Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.224961941929581e-134
ACL012W2041754552e-57
Sklu_2419.52051824501e-56
Scas_644.122101614334e-54
CAGL0E02387g1951904031e-49
KLLA0C06050g2051753943e-48
YOL008W2071753892e-47
AFR281C66042632.7
CAGL0C00407g55040632.7
Sklu_2115.61079106607.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22496
         (192 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22496                                                         373   e-134
ACL012W [1037] [Homologous to ScYOL008W - SH] complement(336674....   179   2e-57
Sklu_2419.5 YOL008W, Contig c2419 6103-6720                           177   1e-56
Scas_644.12                                                           171   4e-54
CAGL0E02387g 227464..228051 similar to tr|Q08058 Saccharomyces c...   159   1e-49
KLLA0C06050g 533200..533817 similar to sgd|S0005368 Saccharomyce...   156   3e-48
YOL008W (YOL008W) [4808] chr15 (310312..310935) Member of the UP...   154   2e-47
AFR281C [3473] [Homologous to ScYIL144W (TID3) - SH] (941614..94...    29   2.7  
CAGL0C00407g 40815..42467 similar to tr|Q12418 Saccharomyces cer...    29   2.7  
Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement         28   7.5  

>Kwal_56.22496
          Length = 194

 Score =  373 bits (958), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/192 (93%), Positives = 180/192 (93%)

Query: 1   MIKLSTRSRCLNAFSQSKIVQRRSFLTSTDSKVQTFLLTRTINAPXXXXXXXXXXXXEYH 60
           MIKLSTRSRCLNAFSQSKIVQRRSFLTSTDSKVQTFLLTRTINAP            EYH
Sbjct: 1   MIKLSTRSRCLNAFSQSKIVQRRSFLTSTDSKVQTFLLTRTINAPISDVYSVVSDISEYH 60

Query: 61  KFIPYCLESFVNKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTH 120
           KFIPYCLESFVNKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTH
Sbjct: 61  KFIPYCLESFVNKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTH 120

Query: 121 SLFDFLQTKWTMRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRI 180
           SLFDFLQTKWTMRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRI
Sbjct: 121 SLFDFLQTKWTMRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRI 180

Query: 181 YQLAKRQASARP 192
           YQLAKRQASARP
Sbjct: 181 YQLAKRQASARP 192

>ACL012W [1037] [Homologous to ScYOL008W - SH]
           complement(336674..337288) [615 bp, 204 aa]
          Length = 204

 Score =  179 bits (455), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 120/175 (68%), Gaps = 3/175 (1%)

Query: 20  VQRRSFL--TSTDSKVQTFLLTRTINAPXXXXXXXXXXXXEYHKFIPYCLESFVNKKDDT 77
           V RR+FL  T  D+K Q ++L R  NAP             Y  FIPYC +SFVNK+   
Sbjct: 24  VSRRTFLGFTGGDTKEQRYILKRVFNAPLHYVYPAVSEVSLYKLFIPYCTDSFVNKRRPG 83

Query: 78  TGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTHSLFDFLQTKWTMRPHPS 137
              PTEAG+RVGFQ+YDETFVC+++C+  P ++  VVA+SL H LF+ L T+W + PHP+
Sbjct: 84  DNMPTEAGLRVGFQQYDETFVCRVDCTTLPGNQRSVVAESLAHHLFETLHTQWLLSPHPT 143

Query: 138 RHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQLAKRQASARP 192
           R +A+  EL L+FKFK  LYN+++SIFG  VT+ VMK+F++R++QL +++A  RP
Sbjct: 144 RPDASVVELILRFKFKSQLYNSVSSIFGTRVTQVVMKAFEKRVFQL-RKEAMDRP 197

>Sklu_2419.5 YOL008W, Contig c2419 6103-6720
          Length = 205

 Score =  177 bits (450), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 116/182 (63%), Gaps = 5/182 (2%)

Query: 15  SQSKIVQRRSFL-----TSTDSKVQTFLLTRTINAPXXXXXXXXXXXXEYHKFIPYCLES 69
           S S  V RRS       +  +++ Q ++L +TINAP            +Y +F+PYC+ES
Sbjct: 20  SVSNTVFRRSLFGLSNHSFNNTREQRYVLCKTINAPTVNVYEVVSEVSQYKEFMPYCVES 79

