMK 293

Query: 290 MWHKGLAERWNEADANIDTALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMP 349
           MW K LAE+WNEAD+ ID ALE WAKITVL++RY RR+  I++DR +  S++++FT+  P
Sbjct: 294 MWRKELAEQWNEADSKIDLALETWAKITVLVERYSRRLKQISEDRTLFESIVNEFTQTAP 353

Query: 350 HLFNSDDGSTNVIGDHLGRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLF 409
            L+  +  +   I  H G ++KH   CN+L S+E +E    L  +F+ F D + +LKGLF
Sbjct: 354 SLYPINKDTIEDINAHTGIITKHLSDCNQLTSKEIEETHLNLLVKFKIFIDMIFSLKGLF 413

Query: 410 ERYKAMAGNNVPQLQRRIEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRS 469
           ERYK +AGNN+ QLQRR+E+N + +  MK KPD++GAEYD+VKQ++QRD++ IAEQMNRS
Sbjct: 414 ERYKILAGNNIAQLQRRVELNIETMNNMKGKPDVRGAEYDKVKQAVQRDKRTIAEQMNRS 473

Query: 470 WLVRECILQEYVYFQEAQFLISDIFQRWVLLNMKYYELNSNEWDKLLQDVQ 520
           WL+RECIL+E+  FQE QF+I+  FQ W  LNMKY +LNSNEW++L   ++
Sbjct: 474 WLIRECILEEFTIFQETQFVITHSFQEWAKLNMKYADLNSNEWERLFDSLE 524

>KLLA0C06006g complement(530169..531707) similar to sp|P40959
           Saccharomyces cerevisiae YMR004w MVP1 required for
           vacuolar protein sorting singleton, start by similarity
          Length = 512

 Score =  507 bits (1305), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 224/392 (57%), Positives = 304/392 (77%)

Query: 129 DFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVIR 188
           ++++W E+VRK+Y PL  DI+ VEE+PEREGL+FKHTNYLV+HL  LP+T PS DR+V+R
Sbjct: 114 EYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDRTVVR 173

Query: 189 RYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVFK 248
           RYSDF WLQ+VLL+KYPFRM+P+LPPK+IGS   DP+F  KRR GLSRFINLV+KHPV +
Sbjct: 174 RYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPVLR 233

Query: 249 KDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADANIDT 308
            DDLVLTFLTVPTDL GWRKQA YDT+DEFTD+ +S +F+ +W K  +E+WN+AD  ID 
Sbjct: 234 SDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADERIDI 293

Query: 309 ALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTNVIGDHLGR 368
           AL+ W K+TVLI+RYE+RM  +A +R +L  +L+   +    L+     + + I + +G 
Sbjct: 294 ALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATVSQINEGVGL 353

Query: 369 VSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQRRIE 428
           + +H  SC +++ +EN+E    LS RF+ F D ++ALKGLFERYK MAGNN+PQLQRR+E
Sbjct: 354 IVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQRRVE 413

Query: 429 VNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQEAQF 488
           +N +RL  ++  PD+KGAEYDRVKQSI RD+++I +QMNRSWL+RECIL+E+  F E QF
Sbjct: 414 INQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFHETQF 473

Query: 489 LISDIFQRWVLLNMKYYELNSNEWDKLLQDVQ 520
           LI+D FQRW+ +N++Y   N + W+K+ + ++
Sbjct: 474 LITDCFQRWIEINLRYTNNNVDNWEKICKKLR 505

>ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH]
           (333900..335474) [1575 bp, 524 aa]
          Length = 524

 Score =  494 bits (1273), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 218/394 (55%), Positives = 306/394 (77%), Gaps = 1/394 (0%)

Query: 128 QDFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVI 187
           +D E+W  + RK+YNPL  +I+VVEE+PEREG+LFKHTNYLV+HL+ LP+T+PSS+++VI
Sbjct: 124 EDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVI 183

Query: 188 RRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVF 247
           RRYSDF WLQEVLLKKYPFRMIP+LPPK+IG+   DP+F  +RR GL RFINLV+ HPV 
Sbjct: 184 RRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVL 243

Query: 248 KKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADANID 307
           K+DDLVLTFLTVPTDL  WRKQA+YDT++EFTD+K+   F+ +WHK L+ +WN+ADA ID
Sbjct: 244 KQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKID 303

Query: 308 TALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGST-NVIGDHL 366
             LE W K +VL++RYERRM  ++++R +L  ++++F +    L+  ++G   + I  H+
Sbjct: 304 ELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHI 363

Query: 367 GRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQRR 426
             +SKH  S  +   +E QE  + LS +F+TF D ++ALKG+F+RYK MAGNN+  LQRR
Sbjct: 364 STISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRR 423

Query: 427 IEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQEA 486
           +E+N D+L+ M+  PD+KGAEYD+++Q+IQRD++ IAEQ+NRSWL+R+CIL+E+V FQE 
Sbjct: 424 VEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQET 483

Query: 487 QFLISDIFQRWVLLNMKYYELNSNEWDKLLQDVQ 520
           QF I+ +FQ W  +++KY    +  W+K+  ++Q
Sbjct: 484 QFCITHVFQEWAKMHVKYANETTESWEKVYANLQ 517

>Scas_644.10
          Length = 512

 Score =  475 bits (1222), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 230/524 (43%), Positives = 331/524 (63%), Gaps = 23/524 (4%)

