Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_56.2248830830411591e-161
Sklu_2419.73072393375e-37
Scas_644.133432312898e-30
YOL007C3412282783e-28
CAGL0E02409g3572272671e-26
ACL009C3211721861e-15
Kwal_23.487830779947e-04
CAGL0J10076g37862870.007
KLLA0F03465g35975800.044
Scas_694.2638259800.046
YIL117C (PRM5)31824790.057
YNL058C31640740.26
Scas_671.34323139720.42
ADL251C23673671.3
Scas_715.5110276644.8
KLLA0D01452g144560629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.22488
         (304 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.22488                                                         451   e-161
Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement       134   5e-37
Scas_644.13                                                           115   8e-30
YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protei...   111   3e-28
CAGL0E02409g complement(228503..229576) similar to sp|Q08054 Sac...   107   1e-26
ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [...    76   1e-15
Kwal_23.4878                                                           41   7e-04
CAGL0J10076g complement(985926..987062) weakly similar to sp|P53...    38   0.007
KLLA0F03465g complement(325270..326349) no similarity, hypotheti...    35   0.044
Scas_694.26                                                            35   0.046
YIL117C (PRM5) [2559] chr9 complement(140610..141566) Protein tr...    35   0.057
YNL058C (YNL058C) [4531] chr14 complement(515761..516711) Protei...    33   0.26 
Scas_671.34                                                            32   0.42 
ADL251C [1490] [Homologous to ScYNL058C - SH; ScYIL117C (PRM5) -...    30   1.3  
Scas_715.5                                                             29   4.8  
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    28   9.9  

>Kwal_56.22488
          Length = 308

 Score =  451 bits (1159), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 233/304 (76%), Positives = 233/304 (76%)

Query: 1   MKPAYIWTLISLIICFASATTEFNRAFHSLRKRAHSMPXXXXXXXXXXXXXXXXXXXXXX 60
           MKPAYIWTLISLIICFASATTEFNRAFHSLRKRAHSMP                      
Sbjct: 1   MKPAYIWTLISLIICFASATTEFNRAFHSLRKRAHSMPSLTTSKSVSSTSTSSSKSGTSA 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYTPTFTPKVPDSTGNKNIARTSYRNGTVFI 120
                                         YTPTFTPKVPDSTGNKNIARTSYRNGTVFI
Sbjct: 61  TTHSSAHSSVTSTQATSSSGSSLTSSTQSSYTPTFTPKVPDSTGNKNIARTSYRNGTVFI 120

Query: 121 AVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQNRYQTDPFLFHTXXXXXXXXXX 180
           AVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQNRYQTDPFLFHT          
Sbjct: 121 AVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQNRYQTDPFLFHTSEGDSDSSEG 180

Query: 181 XXXXXXXXXVLKTRASTRPSIYSLGSQSTLNLLQRHPQDNAHITTANRGSMFISPTEIIK 240
                    VLKTRASTRPSIYSLGSQSTLNLLQRHPQDNAHITTANRGSMFISPTEIIK
Sbjct: 181 SDRSDVSERVLKTRASTRPSIYSLGSQSTLNLLQRHPQDNAHITTANRGSMFISPTEIIK 240

Query: 241 NSANNKSLMSLATPTSENFNITPVLNTDLTSHFDPIYQKSLPANDPNNVNRKARPPSVHL 300
           NSANNKSLMSLATPTSENFNITPVLNTDLTSHFDPIYQKSLPANDPNNVNRKARPPSVHL
Sbjct: 241 NSANNKSLMSLATPTSENFNITPVLNTDLTSHFDPIYQKSLPANDPNNVNRKARPPSVHL 300

Query: 301 EKMF 304
           EKMF
Sbjct: 301 EKMF 304

>Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement
          Length = 307

 Score =  134 bits (337), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 122/239 (51%), Gaps = 29/239 (12%)

Query: 94  TFTPKVPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYH 153
           TF P +P +  NKNI  TSY  GTVFI +G  MG I ++FT+ WL L  +AW+ ARKEY 
Sbjct: 66  TFMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYK 125

Query: 154 LDAIQNRYQTDPFLFH---TXXXXXXXXXXXXXXXXXXXVLKTRASTRPSIYSLGSQSTL 210
           L A++N+YQ DPF F+   T                   VLK   S R S +SLGS STL
Sbjct: 126 LQALENKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQSRRKSTHSLGSSSTL 185

Query: 211 NLLQRHPQDNAH---ITTANRGSMFISPTEII--KNSA----NNKSLMSLATPTSENFNI 261
           NLL ++           T++R SMFISPTEI+  +NS+    N  S     T T     I
Sbjct: 186 NLLNKYENGGKQAVPAVTSSRASMFISPTEILQQQNSSYLNFNGTSQEGSTTSTPTEKTI 245

Query: 262 TPVLNTDLTSHFDP-------IYQK-------SLPAND--PNNVNRKARPPSVHLEKMF 304
           T  + +   + FD        +++        S+P +D       +  RPPSVHL++MF
Sbjct: 246 TQFIGST-PNCFDRGRAPGVLLFENPTDALTVSVPLSDTRQEQTRKSFRPPSVHLDQMF 303

>Scas_644.13
          Length = 343

 Score =  115 bits (289), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 109/231 (47%), Gaps = 26/231 (11%)

Query: 100 PDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQN 159
           P++ GN NI  T+Y +GTVFIA G  +  I LI ++ W  L  KAW   RKEY L A++ 
Sbjct: 108 PNTNGNYNIYHTNYTDGTVFIAFGSCLLFITLILSVVWAVLGLKAWRDERKEYQLRALEE 167

Query: 160 RYQTDPFLFHTXXXXXXXXXXXXXXXXXXXVLKTRASTRPSIYSLGSQSTLNLLQRHPQD 219
           +YQ DPF                           + S+R S YSLG+ S LNLL     D
Sbjct: 168 KYQYDPFQLQNEIDDSRSNSDNDSQSDISEKYLKQKSSRMSFYSLGTASALNLLNPKAND 227

Query: 220 NAHITTAN---------RGSMFISPTEIIKNSA--NNKSLM---SLATPTSENFNITPVL 265
                  N         R SMFISPTEI++     NN S +   +++TP  E  + T V+
Sbjct: 228 KYSDDDTNKINSAASNFRKSMFISPTEILQQDIPFNNDSSIFDSAISTPKGEQTSTTQVI 287

Query: 266 ----NTDLTSHFDPIYQ-------KSLPANDPNNVNRKA-RPPSVHLEKMF 304
               N +     D  +Q         LP+++ NN  +K  RPPS HL+++ 
Sbjct: 288 ANPDNNNWGLLNDSSFQGLGLKLDSELPSSNENNQKKKNYRPPSAHLDQLL 338

>YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protein
           of unknown function [1026 bp, 341 aa]
          Length = 341

 Score =  111 bits (278), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 119/228 (52%), Gaps = 27/228 (11%)

Query: 99  VPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQ 158
           +P + GNK + +  + NGTVFIA  G +G I L  T  W+ L  K+W SARKE  L  ++
Sbjct: 115 IPVTDGNKFLYQAHHPNGTVFIAFAGCLGAILLSLTGAWIALNIKSWRSARKENKLRNLE 174

Query: 159 NRYQTDPFLFHT--XXXXXXXXXXXXXXXXXXXVLKTRASTRPSIYSLGSQSTLNLLQRH 216
           N+YQ DPF F T                     VLK  +S R S+Y+LGS S LNLL   
Sbjct: 175 NQYQHDPFYFQTNINDDESETSSHSDDSDISEKVLKNNSS-RMSLYTLGSTSVLNLLNNK 233

Query: 217 PQDNAHITTANRGSMFISPTEIIKNSANNKSLMSLATPTS--ENFNITP-------VLN- 266
              N +     R SMFISPTEI+++ ANN +  S +  ++  ++ + TP       +L  
Sbjct: 234 TDANDNF----RSSMFISPTEILQSDANNSNTWSQSNESAIYDSLSSTPREPGATQILGK 289

Query: 267 -TDLTSHFD-PIYQKSLPAND----PNNVN----RKARPPSVHLEKMF 304
            TD T+ F+   Y  S  + D     +NV+    +K RPPSVHL+++ 
Sbjct: 290 FTDSTNPFNYTSYNLSPDSEDRSTPKSNVSQGKVKKYRPPSVHLDQLL 337

>CAGL0E02409g complement(228503..229576) similar to sp|Q08054
           Saccharomyces cerevisiae YOL007c CSI2 involved in chitin
           synthesis, hypothetical start
          Length = 357

