Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2249728027713540.0
Sklu_2419.42992558231e-110
ACL013C2632647581e-101
KLLA0C06028g3052577131e-93
YOL009C (MDM12)2712716873e-90
CAGL0E02365g2572596723e-88
Scas_644.112722606482e-84
Scas_638.24455651028e-05
KLLA0F15796g434112973e-04
Sklu_2275.5454161910.002
Kwal_33.1516944259860.008
AAL166C44467850.010
YLL006W (MMM1)42660830.019
Kwal_14.155436461710.48
CAGL0D05698g43153671.8
AER411W118943662.2
YLR144C (ACF2)77961653.5
ACR218W156932627.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22497
         (277 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22497                                                         526   0.0  
Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement        321   e-110
ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH] (335717..3...   296   e-101
KLLA0C06028g complement(532044..532961) some similarities with s...   279   1e-93
YOL009C (MDM12) [4807] chr15 complement(309324..310139) Mitochon...   269   3e-90
CAGL0E02365g complement(226360..227133) similar to sp|Q92328 Sac...   263   3e-88
Scas_644.11                                                           254   2e-84
Scas_638.24                                                            44   8e-05
KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces...    42   3e-04
Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement         40   0.002
Kwal_33.15169                                                          38   0.008
AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315...    37   0.010
YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential f...    37   0.019
Kwal_14.1554                                                           32   0.48 
CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces c...    30   1.8  
AER411W [2911] [Homologous to ScYOR086C - SH; ScYNL087W - SH] co...    30   2.2  
YLR144C (ACF2) [3553] chr12 complement(429678..432017) Endo-1,3-...    30   3.5  
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    28   7.8  

>Kwal_56.22497
          Length = 280

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/277 (94%), Positives = 261/277 (94%)

Query: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60
           MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS
Sbjct: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60

Query: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEIDYKG 120
           NPLEEFYEHISNERLADEIEASSSNLRGEDHFH                LQFLVEIDYKG
Sbjct: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHGENDDSGKDEKDSDSDLQFLVEIDYKG 120

Query: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180
           DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD
Sbjct: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180

Query: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240
           AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR
Sbjct: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240

Query: 241 TILKTEAAWPSWINLDFNEEYSEDEASDETQSDKKLD 277
           TILKTEAAWPSWINLDFNEEYSEDEASDETQSDKKLD
Sbjct: 241 TILKTEAAWPSWINLDFNEEYSEDEASDETQSDKKLD 277

>Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement
          Length = 299

 Score =  321 bits (823), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 162/255 (63%), Positives = 191/255 (74%), Gaps = 8/255 (3%)

Query: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60
           MSFEINW+ L ED  +N SIKDF N HL+SISLPSYV +++VT+F LG  PP ITL++I 
Sbjct: 19  MSFEINWDKLQEDTRINQSIKDFFNDHLRSISLPSYVNNVQVTNFSLGNIPPHITLKQID 78

Query: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEIDYKG 120
           +PLEEFY +IS E   ++IE++S  +  +                    +QFLVEIDYKG
Sbjct: 79  DPLEEFYGYISKES-NEKIESTSDEIEHDPQ-------CPIVMDGKQNDIQFLVEIDYKG 130

Query: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180
           DMLI V AEL LNYPSP FMTLPVKL+ISD+GMH+LCL+AYLSKQLFISFLCDV+DPILD
Sbjct: 131 DMLIEVGAELVLNYPSPTFMTLPVKLSISDIGMHSLCLIAYLSKQLFISFLCDVSDPILD 190

Query: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240
             ES +DT    F+  RSLERISLIRSIKI SEIGE    EGS LRSVG+LEQFL+E+FR
Sbjct: 191 NSESILDTNGPNFMSKRSLERISLIRSIKIQSEIGEYKDGEGSTLRSVGKLEQFLVEIFR 250

Query: 241 TILKTEAAWPSWINL 255
             L+ EAAWPSWINL
Sbjct: 251 NALRKEAAWPSWINL 265

>ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH]
           (335717..336511) [795 bp, 264 aa]
          Length = 263

 Score =  296 bits (758), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/264 (54%), Positives = 191/264 (72%), Gaps = 27/264 (10%)