Query: 1   MSFFDDLDDPWKSDQPASSSGVRNEWTTLNAGTFAGSEISATNPLNSPLNPDFGVTALDR 60
           M+ F D  DPW       S    NEW              AT     P N       +  
Sbjct: 1   MNTFGDDVDPW------GSRAATNEWAE-----------EATTTTQYPTNEQTTPATITT 43

Query: 61  NVNDTSINSIGAIRLLSDHQEDVPREGWDESLDTTNHRVSSELVKGNMAAEE--PFXXXX 118
            +N  S++  G   L +   + + +  W E+           +++ N+   +  P     
Sbjct: 44  GLNAVSLSGDGD--LFNSKTDILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQS 101

Query: 119 XXXXXXXXRQD-FESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPD 177
                   + + F  W + +RKSYNPL  DII +EE+PEREGLLFKHTNY V+HLI+LP 
Sbjct: 102 HEQSSELDQSELFGQWCDQIRKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPG 161

Query: 178 TSPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRF 237
              + D  V+RRYSDF+WLQE LL++YPFRM+P+LPPK++GS   D +F  KRR GL RF
Sbjct: 162 QDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRF 221

Query: 238 INLVVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAE 297
           INLV+KHPVF+KDDLVLTFLTVPT+L  WRKQAS+DTSDEF D++++ +FVKMWHKG++E
Sbjct: 222 INLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISE 281

Query: 298 RWNEADANIDTALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDG 357
           +WN A ++I+  +E+W++I +L++R+ER++  +A ++ I  S+++  +   P+L+  +  
Sbjct: 282 QWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQS 341

Query: 358 STNV-IGDHLGRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMA 416
            T + I +H   + KH     ++      + C  L P+F+ FTD LL+L+GLFERYK MA
Sbjct: 342 DTVLDINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMA 401

Query: 417 GNNVPQLQRRIEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECI 476
            NN+PQLQR + +N ++LE MK KPD  G EYDR+K SI RD+K+I+EQ+NR+WLVR+CI
Sbjct: 402 TNNIPQLQRHVVLNREKLEAMKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCI 461

Query: 477 LQEYVYFQEAQFLISDIFQRWVLLNMKYYELNSNEWDKLLQDVQ 520
           L+E+  FQE QF+++  FQ W  LN  +  +N NEW+KL + ++
Sbjct: 462 LEEFTIFQETQFMLTRAFQDWSKLNASFVGINLNEWEKLEEQLE 505

>YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required for
           sorting proteins to the vacuole, interacts genetically
           with Vps1p [1536 bp, 511 aa]
          Length = 511

 Score =  456 bits (1174), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/392 (56%), Positives = 294/392 (75%), Gaps = 1/392 (0%)

Query: 129 DFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVIR 188
           D   W+  VRK+Y PL ADII++EE+PEREGLLFKH NYLV+HLI LP TSPS +R+V+R
Sbjct: 112 DLLDWTNNVRKTYRPLDADIIIIEEIPEREGLLFKHANYLVKHLIALPSTSPSEERTVVR 171

Query: 189 RYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVFK 248
           RYSDF+WL+E+LLK+YPFRMIP+LPPKRIGS   D +F  KRR GLSRFINLV+KHP   
Sbjct: 172 RYSDFLWLREILLKRYPFRMIPELPPKRIGSQNADQLFLKKRRIGLSRFINLVMKHPKLS 231

Query: 249 KDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADANIDT 308
            DDLVLTFLTV TDL  WRKQA+YDTS+EF D+K+S  F+KMW K  AE+WN+A + IDT
Sbjct: 232 NDDLVLTFLTVRTDLTSWRKQATYDTSNEFADKKISQEFMKMWKKEFAEQWNQAASCIDT 291

Query: 309 ALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTNV-IGDHLG 367
           ++ELW +IT+L++R+E+R+  +  +R+   +++D F+E  P L+      T + I ++L 
Sbjct: 292 SMELWYRITLLLERHEKRIMQMVHERNFFETLVDNFSEVTPKLYPVQQNDTILDINNNLS 351

Query: 368 RVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQRRI 427
            + KH  + + +  QE +E    LSP+F+ FTD LL+L+ LFERYK MA NNV +LQR +
Sbjct: 352 IIKKHLETTSSICKQETEEISGTLSPKFKIFTDILLSLRSLFERYKIMAANNVVELQRHV 411

Query: 428 EVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQEAQ 487
           E+N ++LE MK KPD+ GAEYDR+K+ IQ+DR++I EQ NR+WL+R+CIL+E+  FQE Q
Sbjct: 412 ELNKEKLESMKGKPDVSGAEYDRIKKIIQKDRRSIIEQSNRAWLIRQCILEEFTIFQETQ 471

Query: 488 FLISDIFQRWVLLNMKYYELNSNEWDKLLQDV 519
           FLI+  FQ W  LN  +  L  NEW+KL+  +
Sbjct: 472 FLITRAFQDWAKLNSNHAGLKLNEWEKLVTSI 503

>CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces
           cerevisiae YMR004w MVP1 required for vacuolar protein
           sorting, hypothetical start
          Length = 509

 Score =  455 bits (1170), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/431 (51%), Positives = 289/431 (67%), Gaps = 3/431 (0%)

Query: 90  ESLDTTNHRVSSELVKGNMAAEEPFXXXXXXXXXXXXRQDFESWSEAVRKSYNPLVADII 149
           E+ D+ N  VS+   + N A   P              +  ESW   VRK+YNP   DII
Sbjct: 73  EAKDSLN--VSTNFNELNTAILSPTSSTSNIEEQNSFTESLESWINEVRKTYNPQQLDII 130