Query: 70  FVNKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTHSLFDFLQTK 129
           FVNK++  TGKP EAG+ + F+ Y E FVC++ C         VVA+SLTH+LFD L TK
Sbjct: 80  FVNKRNQDTGKPVEAGLMISFKHYVEKFVCKVECDSKLEGIKTVVAESLTHTLFDLLYTK 139

Query: 130 WTMRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQLAKRQAS 189
           WT+ PHP+R N TE EL L+FKF   LYN+I+SIF KSVT  VMK+F++RI+QL K    
Sbjct: 140 WTIAPHPTRPNVTEVELLLRFKFHSKLYNSISSIFAKSVTGLVMKAFEKRIFQLKKESMK 199

Query: 190 AR 191
            +
Sbjct: 200 VK 201

>Scas_644.12
          Length = 210

 Score =  171 bits (433), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 112/161 (69%), Gaps = 1/161 (0%)

Query: 26  LTSTDSKVQTFLLTRTINAPXXXXXXXXXXXXEYHKFIPYCLESFVNKKDDTTGKPTEAG 85
           L S + K Q + L +TIN+P            +Y+KFIPYC ESFV K++   GKPT AG
Sbjct: 32  LGSPEVKEQRYTLLKTINSPPTDVYNVVSEVSQYYKFIPYCTESFVEKRNLLDGKPTIAG 91

Query: 86  MRVGFQRYDETFVCQINCSKGPSDRHVVV-ADSLTHSLFDFLQTKWTMRPHPSRHNATEA 144
           +RVGF++YDE FVC+++C    +DR   V A+SL+H+LF  L +KWT+RPHP R   TE 
Sbjct: 92  LRVGFKQYDEKFVCEVSCKDLLADRDFTVEANSLSHNLFHLLYSKWTIRPHPRRPQTTEV 151

Query: 145 ELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQLAK 185
           ELSL+FKFK  LYN ++SIF KSVT+ VM +F++R+++L +
Sbjct: 152 ELSLRFKFKSRLYNAVSSIFAKSVTKLVMDAFEKRVFELKR 192

>CAGL0E02387g 227464..228051 similar to tr|Q08058 Saccharomyces
           cerevisiae YOL008w, hypothetical start
          Length = 195

 Score =  159 bits (403), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 115/190 (60%), Gaps = 8/190 (4%)

Query: 9   RCLNAFSQSKIVQRRSFLTSTDS----KVQTFLLTRTINAPXXXXXXXXXXXXEYHKFIP 64
           RCLN  S  +    R F    +     K Q ++L + I               +YH+FIP
Sbjct: 7   RCLNR-SLLRPFGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIP 65

Query: 65  YCLESFVNKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVV--ADSLTHSL 122
           YC +SFVN++DD+  KP  AG+RVGF++YDE FVC ++C    S + V V  A+SL+H+L
Sbjct: 66  YCEDSFVNERDDS-NKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESLSHNL 124

Query: 123 FDFLQTKWTMRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQ 182
           FD L ++WT+  HP+R +A+  EL LKFKFK  LYN+I+SIF KSVTE VM +F RR+Y 
Sbjct: 125 FDILSSQWTISTHPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFARRVYH 184

Query: 183 LAKRQASARP 192
           L K      P
Sbjct: 185 LKKAAVLENP 194

>KLLA0C06050g 533200..533817 similar to sgd|S0005368 Saccharomyces
           cerevisiae YOL008w, start by similarity
          Length = 205

 Score =  156 bits (394), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 109/175 (62%), Gaps = 5/175 (2%)

Query: 16  QSKIVQRRSFL---TSTDSK-VQTFLLTRTINAPXXXXXXXXXXXXEYHKFIPYCLESFV 71
           Q+  + +RSF    T   SK  Q ++L R I                Y  FIPYC ESFV
Sbjct: 23  QASALGKRSFFNLTTEASSKDEQHYVLKRNIRGTPNEVYEVVSEVSNYKDFIPYCTESFV 82