Query: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60
           MSF+INW  + ED  +N   + FLN HL+S+ LPSYV ++++TDF LG  PP+ITL++I 
Sbjct: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60

Query: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEIDYKG 120
           NPL++FYE +  E          +++ G D                   +QFL+E+DYKG
Sbjct: 61  NPLDDFYEALRLE---------GASIGGRDD------------------VQFLMEVDYKG 93

Query: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180
           DMLI +SAEL LNYPSP+FM LPVKLTISD+ +H+LCLVAYL +QLFISFL  V+D  LD
Sbjct: 94  DMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALD 153

Query: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240
             ES +D+   AFLG++++ERISLIRSIKI +EIG Q+ +EG++LRSVG+LEQFL +VF+
Sbjct: 154 NVESPLDSNGPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFK 213

Query: 241 TILKTEAAWPSWINLDFNEEYSED 264
            +L+ EAAWPSWINLDFNE+ S D
Sbjct: 214 NLLRKEAAWPSWINLDFNEDVSAD 237

>KLLA0C06028g complement(532044..532961) some similarities with
           sp|Q92328 Saccharomyces cerevisiae YOL009c MDM12
           involved in mitochondrial inheritance singleton,
           hypothetical start
          Length = 305

 Score =  279 bits (713), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 181/257 (70%), Gaps = 22/257 (8%)

Query: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60
           MS EI+W+++  D  VN  +KDFLNS LQ   LPSYV +L+VT+F LG  PP + L+++ 
Sbjct: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60

Query: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEIDYKG 120
           +PL+EFY ++  E    +I   ++  +  D                   +Q LVE+DYKG
Sbjct: 61  DPLDEFYSYLLQE---GDISKEAAKDKNTD-------------------VQLLVELDYKG 98

Query: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180
           DM I +SA+L LNYPSP FM LPVKL ISD+GMH LCL+AYL KQLFISFLCDV+DP+L+
Sbjct: 99  DMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLE 158

Query: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240
             +  +D     F+G R+LERISLIR+IKI +E+G+ +  EGSVLRSVG+LE+FL+++FR
Sbjct: 159 NDKLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFR 218

Query: 241 TILKTEAAWPSWINLDF 257
            +++ EAAWPSWI+LDF
Sbjct: 219 NLIRKEAAWPSWIDLDF 235

>YOL009C (MDM12) [4807] chr15 complement(309324..310139)
           Mitochondrial inheritance protein which may function in
           a complex with Mdm10p at the mitochondrial surface [816
           bp, 271 aa]
          Length = 271

 Score =  269 bits (687), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 138/271 (50%), Positives = 182/271 (67%), Gaps = 15/271 (5%)

Query: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60
           MSF+INW +L  D  +N+ I+  LNS+LQ+  LPSYV +LRV DF LG   P ITL+EI+
Sbjct: 1   MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEIT 60

Query: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHXXXXXXXX------------XXXXXXX 108
           +PL+EFY+ I  E  AD+ E   +N   ED  H                           
Sbjct: 61  DPLDEFYDSIREE--ADQ-ETEENNDNKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPN 117

Query: 109 XLQFLVEIDYKGDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFI 168
            +QFL+E++YKGD+L+T+ A+L LNYP   FMTLPVKL+ISD+G+H+LC+VA LSKQLF+
Sbjct: 118 DIQFLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFL 177

Query: 169 SFLCDVADPILDAQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSV 228
           SFLCDV+DP LD  ++ +D         + LERIS++RS+KI++EIGEQ   +GSVLRSV
Sbjct: 178 SFLCDVSDPALDDNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSV 237

Query: 229 GRLEQFLLEVFRTILKTEAAWPSWINLDFNE 259
           G LEQFL  +F+  L+ E AWPSWINLDFN+
Sbjct: 238 GELEQFLFTIFKDFLRKELAWPSWINLDFND 268

>CAGL0E02365g complement(226360..227133) similar to sp|Q92328
           Saccharomyces cerevisiae YOL009c MDM12, start by
           similarity
          Length = 257

 Score =  263 bits (672), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 124/259 (47%), Positives = 180/259 (69%), Gaps = 2/259 (0%)