Query: 150 VVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKKYPFRMI 209
            +EE+PEREGLLFKH NY V+HLIDLP+T P  +R+V+RRYSDF+WLQEVLLK+YPFRMI
Sbjct: 131 SIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMI 190

Query: 210 PDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFLTVPTDLLGWRKQ 269
           PDLPPK+IGS   DPVF  KRR GLS+FINLV+KHP   KDDLVLTFLTVPTDL  WRKQ
Sbjct: 191 PDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQ 250

Query: 270 ASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADANIDTALELWAKITVLIDRYERRMAF 329
            SYDT+DEFTD+++S  FVK+W K LAE WN     ID  ++ W KI++L+DR+E+R+  
Sbjct: 251 VSYDTADEFTDKRISKDFVKIWKKDLAEIWNNTANCIDELIDKWTKISILVDRHEKRLQI 310

Query: 330 IAQDRDILRSMLDQFTEGMPHLFNSDDGSTNV-IGDHLGRVSKHFGSCNELVSQENQEAC 388
           IA +R I+  ++         ++  D   T + I   +  +SKH    NE  +Q+  +  
Sbjct: 311 IANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMTVISKHIEKTNENYNQQALDTK 370

Query: 389 KELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQRRIEVNSDRLEQMKDKPDLKGAEY 448
           +++ P+FR +TD L ALK +FERYK +A NNV  LQ+ I++N  +LE MK KPD  G EY
Sbjct: 371 QKVLPKFRMYTDILRALKNVFERYKMLATNNVSMLQKHIDLNLQKLEDMKGKPDASGQEY 430

Query: 449 DRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQEAQFLISDIFQRWVLLNMKYYELN 508
           DR+K +I++DRK + EQ NR+WL+RECIL+E+  FQE QF+I+  FQ W  +   Y  LN
Sbjct: 431 DRIKTTIRKDRKIMYEQSNRAWLIRECILEEFTIFQETQFMITGCFQEWAKVQSTYSSLN 490

Query: 509 SNEWDKLLQDV 519
            NEW+ +   +
Sbjct: 491 LNEWENVTNHI 501

>Kwal_23.2896
          Length = 421

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 93/205 (45%), Gaps = 33/205 (16%)

Query: 177 DTSPSSDRSVI---RRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFS----IK 229
           +T+P  +  +I   RRYSDF+ LQ +L + +P  +IP LP K++  +     FS     K
Sbjct: 58  NTTPLEEIDIIVVHRRYSDFLLLQSILSQDHPTCVIPPLPDKKVFQYIAGDRFSQSFTQK 117

Query: 230 RRNGLSRFINLVVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFV- 288
           R + L  F+  + +HP+  K  +++TFL +  D   +R+  S   S      +VS TF+ 
Sbjct: 118 RCHSLQNFLRRISEHPILSKSQVLMTFL-MSNDWEAYRRSLSGSLSG--NKEEVSDTFMN 174

Query: 289 --KMWHKG------LAERWNEADANI--------------DTALELWAKITVLIDRYERR 326
             K  H        + E+ ++ D N+              D   E +AK +  +   +  
Sbjct: 175 AFKTVHNQTEEFAEIKEKSDKLDHNVSKIDKVFHRVVKRQDAISEDYAKFSTNLQELQEL 234

Query: 327 MAFIAQDRDILRSMLDQFTEGMPHL 351
           +A    + + LRS    F EG+  L
Sbjct: 235 VADSTAEDETLRSKAKLFNEGVSQL 259

>ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH]
           complement(496156..497388) [1233 bp, 410 aa]
          Length = 410

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 112/251 (44%), Gaps = 33/251 (13%)

Query: 149 IVVEELPEREGLLFKHTNYLVRHLIDLPDT-----SPSSDRSVI-RRYSDFVWLQEVLLK 202
           I+V +  ++ G      +Y+   +   P T     S   D +V+ RRYSDFV L ++L  
Sbjct: 12  IIVSDPQKQRGDKSSSGSYVTYQISSKPATEGDKRSGEDDITVVHRRYSDFVLLYQILAN 71

Query: 203 KYPFRMIPDLPPKRIGSHTT--DPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFLTVP 260
            YP  ++P LP K++ ++       F+ KR + L  F+  + +HPV  +  ++ TFL V 
Sbjct: 72  DYPACIVPPLPDKKVLNYLDRFSQSFTQKRCHSLQNFLQRLAQHPVLSQSKILHTFL-VS 130

Query: 261 TDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHK---------GLAERWNEADANIDTALE 311
           +D   ++K  +    +     +++ T +  +            + E+  + D N+     
Sbjct: 131 SDWDAYQKSLAETVGNLSNKEELTETIMNAFKSVHSQSDEFVEIKEKSGKLDHNV----- 185

Query: 312 LWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTNVIGDHLGRVSK 371
             +KI  L  R  ++   IA+D   L   L +  E    L  + D   + +G+ LG   K
Sbjct: 186 --SKIDKLFHRVVKKQEAIAEDYGKLGLSLRELQE----LVTTGDDRNSEVGN-LGTKIK 238

Query: 372 HFGSCNELVSQ 382
            F   NE ++Q
Sbjct: 239 TF---NEGMAQ 246

>Scas_690.22
          Length = 428

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 82/188 (43%), Gaps = 23/188 (12%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFS----IKRRNGLSRFINLV 241
           V RRYSD V L ++L+  +P  +IP LP K++  +     FS     KR + L  F+  V
Sbjct: 77  VHRRYSDLVLLHDILMNDHPTCIIPPLPDKKVLQYIAGDRFSQRFTQKRCHSLQNFLRRV 136