 Score =  107 bits (267), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 103/227 (45%), Gaps = 21/227 (9%)

Query: 99  VPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQ 158
           +P +  NK +   ++ +GTVF A G  +  IAL+  L W+ L  ++W +ARKEY +   +
Sbjct: 127 IPSAQNNKYVYHATHPSGTVFTAFGSCLAFIALVLVLVWIALTLRSWKNARKEYQIRERE 186

Query: 159 NRYQTDPFLFHTXXXXXXXXXXXXXXXXXXXVLKTRASTRPSIYSLGSQSTLNLLQRHPQ 218
           N+YQ DP+ F                      +  + ++R S+YSLG  S  NLL     
Sbjct: 187 NKYQLDPYYFQNGDKDDYSSSDSDVASDISEKILKKKASRMSLYSLGGGSAFNLLSSEKL 246

Query: 219 DN---AHITTANRGSMFISPTEIIKNSANNKSLMSLA------TPTSENFNITPVLNTDL 269
           D    A  +   R SMFISPTEI+KN  N  S  S A      TP  ++     V    L
Sbjct: 247 DTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDSSAFNSLTSTPREQSVANIIVPQNGL 306

Query: 270 TSHFDPIY-QKSLPAND-----------PNNVNRKARPPSVHLEKMF 304
               DP +  K+L   D           PN   ++ RPPS HL+ + 
Sbjct: 307 NKLGDPPFTGKNLSNMDISSTPGVAIPKPNGNQKRGRPPSAHLDDLL 353

>ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [966
           bp, 321 aa]
          Length = 321

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 14/172 (8%)

Query: 95  FTPKVPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHL 154
           +TP +P    N+NI ++   +G +F+A G  + V+   F ++W  +  ++W+ ARKE+  
Sbjct: 117 YTPGIPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRF 176

Query: 155 DAIQNRYQTDPFLFHTXXXXXXXXXXXXXXXXXXXVLKTRAS---TRPSIYSLGSQSTLN 211
            A+ +RYQ      +                    VLK R      R S+YSLGS S+L 
Sbjct: 177 QAMASRYQ------NAALYNLSSDSADSAPYDSDLVLKVRKMDQLNRLSLYSLGSMSSLG 230

Query: 212 LLQRHPQDNAHITTANRGSMFISPTEIIKNSANNKSLMSLATPTSENFNITP 263
             + H +D    +  NR SM+ISPT +I+    ++ L  L+T T    ++TP
Sbjct: 231 GGE-HSKDANRRSLENRASMYISPTNLIQ----HQKLFMLSTRTPSTLSLTP 277

>Kwal_23.4878
          Length = 307

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 92  TPTFTPKVPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKE 151
           TPT TP  P   GN +I  ++  +GTVFIAVG  +G I L+  L ++     A+ S R+ 
Sbjct: 51  TPTITP--PSIKGNPHIWSSNKPSGTVFIAVGSIVGFIFLVIVLAYV---ISAYISRRQT 105

Query: 152 YHLDAIQNRYQTDPFLFHT 170
             L     RY++    FH+
Sbjct: 106 DKL-----RYESVDHEFHS 119

>CAGL0J10076g complement(985926..987062) weakly similar to sp|P53947
           Saccharomyces cerevisiae YNL058c, hypothetical start
          Length = 378

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 100 PDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQN 159
           P +  N  I RTS  +GTVFIAVG   G I ++  L W       +   +K+Y L+++  
Sbjct: 99  PSAENNPYIFRTSALSGTVFIAVGSIAGAILMLIFLWWSITKYLNYKRTKKDY-LESMAT 157

Query: 160 RY 161
           +Y
Sbjct: 158 QY 159

>KLLA0F03465g complement(325270..326349) no similarity, hypothetical
           start
          Length = 359

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 11/75 (14%)

Query: 98  KVPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTL-----TWLGLAAKAWHSARKEY 152
           ++P + GN NI  ++   GTVFIAVG   G I L   +     TW+     ++  A++  
Sbjct: 93  ELPSAKGNPNIWSSNKPTGTVFIAVGSAAGFIFLALLVWFIINTWM-----SYSQAKQLK 147