Query: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60
           MSFEINWE L  D  + ++I++ LN + Q + LPSYV ++ + DF  G   P ITLREIS
Sbjct: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60

Query: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEIDYKG 120
           +PL++FY+ ++ E   +E   +SS + G D  +                 QFL+E +YKG
Sbjct: 61  SPLQDFYDAVNEE--YEEDNETSSEMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKG 118

Query: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180
           DM +T++AEL LNYP   FMTLP+K++IS++G+H+LCLV+YL+KQ+FIS LCDV+DP+LD
Sbjct: 119 DMSLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMLCDVSDPVLD 178

Query: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240
             +  +D      L N+ LERIS+IRS+KI++EIG++   +GS LRSVG+LE+F+++  +
Sbjct: 179 DVDCVLDPNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLK 238

Query: 241 TILKTEAAWPSWINLDFNE 259
             L+ E AWPSW+NLDFN+
Sbjct: 239 DFLRKELAWPSWVNLDFND 257

>Scas_644.11
          Length = 272

 Score =  254 bits (648), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 173/260 (66%), Gaps = 23/260 (8%)

Query: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60
           MSF INW  +G D  ++ ++KD L+S+LQ++SLPS+V +L++TDF  G   P I L+EI+
Sbjct: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60

Query: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEIDYKG 120
           +PL +FYE + NE L +  E  +                           QFL+E++YKG
Sbjct: 61  DPLPDFYESV-NEGLVEGDEGWT--------------------IPSPSDTQFLIEVEYKG 99

Query: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180
           D+ +T+S EL LNYPS  F+ LP+KL ++++G H+LCLVAYL+KQ+F+S LCDV+DPILD
Sbjct: 100 DLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILD 159

Query: 181 AQESN--IDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEV 238
            Q S   +D         +  ERIS+IRS+ ID+EIG+Q   EGS L++VG+LEQFLLE 
Sbjct: 160 EQNSEPLLDPNGTFMAPKKPFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEK 219

Query: 239 FRTILKTEAAWPSWINLDFN 258
           F+ +L+ E AWPSWINLD +
Sbjct: 220 FKDLLRKEIAWPSWINLDLS 239

>Scas_638.24
          Length = 455

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%)

Query: 110 LQFLVEIDYKGDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFIS 169
           LQ  ++ID    +   V  EL LNYP   F TLP+KL ++ +       V++ + + FIS
Sbjct: 288 LQAKIDIDMNDRLAFGVETELMLNYPRAAFATLPIKLNVAIVRFQGCLNVSFTTAEDFIS 347

Query: 170 FLCDV 174
              D 
Sbjct: 348 KSSDT 352

>KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1 required for mitochondrial shape
           and structure singleton, start by similarity
          Length = 434

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 3/112 (2%)

Query: 59  ISNPLEEFYEHISNE--RLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEI 116
           I N L +F E  SNE  +  D+I+ +  ++ G+D                   L+  ++I
Sbjct: 222 ILNSLNDFIERRSNELPQYLDQIKITEVDI-GDDFPIFSNCIIQYSPNSNKKRLEAKIDI 280

Query: 117 DYKGDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFI 168
           D    + + +  +L LNYP P    LP+KLT+S +   A   V+  + + F+
Sbjct: 281 DLSDRLALGIETKLLLNYPKPFSAALPIKLTVSIVRFQACLTVSLTTDEQFV 332

>Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement
          Length = 454

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 67/161 (41%), Gaps = 43/161 (26%)

Query: 8   ESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREISNPLEEFY 67
           E+L +D I++ S+ DF+    +S  LP Y+ S++VT+  +G   P  +   I       Y
Sbjct: 234 EALQKDNIIH-SLNDFI--QRKSTELPHYLSSIKVTELDIGDDFPIFSNCRIQ------Y 284

Query: 68  EHISNERLADEIEASSSNLRGEDHFHXXXXXXXXXXXXXXXXLQFLVEIDYKGDMLITVS 127
              SN++                                   L+  ++ID    + + + 
Sbjct: 285 SPNSNKK----------------------------------RLEAKIDIDLSDRLALGIE 310

Query: 128 AELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFI 168
            +L +NYP P    LPV+LT+S +   A   V+  + + F+
Sbjct: 311 TKLLMNYPKPFTAALPVQLTVSIVRFQACLTVSLTTDEEFV 351