Query: 242 VKHPVFKKDDLVLTFLTVPTDLLGWRKQASYD---TSDEFTD---------RKVSVTFVK 289
             HP+  K  ++ TFL +  D   +RK  S +     +E TD          K S  FV+
Sbjct: 137 SLHPILSKSKILETFL-IDADWDAYRKSLSGNIQTNKEEVTDAFMNAFKTVHKQSEEFVE 195

Query: 290 MWHKG--LAERWNEADANIDTALELWAKITVLIDRYERRMA----FIAQDRDILRSMLDQ 343
           +  K   L    ++ D N     +    I+    + E+ +      I+ D + L   L  
Sbjct: 196 IKEKSDKLDHTLSKLDKNFHKMTKKNESISEDYGKLEQTLQDLNELISGDNEPLGRKLKF 255

Query: 344 FTEGMPHL 351
           F EG+  L
Sbjct: 256 FNEGITQL 263

>KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4 singleton, hypothetical start
          Length = 400

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 4/77 (5%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFS----IKRRNGLSRFINLV 241
           V+RRY+DFV L ++L+  +P  ++P LP K++ ++ +   FS     KR   L  F+  +
Sbjct: 52  VVRRYNDFVLLHQILINDHPALLVPPLPDKKVLNYLSGDRFSHSFTQKRCRSLQTFMRRL 111

Query: 242 VKHPVFKKDDLVLTFLT 258
           + H    K  ++ TFLT
Sbjct: 112 LSHSELSKSRILETFLT 128

>Scas_663.19
          Length = 169

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 165 TNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKK------YPFRMIPDLPPKRIG 218
           T+Y +    +LP+   S +  V RRYSDF + ++ LLK+      +P  MIP LP K   
Sbjct: 64  TDYEIVCHTNLPNFK-SRNSKVRRRYSDFEFFKKCLLKEISMFTNHPRIMIPHLPGKIFL 122

Query: 219 SHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLT 255
           ++  +P    +R  GL +++  V  HP+ +    VL 
Sbjct: 123 NNRFNPEVIEERMQGLDKWLKTVAGHPLLQSGSKVLV 159

>ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH]
           (1410245..1410736) [492 bp, 163 aa]
          Length = 163

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 6/97 (6%)

Query: 164 HTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKK-----YPFRMIPDLPPKRIG 218
           +T+YLV    +LP + P     V RRYSDF + +  L K+     +P  +IP LP K + 
Sbjct: 58  YTDYLVVCRTNLP-SFPQRVSHVRRRYSDFEFFKRCLFKELSLSAHPRVVIPALPGKILW 116

Query: 219 SHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLT 255
           +         +RR GL+++++ V  HP+ +    VL 
Sbjct: 117 ARRFHDEVIEERREGLAQWLSTVAGHPLLQSGSKVLV 153

>CAGL0G06424g complement(621136..621630) highly similar to sp|Q08826
           Saccharomyces cerevisiae YOR357c GRD19, hypothetical
           start
          Length = 164

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 8/97 (8%)

Query: 164 HTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKKY-----PFRMIPDLPPK-RI 217
           +T+Y +    +LP+    + R V RRYSDF + ++ LLK+      P  ++P LP K  +
Sbjct: 59  YTDYEIICRTNLPNFHKRASR-VRRRYSDFEFFRKCLLKEISMLNNPRVVVPHLPGKIYL 117

Query: 218 GSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVL 254
            +  +D V   +RR GL+R++ +V  HP+ +     L
Sbjct: 118 SNRFSDEVIE-ERRQGLNRWMQIVAGHPLLQSGSKTL 153

>CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4, hypothetical start
          Length = 430

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDP----VFSIKRRNGLSRFINLV 241
           V RRY+D V L ++L   +P  +IP LP K++  +         F+ +R + L  F+  V
Sbjct: 80  VHRRYNDVVLLHDILQNDHPTCIIPPLPDKKVLQYIAGDRFGRRFTQRRCHSLQNFLRRV 139

Query: 242 VKHPVFKKDDLVLTFL 257
            +HP+     ++  FL
Sbjct: 140 SQHPILSTSKVLEIFL 155

>YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protein
           involved in retrieval of late Golgi membrane proteins
           from the prevacuolar compartment [489 bp, 162 aa]
          Length = 162

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 186 VIRRYSDFVWLQEVLLKK-----YPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINL 240
           V RRYSDF + ++ L+K+     +P  M+P LP K + S+        +RR GL+ ++  
Sbjct: 78  VRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQS 137

Query: 241 VVKHPVFKKDDLVL 254
           V  HP+ +    VL
Sbjct: 138 VAGHPLLQSGSKVL 151

>Kwal_23.3438
          Length = 614

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 11/75 (14%)

Query: 143 PLVAD-IIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLL 201
           PL  D + ++E     EG    +  Y +++           D+ V RRYSDF  L+++L+
Sbjct: 135 PLSGDKVYILEASKASEGQGRTYIAYTIKY----------GDKVVKRRYSDFESLRKILI 184

Query: 202 KKYPFRMIPDLPPKR 216
           K +P  +IP +P K+
Sbjct: 185 KLFPMSLIPPIPEKQ 199

>Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement
          Length = 349

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 185 SVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIG-----SHTTDPVFSIKRRNGLSRFIN 239
           +V RR+S+FV L++ L +++   +  +LPP+  G     SH+ DP    +R++ LS F+ 
Sbjct: 42  TVSRRFSEFVSLKKQLEQEFNAELPYELPPRHYGFWNKSSHSCDPQVIQERKSKLSTFLL 101

