Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.224921521513742e-46
YMR002W1561552812e-32
Sklu_2419.61581572709e-31
KLLA0C06094g1491532631e-29
CAGL0J11682g1591602631e-29
ACL010C1531462231e-23
Scas_686.141521031942e-19
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22492
         (151 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22492                                                         148   2e-46
YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the DU...   112   2e-32
Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement        108   9e-31
KLLA0C06094g complement(535470..535919) similar to sp|Q03667 Sac...   105   1e-29
CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces...   105   1e-29
ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [...    91   1e-23
Scas_686.14                                                            79   2e-19

>Kwal_56.22492
          Length = 152

 Score =  148 bits (374), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 82/151 (54%)

Query: 1   MARSRGGVRSRPAPAQTRSASTMXXXXXXXXXXXXXXXXXXXXXXXXXRQPGLFAQMXXX 60
           MARSRGGVRSRPAPAQTRSASTM                         RQPGLFAQM   
Sbjct: 1   MARSRGGVRSRPAPAQTRSASTMAAHPPAQQHAAPSSAYSHPQSAAQPRQPGLFAQMAST 60

Query: 61  XXXXXXXXXXXXXXXXXLTGMFSGSSSXXXXXXXXXXXXXXXXXXXXXXXXRACDVDARS 120
                            LTGMFSGSSS                        RACDVDARS
Sbjct: 61  AAGVAVGSAVGHTVGAGLTGMFSGSSSAPAEQQQQQLAAAPAQQGFAQEQGRACDVDARS 120

Query: 121 FTRCLEENNGNMQICDFYLQQLKACQEAARQ 151
           FTRCLEENNGNMQICDFYLQQLKACQEAARQ
Sbjct: 121 FTRCLEENNGNMQICDFYLQQLKACQEAARQ 151

>YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the
           DUF657 protein of unknown function family, which may
           bind metal, has high similarity to uncharacterized C.
           albicans Orf6.159p [471 bp, 156 aa]
          Length = 156

 Score =  112 bits (281), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 74/155 (47%), Gaps = 4/155 (2%)

Query: 1   MARSRGGVR--SRPAPAQTRSASTMXXXXXXXXXXXXXXXXXXXXXXXXXRQPGLFAQMX 58
           MARSRG  R  SR  P QTRSASTM                         RQPG+FAQM 
Sbjct: 1   MARSRGSSRPISRSRPTQTRSASTMAAPVHPQQQQQPNAYSHPPAAGAQTRQPGMFAQMA 60

Query: 59  XXXXXXXXXXXXXXXXXXXLTGMFSGSSSXXXXXXXXXXXXXXXXXXXXXXXX--RACDV 116
                              +TGMFSGS S                          R C++
Sbjct: 61  STAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEI 120

Query: 117 DARSFTRCLEENNGNMQICDFYLQQLKACQEAARQ 151
           DAR+FTRCL+ENNGN QICD+YLQQLKACQEAARQ
Sbjct: 121 DARNFTRCLDENNGNFQICDYYLQQLKACQEAARQ 155

>Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement
          Length = 158

 Score =  108 bits (270), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 71/157 (45%), Gaps = 6/157 (3%)

Query: 1   MARSRGGVRSRPAPAQTRSASTMXX---XXXXXXXXXXXXXXXXXXXXXXXRQPGLFAQM 57
           MARSRG  RS   P  TRSASTM                            +QPGLFAQM
Sbjct: 1   MARSRGSARSAARPTHTRSASTMAAPPPSSAHVQPQQTAYSHPPAAAGAQPQQPGLFAQM 60

Query: 58  XXXXXXXXXXXXXXXXXXXXLTGMFSGSSSXXXXXXXXXXXXXXXXXXXXXXXXR---AC 114
                               LTG+FSGS S                             C
Sbjct: 61  ASTAAGVAVGSAVGHTVGAGLTGLFSGSGSSAAPAEQQQQQQLAAAPAQQSLAQNQATHC 120

Query: 115 DVDARSFTRCLEENNGNMQICDFYLQQLKACQEAARQ 151
           DVDAR+FTRCLEEN+GN QICDFYLQQLKACQEAARQ
Sbjct: 121 DVDARNFTRCLEENDGNFQICDFYLQQLKACQEAARQ 157

>KLLA0C06094g complement(535470..535919) similar to sp|Q03667
           Saccharomyces cerevisiae YMR002w singleton, start by
           similarity
          Length = 149

 Score =  105 bits (263), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 74/153 (48%), Gaps = 7/153 (4%)