>Kwal_33.15169
          Length = 442

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%)

Query: 110 LQFLVEIDYKGDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFI 168
           L+  ++ID    + + +  +L +NYP P    LPV+LT+S +   A   V+  + + F+
Sbjct: 285 LEAKIDIDLSDRLALGIETKLLINYPKPFTAALPVQLTVSVVRFQACLTVSLTAAEEFV 343

>AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315)
           [1335 bp, 444 aa]
          Length = 444

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%)

Query: 110 LQFLVEIDYKGDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFIS 169
           L+  ++ID    + + +   L +NYP     +LPVKLT+S L   A   V+  + + F+ 
Sbjct: 284 LEAKIDIDLSDRLTLGIETRLLMNYPKYLTASLPVKLTVSMLRFQACLTVSLTTAEEFVP 343

Query: 170 FLCDVAD 176
            +    D
Sbjct: 344 TMAATTD 350

>YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential for
           establishment and maintenance of mitochondrial shape and
           structure, involved in coupling mitochondria to the
           actin cytoskeleton, required for maintenance of
           mitochondrial genome [1281 bp, 426 aa]
          Length = 426

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 110 LQFLVEIDYKGDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFIS 169
           L+  ++ID    + + V  +L LNYP P    LP+ L +S +   A   V+  + + F S
Sbjct: 274 LEAKIDIDLNDHLTLGVETKLLLNYPKPGIAALPINLVVSIVRFQACLTVSLTNAEEFAS 333

>Kwal_14.1554
          Length = 364

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 11  GEDPIVNNSIKDFLNSHLQSISLPSYVG---SLRVTDFCLGCTPPKITLREISNPLEEFY 67
           GED I+   I+  +N   QSI      G    + +TD C+G    +  LR++SN +++  
Sbjct: 298 GEDKIIGVMIESHINEGKQSIPPEGKAGLKYGVSITDGCIGWETTEEVLRKLSNAVKQRR 357

Query: 68  E 68
           E
Sbjct: 358 E 358

>CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1, start by similarity
          Length = 431

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 110 LQFLVEIDYKGDMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYL 162
           L+  ++ID    +   +S  L LNYP      LP+ L +S +   A CL   L
Sbjct: 272 LEAKIDIDLNDKITFGMSTRLLLNYPKKCTAALPIDLAVSMVRFQA-CLTVSL 323

>AER411W [2911] [Homologous to ScYOR086C - SH; ScYNL087W - SH]
           complement(1425883..1429452) [3570 bp, 1189 aa]
          Length = 1189

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 13  DPIVNNSIKDFLNSHL-QSISLPSYVGSLRVTDFCLGCTPPKI 54
           +P ++  + D +N  L ++ S+P ++ SL +  F LG  PP+I
Sbjct: 201 EPNISVMVVDQVNHELAKNPSVPGFIKSLWIDQFTLGVKPPRI 243

>YLR144C (ACF2) [3553] chr12 complement(429678..432017)
           Endo-1,3-beta-glucanase involved in cortical actin
           assembly, has similarity to C. albicans Eng2p [2340 bp,
           779 aa]
          Length = 779

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 144 VKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILDAQESNIDTGSAAFLGNRSLERIS 203
           +KL   D+   ++CL+  LS   FI F        + A   ++     + +G RSLERIS
Sbjct: 191 IKLEFRDMKHMSMCLLMSLSSSQFIEFPLVQGMGFVTAIYHDLGFELRSAVGFRSLERIS 250

Query: 204 L 204
           +
Sbjct: 251 V 251

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
            complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 237  EVFRTILKTEAAWPSWINLDFNEEYSEDEASD 268
            +VF+ IL  +  WPS+ N +   EY   EA D
Sbjct: 1048 DVFKNILSGQIDWPSFPNKETELEYLSPEAKD 1079

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,361,190
Number of extensions: 321676
Number of successful extensions: 1132
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1125
Number of HSP's successfully gapped: 29
Length of query: 277
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 177
Effective length of database: 13,134,309
Effective search space: 2324772693
Effective search space used: 2324772693
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)