Query: 240 LVVKHPV---FKKDDLVLTFLTVPTD------LLGWRKQASYDTSDE 277
            ++       +KK   +  FL +P +      L    +Q+   TSDE
Sbjct: 102 DLLNDSFDTRWKKSPFLCHFLQLPGNWDTQDVLPSHTRQSFTHTSDE 148

>Kwal_26.6858
          Length = 160

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 11/107 (10%)

Query: 155 PEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKK-----YPFRMI 209
           P++ G+   +T+Y V    ++P  S    + V RRYS+F   ++ L+K+     +P  ++
Sbjct: 49  PDQHGM---YTDYEVICRTNVPAFSKRMSK-VRRRYSEFELFRKCLIKELSLSSHPKVVV 104

Query: 210 PDLPPK-RIGSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLT 255
           P LP K  +G+   D V   +R+ GL++++  V  HP+ +    VL 
Sbjct: 105 PHLPGKILLGNRFNDEVIE-ERKQGLNKWLVAVAGHPLLQSGSKVLV 150

>ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -
           SH] complement(1072310..1074112) [1803 bp, 600 aa]
          Length = 600

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 162 FKHTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPK-RIGSH 220
           F H  Y VR    L      ++ SV RRY DF WL   L   +  ++IP  P K ++G  
Sbjct: 219 FSHVEYSVRTRSPLVG---DAEVSVQRRYRDFRWLYRQLQSNHWGKVIPPPPDKQKVGRF 275

Query: 221 TTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFLT 258
             D  F   RR  + R +  + ++   + D   L FLT
Sbjct: 276 KQD--FIENRRFQMERMLQRIAQNAALQNDQDFLLFLT 311

>YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorting
           nexin family involved in Golgi retention and vacuolar
           sorting [2028 bp, 675 aa]
          Length = 675

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR-IGSHTTDPVFSIKRRNGLSRFINLVVKH 244
           V RRY DF WL   L   +  ++IP  P K+ +GS   +  F   RR  +   +  + + 
Sbjct: 317 VSRRYRDFRWLYRQLQNNHWGKVIPPPPEKQSVGSFKEN--FIENRRFQMESMLKKICQD 374

Query: 245 PVFKKDDLVLTFLT 258
           PV +KD   L FLT
Sbjct: 375 PVLQKDKDFLLFLT 388

>KLLA0E09141g complement(817829..819739) similar to sgd|S0002271
           Saccharomyces cerevisiae YDL113c, start by similarity
          Length = 636

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 183 DRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR 216
           D  V RRYSDF  L++VL+K +P  +IP +P K+
Sbjct: 190 DSIVKRRYSDFESLRKVLVKLFPISLIPPIPEKQ 223

>KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w VPS5 involved in Golgi retention and
           vacuolar sorting, start by similarity
          Length = 665

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR-IGSHTTDPVFSIKRRNGLSRFINLVVKH 244
           V RRY DF WL   L   +  ++IP  P K+ +G    D  F   RR  + R +  +  +
Sbjct: 306 VKRRYRDFRWLYRQLQHNHWGKIIPPPPEKQAVGRFKQD--FIENRRAQMERMLQHIASN 363

Query: 245 PVFKKDDLVLTFLT 258
            V +KD+  + FLT
Sbjct: 364 HVLQKDEDFILFLT 377

>Scas_712.33
          Length = 357

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 15/96 (15%)

Query: 183 DRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIG---------SHTTDPVFSIKRRNG 233
           DR + +R+S+F+ L+  L K++   +  +LP +  G         + + DPV + +RR  
Sbjct: 49  DRHIYKRFSEFLELKRRLEKEFNSELPYELPSRHHGPIFNVWTRSTTSIDPVITEERRIQ 108

Query: 234 LSRFINLVVKHPV---FKKDDLVLTFLTVPTDLLGW 266
           L++F++ ++       +K  +LV  FL +P   L W
Sbjct: 109 LAKFVSDMLNDSFDTKWKNSELVRVFLQLP---LNW 141

>CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w, start by similarity
          Length = 638

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 63/148 (42%), Gaps = 13/148 (8%)

Query: 127 RQDFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSV 186
           +QD E   E V   +   V D I V EL         H  Y V    +L   SP+ ++ V
Sbjct: 228 QQDIED--EPVISHFQIEVTDPIKVGELTS------SHIKYTVNAESEL--LSPNQNQ-V 276

Query: 187 IRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPV 246
            RRY DF WL   L   +  ++IP  PP++    T  P F   RR  L   +  +     
Sbjct: 277 SRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQTVGTFQPEFVETRRLQLQTMLRRIANDSD 335

Query: 247 FKKDDLVLTFLTVPTDLLGWRKQASYDT 274
            ++D+    FLT   +     K+ SY+T
Sbjct: 336 LQRDEHFHMFLT-SDNFAEDSKRVSYET 362

>YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein that
           may play a role in vesicular transport, has similarity
           to human SNX1 [1923 bp, 640 aa]
          Length = 640

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 183 DRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR 216
           + +V RRYSDF  L+ +L++ +P  +IP +P K+
Sbjct: 186 NSTVQRRYSDFESLRSILIRLFPMTLIPPIPEKQ 219

>Scas_613.21
          Length = 649

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 34/109 (31%)

Query: 183 DRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR---------IGSHT-----TDPVFSI 228
           D  V RRYSDF  L+ VL++ +P  +IP +P K           GS +     +DP  S+
Sbjct: 201 DVCVRRRYSDFESLRNVLVRLFPITLIPPIPEKESIKTYGKAIAGSSSKYQLPSDPAGSV 260