Query: 1   MARSRGGVR--SRPAPAQTRSASTMXXXXXXXXXXXXXXXXXXXXXXXXXRQPGLFAQMX 58
           MARSRG  R  SRP   QTRSAST+                         +QPG+FAQM 
Sbjct: 1   MARSRGSARPVSRP---QTRSASTVAAPAPAQHQAPNAYSHPPHTAQP--QQPGMFAQMA 55

Query: 59  XXXXXXXXXXXXXXXXXXXLTGMFSGSSSXXXXXXXXXXXXXXXXXXXXXXXXRACDVDA 118
                              +TGMFSGSSS                          CDVDA
Sbjct: 56  STAAGVAVGSTIGHTLGAGITGMFSGSSSAPAEQQQQQVAAPVQADTFQNQQATHCDVDA 115

Query: 119 RSFTRCLEENNGNMQICDFYLQQLKACQEAARQ 151
           R+FTRCLE+N GNMQICD+YLQQLKACQEAARQ
Sbjct: 116 RNFTRCLEDNGGNMQICDYYLQQLKACQEAARQ 148

>CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces
           cerevisiae YMR002w, start by similarity
          Length = 159

 Score =  105 bits (263), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 75/160 (46%), Gaps = 11/160 (6%)

Query: 1   MARSRGGVRSRPA--------PAQTRSASTMXXXXXXXXXXXXXXXXXXXXXXXXXRQPG 52
           MARSRGG  SRPA        P Q+RSAST                          +QPG
Sbjct: 1   MARSRGG--SRPAGRSSAFSRPQQSRSASTAAYPAAPPRQQPVAPANAHPQAGAQPQQPG 58

Query: 53  LFAQMXXXXXXXXXXXXXXXXXXXXLTGMFSGS-SSXXXXXXXXXXXXXXXXXXXXXXXX 111
           LFAQM                    +TGMFSGS SS                        
Sbjct: 59  LFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDAAAQQQQQQF 118

Query: 112 RACDVDARSFTRCLEENNGNMQICDFYLQQLKACQEAARQ 151
           R CD DA++FTRCL+ENNGN QICD+YLQQLKACQEAARQ
Sbjct: 119 RTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAARQ 158

>ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [462
           bp, 153 aa]
          Length = 153

 Score = 90.5 bits (223), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 63/146 (43%), Gaps = 3/146 (2%)

Query: 1   MARSRGGVRSRPAPAQTRSASTMXXXXXXXXXXXXXXXXXXXXXXXXXRQPGLFAQMXXX 60
           MARSRG  R RPAP Q+RSAS+M                            GLFAQM   
Sbjct: 1   MARSRGPAR-RPAPVQSRSASSMAAPAAHAPPAPAPAAHAPAQAAPQQP--GLFAQMAST 57

Query: 61  XXXXXXXXXXXXXXXXXLTGMFSGSSSXXXXXXXXXXXXXXXXXXXXXXXXRACDVDARS 120
                            LTG+FSGS S                        R CD DAR+
Sbjct: 58  AAGVAVGSAVGHTIGAGLTGLFSGSGSAPAEAQPQQLAAAPVQQDTFQTQARHCDTDARN 117

Query: 121 FTRCLEENNGNMQICDFYLQQLKACQ 146
           FTRCLE+NNGN QICD+YLQQ +  Q
Sbjct: 118 FTRCLEDNNGNFQICDYYLQQFEGLQ 143

>Scas_686.14
          Length = 152

 Score = 79.3 bits (194), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 51/103 (49%), Gaps = 2/103 (1%)

Query: 49  RQPGLFAQMXXXXXXXXXXXXXXXXXXXXLTGMFSGSSSXXXXXXXXXXXXXXXXXXXXX 108
           RQPG+FAQM                    L G   GS+                      
Sbjct: 51  RQPGMFAQMASTAAGVAVGSTVGHAVSGLLFG--GGSAPAEQPVQQQAMDPYASQRTLDQ 108

Query: 109 XXXRACDVDARSFTRCLEENNGNMQICDFYLQQLKACQEAARQ 151
              ++CD  A+SFT+CL+ENNGN QICD+YLQQLKACQEAARQ
Sbjct: 109 EPAQSCDGAAKSFTKCLDENNGNFQICDYYLQQLKACQEAARQ 151

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.128    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,088,755
Number of extensions: 34195
Number of successful extensions: 101
Number of sequences better than 10.0: 8
Number of HSP's gapped: 85
Number of HSP's successfully gapped: 8
Length of query: 151
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 59
Effective length of database: 13,411,253
Effective search space: 791263927
Effective search space used: 791263927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 57 (26.6 bits)