Query: 153 HLDAIQNRYQTDPFL 167
             + ++ ++Q +PF+
Sbjct: 148 KFNNMEKQFQ-NPFI 161

>Scas_694.26
          Length = 382

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 93  PTFTPKVPDSTGNKNI-ARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARK 150
           PT  P  P +  N  I  ++ + +GTVFIAVG  +G I L   + W+ L+  +  +A++
Sbjct: 86  PTIVP--PSADNNPYILGKSKHPDGTVFIAVGTLVGFIFLALLVRWVTLSVLSRRNAKR 142

>YIL117C (PRM5) [2559] chr9 complement(140610..141566) Protein
           transcriptionally regulated by cell stress, the
           pheromone response pathway, and the cell integrity
           signaling pathway [957 bp, 318 aa]
          Length = 318

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 16/24 (66%)

Query: 115 NGTVFIAVGGTMGVIALIFTLTWL 138
           NGTVFI VGG  GVI L   L W+
Sbjct: 74  NGTVFIVVGGIAGVIFLAILLWWV 97

>YNL058C (YNL058C) [4531] chr14 complement(515761..516711) Protein
           of unknown function [951 bp, 316 aa]
          Length = 316

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 100 PDSTGNKNIARTSYR-NGTVFIAVGGTMGVIALIFTLTWL 138
           P + GN  I   + + NGTV+IAVG  +G I +   + WL
Sbjct: 74  PSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWL 113

>Scas_671.34
          Length = 323

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 55/139 (39%), Gaps = 23/139 (16%)

Query: 115 NGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHLDAIQNRYQTDPFLFHTXXXX 174
           NGTVFI VG  +G +  I +L W G+    + S R  +    +  +Y   P+        
Sbjct: 94  NGTVFIIVGSVLGAVFAILSL-WWGIT--TYLSYRTAHRQSILTEKYNA-PYNIQKVVSN 149

Query: 175 XXXXXXXXXXXXXXXVLKTRASTRPSIYSLGSQSTLNLLQRHP---------QD---NAH 222
                              +AS       + SQ +  LL+R           +D   +  
Sbjct: 150 DSDYSVEIDTEKGLEKPSNKASP------IVSQESKELLKRSSFLSGFYDSFEDSVLDTP 203

Query: 223 ITTAN-RGSMFISPTEIIK 240
           I+  N R S+F+SPTE+I+
Sbjct: 204 ISNNNVRNSLFVSPTELIQ 222

>ADL251C [1490] [Homologous to ScYNL058C - SH; ScYIL117C (PRM5) -
           SH] (259355..260065) [711 bp, 236 aa]
          Length = 236

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 92  TPTFTPKVPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKE 151
            P  TP  P +  N NI ++S   G VFI VG     + LI  + +L     +    RK 
Sbjct: 25  VPFVTP--PSAANNPNIWKSSQPPGAVFIFVGAVAAGVFLILIIWYLVTEHISRRETRKS 82

Query: 152 YHLDAIQNRYQTD 164
            + + I+  ++ D
Sbjct: 83  QY-EGIEELFKDD 94

>Scas_715.5
          Length = 1102

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 207 QSTLNLLQ--RHPQDNAHITTANRGSMFISPTEIIKNSANNKSLMSLATPTSENFNITPV 264
           Q+ +++++  R  Q    +T  N+    +S  ++  N+ N K+L  L   +S + NI   
Sbjct: 765 QTIIDMIENSRQKQHEVDMTILNKSQAILSNMDMESNATNEKNLQKLQIQSSNSLNIIDK 824

Query: 265 LNTDLTSHFDPIYQKS 280
              +L   F+ +Y K 
Sbjct: 825 NLHELPQKFELMYSKE 840

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
            lactis Cat8p, start by similarity
          Length = 1445

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 216  HPQDNAHITTANRGSMFISPTEIIKNSANNKSLM-SLATPTSENFNITPVLNTDLTSHFD 274
            H QDN H  T    +  +   E++K+     ++     T   E F + PVLNT+L S+ D
Sbjct: 1022 HSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNTD 1081

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.130    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,903,191
Number of extensions: 279780
Number of successful extensions: 997
Number of sequences better than 10.0: 33
Number of HSP's gapped: 979
Number of HSP's successfully gapped: 34
Length of query: 304
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 203
Effective length of database: 13,099,691
Effective search space: 2659237273
Effective search space used: 2659237273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)