Query: 229 --------------------KRRNGLSRFINLVVKHPVFKKDDLVLTFL 257
                                R   L++F+N ++++P   K  ++  FL
Sbjct: 261 DLTLSVINGSVNNRDEKLIRHRIRMLTQFLNKLLQNPEIMKTTIISDFL 309

>CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces
           cerevisiae YDL113c, hypothetical start
          Length = 753

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRMIPDLPPK 215
           V RRYSDF  L+ +L+K +P  +IP +P K
Sbjct: 316 VRRRYSDFESLRSILVKLFPLMVIPPIPEK 345

>Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement
          Length = 647

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 3/78 (3%)

Query: 182 SDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR-IGSHTTDPVFSIKRRNGLSRFINL 240
           S+  V RRY DF WL   L      R+IP  P K+ +G    D  F   RR  + R +  
Sbjct: 283 SECQVKRRYRDFRWLYRQLQNNNWGRIIPPPPEKQTVGRFKED--FIESRRFQMERMLKK 340

Query: 241 VVKHPVFKKDDLVLTFLT 258
           +    + +KD+  + FLT
Sbjct: 341 ISSDSILQKDEDFIMFLT 358

>YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sorting
           protein, possibly involved in proteasome function [1272
           bp, 423 aa]
          Length = 423

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 75/174 (43%), Gaps = 11/174 (6%)

Query: 180 PSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFS----IKRRNGLS 235
           P S   V RRYSD + L ++LL ++P  +IP LP K++  +     FS     KR + L 
Sbjct: 69  PESIIVVHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSLQ 128

Query: 236 RFINLVVKHPVFKKDDLVLTFLTVPTDLLGWRK--QASYD-TSDEFTDRKVSVTFVKMWH 292
            F+  V  HP   +  +  TFL V  D    RK  Q S     DE TD    +   K  H
Sbjct: 129 NFLRRVSLHPDLSQSKVFKTFL-VSKDWESHRKVLQDSLQPNKDEVTD--AFMNAFKTVH 185

Query: 293 KGLAERWNEADANIDTALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTE 346
           K   E + E     D       KI  L  +  ++   +++D   L S L +  E
Sbjct: 186 KQ-NEEFTEIREKSDKLDRTVTKIDKLFHKVVKKNDSMSEDYTKLGSNLQELQE 238

>Sklu_2219.2 YDL113C, Contig c2219 4054-5958
          Length = 634

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 24/32 (75%)

Query: 185 SVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR 216
           +V RRYS+F  L+++L+K +P  +IP +P K+
Sbjct: 188 TVRRRYSEFESLRKILVKLFPMTLIPPIPEKQ 219

>ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)
           [1812 bp, 603 aa]
          Length = 603

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 14/80 (17%)

Query: 184 RSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR-IGSHTTDPVFS-------IKRRNGLS 235
           R V RRYS+F  L++ L +  P  +IP +P K  +  +  +P+ +        KRR  LS
Sbjct: 154 RQVTRRYSEFDSLRQALARLLPTVIIPPIPSKHPLIRYFLNPLNAENDIRIIEKRRRLLS 213

Query: 236 RFINL------VVKHPVFKK 249
           RF+N       + +H VF+K
Sbjct: 214 RFLNNCHDITDIREHTVFQK 233

>Kwal_47.19079
          Length = 345

 Score = 35.4 bits (80), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 188 RRYSDFVWLQEVLLKKYPFRMIPDLPPKRIG-----SHTTDPVFSIKRRNGLSRFINLVV 242
           RR+SDFV L++ L ++    +  +LPP+R       S + DP    +R   LS F++ ++
Sbjct: 46  RRFSDFVKLKKDLEQEVGSELPYELPPRRFNKWMRPSGSCDPDVIEERVKELSTFLHDLL 105

Query: 243 KHPV---FKKDDLVLTFLTVPTD 262
                  +KK   V  FL +P+D
Sbjct: 106 NDSFDTRWKKSPYVCHFLQIPSD 128

>Kwal_23.3773
          Length = 991

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 13/105 (12%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRMIPDLPPK-RIGSHTTDPVFSIKRRNGLSRFINLVVKH 244
           + + YSDF  L   L K++P + +P LP + +IG  +T    +  + +           +
Sbjct: 293 IAKTYSDFKHLVSDLRKEFPGKELPKLPHQSKIGVSSTTSFENSSQADP--------ADN 344

Query: 245 PVFKKDDLVLTF---LTVPTDLLGWRKQASYDTSDEFTDRKVSVT 286
           P   K+ +V TF    + PTD L        D SDEF D K SVT
Sbjct: 345 PTTPKEKIVSTFEEEKSSPTDSLTDYTDGQ-DESDEFQDAKESVT 388

>Sklu_1971.4 YHR105W, Contig c1971 6476-6973
          Length = 165

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRM---IPDLPPK-------RIGSHTTDPVFSIKRRNGLS 235
           + +RYSDF  L+  L++  P  +   IP LPPK       R      D  +  KRR GL 
Sbjct: 80  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 139

Query: 236 RFINLVV 242
            F+N V+
Sbjct: 140 YFLNQVL 146

>Scas_322.2
          Length = 176

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRM---IPDLPPK-------RIGSHTTDPVFSIKRRNGLS 235
           + +RYSDF  L+  L++  P  +   IP LPPK       R      D  +  KRR GL 
Sbjct: 91  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 150