Query: 72  NKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTHSLFDFLQTKWT 131
           N +D+   +P EAG+RVGFQ+YDE FVC++ C +       V A+SL+H+LF  L +KW 
Sbjct: 83  NLRDEKN-RPVEAGLRVGFQQYDEKFVCKVQCKELSDLVKSVTAESLSHNLFHVLNSKWV 141

Query: 132 MRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQLAKR 186
           ++ HP R + TE EL L+++FK  LY ++AS+F KSVTE ++K+FDRR+YQL K+
Sbjct: 142 IKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKKK 196

>YOL008W (YOL008W) [4808] chr15 (310312..310935) Member of the
           UPF0083 uncharacterized protein family, has moderate
           similarity to uncharacterized C. albicans Orf6.6771p
           [624 bp, 207 aa]
          Length = 207

 Score =  154 bits (389), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 113/175 (64%), Gaps = 6/175 (3%)

Query: 22  RRSF--LTSTDSKV--QTFLLTRTINAPXXXXXXXXXXXXEYHKFIPYCLESFVNKKDDT 77
           +R+F  L+ T+  +  Q ++L + INAP            +Y +FIPYC++SFV+K++  
Sbjct: 28  KRNFFGLSGTNHTIREQRYVLRKAINAPPSTVYAAVSEVAQYKEFIPYCVDSFVDKRNPV 87

Query: 78  TGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTHSLFDFLQTKWTMRPHPS 137
             KP  AG+RVGF++YDE F+C + C K     + VVA++++H+LF  L +KWT+ PHP+
Sbjct: 88  DNKPLIAGLRVGFKQYDEEFICNVTC-KDTDHTYTVVAETISHNLFHLLISKWTIMPHPN 146

Query: 138 RHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQLAKRQASARP 192
           R NA   EL L+FKFK  +YN+++ IF K+VTE VM +F +R Y L  R A  +P
Sbjct: 147 RPNAAMVELLLRFKFKSRIYNSVSLIFAKTVTELVMNAFAKRAYHLV-RLAMLKP 200

>AFR281C [3473] [Homologous to ScYIL144W (TID3) - SH]
           (941614..943596) [1983 bp, 660 aa]
          Length = 660

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 61  KFIPYCLESFVNKKDDTTGKPTEAGMRVGFQRYDETFVCQIN 102
           ++I  C +SF+N +DD +  P +  + +GF R+       IN
Sbjct: 267 EYISKCYKSFINMEDDFS--PFKEELEIGFDRFVHIIETDIN 306

>CAGL0C00407g 40815..42467 similar to tr|Q12418 Saccharomyces
           cerevisiae YLR094c GIS3, hypothetical start
          Length = 550

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 80  KPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLT 119
           KPT++G+ +  +  DET  C IN   G + R  +  D+L+
Sbjct: 142 KPTDSGILLKRKLSDETHNCNINTDSGFNFRESLKLDTLS 181

>Sklu_2115.6 YGL156W, Contig c2115 5286-8525 reverse complement
          Length = 1079

 Score = 27.7 bits (60), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 13/106 (12%)

Query: 66  CLESFVNKKDDTTGKPTEAGMRVGFQRYDETF-VCQINCSKGPSDRHVVVADSLTHSLFD 124
           C   F +  D + G       + GF  +     +  +  SK P D H   AD  +H +  
Sbjct: 878 CHHKFADYSDFSKGVSIMNNCKYGFATHGNLMRLSLLRSSKAP-DAH---ADMGSHEI-- 931

Query: 125 FLQTKWTMRPHPSRHNATEAELSLK--FKFKFSLYNNIASIFGKSV 168
               K+ + PH    +A   +L+L+  F +K+ + +NIA  F + +
Sbjct: 932 ----KYALYPHKGALSAETVKLALQLNFGYKYGVASNIAKQFNEVI 973

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,409,307
Number of extensions: 198143
Number of successful extensions: 441
Number of sequences better than 10.0: 13
Number of HSP's gapped: 436
Number of HSP's successfully gapped: 13
Length of query: 192
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 96
Effective length of database: 13,272,781
Effective search space: 1274186976
Effective search space used: 1274186976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 58 (26.9 bits)