Query: 236 RFINLVV 242
            F+N V+
Sbjct: 151 YFLNQVL 157

>Scas_580.3
          Length = 183

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 188 RRYSDFVWLQEVLLKKYPFRM-IPDLPPK-------RIGSHTTDPVFSIKRRNGLSRFIN 239
           +RYSDFV  +  ++ K   RM IP LPP        +      D  +  KRR GL RF+ 
Sbjct: 102 KRYSDFVAFRNSIMNKLGDRMEIPSLPPGVPWYDSWKYQDVNFDKKWLAKRRRGLERFLE 161

Query: 240 LVV 242
            V+
Sbjct: 162 QVL 164

>Scas_698.32
          Length = 699

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 63/147 (42%), Gaps = 14/147 (9%)

Query: 147 DIIVVEELPEREG-LLFKHTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKKYP 205
           DI+V +  P + G L   H  Y+V     + ++  S    V RRY DF WL   L   + 
Sbjct: 302 DIVVKD--PRKVGELTSAHIEYMVVAEAKILESGCSI---VYRRYRDFRWLYRQLQNNHW 356

Query: 206 FRMIPDLPPKR-IGSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFLT---VPT 261
            ++IP  P K+ +G    D  F   RR  +   +  +      + D   + FLT    P 
Sbjct: 357 GKIIPPPPEKQAVGRFKQD--FIENRRLQMENMLQTIASSDSLQNDSDFILFLTSKDFPQ 414

Query: 262 DLLGWRKQASYDTSDEFTDRKVSVTFV 288
           D      ++  +  ++  D  +S+T++
Sbjct: 415 DCKKREYESGSNACNDSGD--LSITYI 439

>Kwal_55.21533
          Length = 159

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 186 VIRRYSDFVWLQEVLLKKYPFRM---IPDLPPK-------RIGSHTTDPVFSIKRRNGLS 235
           + +RYSDFV  +E L+     ++   IP LPPK       R         +  +RR GL 
Sbjct: 74  IYKRYSDFVRFREELMATLSPKLRTGIPALPPKLSWFDSWRYDDANFKSAWLARRRAGLE 133

Query: 236 RFINLVV 242
            F+N V+
Sbjct: 134 FFLNQVL 140

>YKR078W (YKR078W) [3328] chr11 (584594..586351) Protein with
           similarity to Uso1p [1758 bp, 585 aa]
          Length = 585

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 23/107 (21%)

Query: 178 TSPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRI------------------GS 219
           T P  ++++ R +SDF WL   L   +  + IP  PP R                    +
Sbjct: 141 TQPDVEKTIARAFSDFYWLYHQLQNNHWGKTIP--PPTRSNILVEKDEFAINHLFMIRNN 198

Query: 220 HTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFLTVPTDLLGW 266
              DP+F+ K    +S  +  ++KH +F  +D VL   +   D + W
Sbjct: 199 EKYDPIFNFKPEYIISLQLMAMIKH-IF--NDKVLRLDSNFIDFISW 242

>Sklu_2221.5 YDR425W, Contig c2221 7089-9104
          Length = 671

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 14/81 (17%)

Query: 183 DRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR-IGSHTTDPVFSI-------KRRNGL 234
           ++ V RRYS+F  L++ L +  P  +IP +P K  +  +  +P+ +        KR+  L
Sbjct: 206 NKQVTRRYSEFDTLRQALCRLLPSVIIPPIPSKHPLIKYFLNPLNAENDVKIIDKRKRLL 265

Query: 235 SRFINL------VVKHPVFKK 249
           + F+N       + +H VFKK
Sbjct: 266 TSFLNSCYYTDEIKEHVVFKK 286

>CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces
           cerevisiae YHR105w, start by similarity
          Length = 173

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 176 PDTSPSSDRSVIRRYSDFVWLQEVLL----KKYPFRM--IPDLPPK-------RIGSHTT 222
           P++S S      +RYSDFV  +  LL     K P  +  IP+LPP        +      
Sbjct: 73  PNSSGSYRIHTYKRYSDFVEFRNALLDRVRTKRPASVSEIPELPPPVKWYYSWKYNEINL 132

Query: 223 DPVFSIKRRNGLSRFINLVV--KHPVFKKDDLVLTFL 257
           +  +   RR GL  FIN V+   + V    DLV+ FL
Sbjct: 133 NKEWLANRRKGLELFINQVLLNGNIVDIAKDLVIQFL 169

>Sklu_2286.5 , Contig c2286 6691-8082 reverse complement
          Length = 463

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 59/147 (40%), Gaps = 15/147 (10%)

Query: 287 FVKMWHKGLAERWNEADA--NIDTA----LELWAKITVLIDRYERRMAFIAQDRDILRSM 340
           F K + K  AER N+++   NI T+    + +W    + +         +     I  S 
Sbjct: 229 FPKDYLKQAAERINDSNPGLNITTSDVQTMYVWCAFEINVRGRSDMCDVLTMQELINFSY 288

Query: 341 LDQFTEGMPHLFNSDDGSTNVIGDHLGRVSKHFGSCNELVSQENQEACKELSPRFRTFTD 400
            D  TE   H      G  N +G  +G V   F +  +L+++EN      LS    T   
Sbjct: 289 YDDLTEFYEH------GPGNSLGKTVGSVL--FNASLQLLTEENPSNKIWLSFTHDTDIS 340

Query: 401 TLLALKGLFERYKAMAGNNVPQLQRRI 427
             LA  GLF+  K M   + P+ Q  +
Sbjct: 341 NFLAAVGLFDTGKNMTSKH-PEFQGHV 366

>Sklu_2404.3 YOR357C, Contig c2404 1457-1948
          Length = 163

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%)

Query: 194 VWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLV 253
             ++E+ L  +P  ++P LP K + S+  +     +RR GL +++  V  HP+ +    V
Sbjct: 92  CLVKELALSSHPRVVVPHLPGKILLSNRFNDEIIEERRQGLQQWLLNVAGHPLLQSGSKV 151

Query: 254 LT 255
           L 
Sbjct: 152 LV 153

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 41/107 (38%), Gaps = 7/107 (6%)

Query: 228 IKRRNGLSRFINLVVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTF 287
           IK  + L R     +       DDL+   +T     LGW K ++    D F       + 
Sbjct: 54  IKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQAS- 112

Query: 288 VKMWHKGLAERWNEADANIDTALELWAKITVLIDRYERRMAFIAQDR 334
                  L E   + DA+++  +EL    + +++R E R   +   R
Sbjct: 113 ------ALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGR 153

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 365 HLGRVSKHFGSCNELVSQ--ENQEACKELSPRFR 396
           H GR  KHF S NE +    EN+E C+ + P F+
Sbjct: 323 HCGRCKKHFDSTNEWIEHHIENRE-CEAILPTFK 355

>CAGL0I02002g complement(171015..171944) weakly similar to sp|P38852
           Saccharomyces cerevisiae YHR156c, hypothetical start
          Length = 309

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 16/94 (17%)

Query: 419 NVPQLQRRIEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQ 478
           NV Q++R+  VN+     +K++P  K   YD +K  I + +          WL ++ +  
Sbjct: 221 NVYQMKRQDLVNA-----IKEEPTSKDGPYDPIKDRIWQYK----------WLGKDKVYG 265

Query: 479 EYVYFQEAQFLISDIFQRWVLLNMKYYELNSNEW 512
            Y  + E Q+   + FQ  VL+ +  Y  + N W
Sbjct: 266 FYTCY-EMQYWKENYFQNRVLVRLNSYSESDNYW 298

>Kwal_55.21745
          Length = 629

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 7/105 (6%)

Query: 155 PEREG-LLFKHTNYLVRHLIDLPDTSPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLP 213
           P++ G L   H  Y +   +   D   + +  V RRY DF WL   L   +  ++IP  P
Sbjct: 243 PQKVGDLTSAHVEYTI---LSKSDNLNNPEVRVQRRYRDFRWLYRQLQNNHWGKIIPPPP 299

Query: 214 PKR-IGSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFL 257
            K+ +G    D  F   RR  + R +  + +    ++D   + FL
Sbjct: 300 EKQTVGRFKDD--FIENRRFQMERMLTKISQDKDLQEDVDFVMFL 342

>YML104C (MDM1) [3867] chr13 complement(58939..62322) Intermediate
           filament protein involved in organelle inheritance and
           in the regulation of mitochondrial morphology [3384 bp,
           1127 aa]
          Length = 1127

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 188 RRYSDFVWLQEVLLKKYP--FRMIPDLPPKRIGS----HTTDPVFSIKRRNGLSRFINLV 241
           RRY++F  L   L K +    R + DL P ++      H T  +   +R+  L +++  +
Sbjct: 823 RRYNEFFELNTYLKKNFRDLMRQLQDLFPSKVKMSLKYHVTKTLLYEERKQKLEKYLREL 882

Query: 242 VKHPVFKKDDLVLTFLTVPT 261
           +      +D++   FLT PT
Sbjct: 883 LSISEICEDNIFRRFLTDPT 902

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 54/157 (34%), Gaps = 28/157 (17%)

Query: 218 GSHTTDPVFSIKRRNGLSRFINLVVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDE 277
           G    DP F +  RNGL RF  +    PV    +  L    V  ++      +SYD  +E
Sbjct: 220 GISKNDPFFDVNERNGLGRFQFVQGYEPVILNHNSPLFIAPVADEM-----DSSYDELEE 274

Query: 278 FTDRK----VSVTFVKMWHKGLAERWNEADANIDTALELW------------AKITVLID 321
                        F+  W   +  RW     N+     LW             K TV   
Sbjct: 275 LRKENEIDPQDYYFLNYWFSKML-RWIAVFINLIIITPLWFIWFIISGIMETCKSTVRAT 333

Query: 322 RYERR--MAFIAQDRDI----LRSMLDQFTEGMPHLF 352
            + R+  M FI +  DI      S  D F+   P LF
Sbjct: 334 TFARKYSMYFITEVLDISTDRTESNDDTFSISSPTLF 370

>Scas_714.58
          Length = 636

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 14/80 (17%)

Query: 184 RSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKR-IGSHTTDPV-------FSIKRRNGLS 235
           + V RRYS+F  L +VL +  P  +IP +P K  + ++  +P+          KR+   +
Sbjct: 195 KRVTRRYSEFDSLYQVLKRLLPTIVIPPIPTKHPLINYLINPINVNNDTKIIDKRKRKFN 254

Query: 236 RFIN------LVVKHPVFKK 249
            F+N       +  H VF+K
Sbjct: 255 SFLNNCNDIPEIRNHVVFQK 274

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,498,333
Number of extensions: 760805
Number of successful extensions: 2323
Number of sequences better than 10.0: 72
Number of HSP's gapped: 2353
Number of HSP's successfully gapped: 72
Length of query: 520
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 414
Effective length of database: 12,926,601
Effective search space: 5351612814
Effective search space used: 5351612814
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)